Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sperm-associated antigen 6

Gene

SPAG6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Important for structural integrity of the central apparatus in the sperm tail and for flagellar motility.By similarity1 Publication

GO - Biological processi

  • cell projection organization Source: UniProtKB-KW
  • spermatid development Source: ProtInc
Complete GO annotation...

Keywords - Biological processi

Cilium biogenesis/degradation

Enzyme and pathway databases

SignaLinkiO75602.

Names & Taxonomyi

Protein namesi
Recommended name:
Sperm-associated antigen 6
Alternative name(s):
Protein PF16 homolog
Repro-SA-1
Sperm flagellar protein
Gene namesi
Name:SPAG6
Synonyms:PF16
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:11215. SPAG6.

Subcellular locationi

GO - Cellular componenti

  • axoneme Source: ProtInc
  • cytoplasm Source: UniProtKB-KW
  • microtubule Source: UniProtKB-KW
  • microtubule cytoskeleton Source: LIFEdb
  • motile cilium Source: UniProtKB-KW
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton, Flagellum, Microtubule

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA36051.

Polymorphism and mutation databases

BioMutaiSPAG6.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 509509Sperm-associated antigen 6PRO_0000072095Add
BLAST

Proteomic databases

EPDiO75602.
PaxDbiO75602.
PRIDEiO75602.

PTM databases

iPTMnetiO75602.
PhosphoSiteiO75602.

Expressioni

Tissue specificityi

Highly expressed in testis.1 Publication

Gene expression databases

BgeeiO75602.
CleanExiHS_SPAG6.
ExpressionAtlasiO75602. baseline and differential.
GenevisibleiO75602. HS.

Organism-specific databases

HPAiHPA038440.

Interactioni

Subunit structurei

Interacts with SPAG16 and SPAG17.By similarity

Protein-protein interaction databases

BioGridi114945. 2 interactions.
MINTiMINT-4718003.
STRINGi9606.ENSP00000365811.

Structurei

3D structure databases

ProteinModelPortaliO75602.
SMRiO75602. Positions 24-407.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati31 – 7040ARM 1Add
BLAST
Repeati73 – 11240ARM 2Add
BLAST
Repeati115 – 15440ARM 3Add
BLAST
Repeati157 – 19640ARM 4Add
BLAST
Repeati199 – 23840ARM 5Add
BLAST
Repeati241 – 28040ARM 6Add
BLAST
Repeati325 – 36541ARM 7Add
BLAST
Repeati368 – 40942ARM 8Add
BLAST

Sequence similaritiesi

Contains 8 ARM repeats.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0166. Eukaryota.
COG5064. LUCA.
GeneTreeiENSGT00760000119094.
HOVERGENiHBG055326.
InParanoidiO75602.
OMAiRVENYQP.
OrthoDBiEOG7WMCJ9.
PhylomeDBiO75602.
TreeFamiTF328894.

Family and domain databases

Gene3Di1.25.10.10. 2 hits.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR000225. Armadillo.
[Graphical view]
PfamiPF00514. Arm. 4 hits.
[Graphical view]
SMARTiSM00185. ARM. 7 hits.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 1 hit.

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O75602-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSQRQVLQVF EQYQKARTQF VQMVAELATR PQNIETLQNA GVMSLLRTLL
60 70 80 90 100
LDVVPTIQQT AALALGRLAN YNDDLAEAVV KCDILPQLVY SLAEQNRFYK
110 120 130 140 150
KAAAFVLRAV GKHSPQLAQA IVDCGALDTL VICLEDFDPG VKEAAAWALR
160 170 180 190 200
YIARHNAELS QAVVDAGAVP LLVLCIQEPE IALKRIAASA LSDIAKHSPE
210 220 230 240 250
LAQTVVDAGA VAHLAQMILN PDAKLKHQIL SALSQVSKHS VDLAEMVVEA
260 270 280 290 300
EIFPVVLTCL KDKDEYVKKN ASTLIREIAK HTPELSQLVV NAGGVAAVID
310 320 330 340 350
CIGSCKGNTR LPGIMMLGYV AAHSENLAMA VIISKGVPQL SVCLSEEPED
360 370 380 390 400
HIKAAAAWAL GQIGRHTPEH ARAVAVTNTL PVLLSLYMST ESSEDLQVKS
410 420 430 440 450
KKAIKNILQK CTYLPALEPF LYDAPPNILK HVVGQFSKVL PHDSKARRLF
460 470 480 490 500
VTSGGLKKVQ EIKAEPGSLL QEYINSINSC YPEEIVRYYS PGYSDTLLQR

VDSYQPLNN
Length:509
Mass (Da):55,476
Last modified:November 1, 1998 - v1
Checksum:i03D868E31D3883E1
GO
Isoform 2 (identifier: O75602-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     441-458: PHDSKARRLFVTSGGLKK → FPWIFRYTSAEGGQLSTT
     459-509: Missing.

Show »
Length:458
Mass (Da):49,660
Checksum:i45654F0A31FD4B7A
GO
Isoform 3 (identifier: O75602-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     41-41: G → GEPGARTPVA...SLFPSSLHTG

Note: Derived from EST data. No experimental confirmation available.
Show »
Length:585
Mass (Da):63,490
Checksum:i2A08F5EC8547BA88
GO
Isoform 4 (identifier: O75602-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     97-335: Missing.

Note: Derived from EST data. No experimental confirmation available.
Show »
Length:270
Mass (Da):30,079
Checksum:i7DFE341A6E73387D
GO
Isoform 5 (identifier: O75602-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: MSQRQVLQVFEQYQKARTQFVQMVAELATRPQNIETLQN → MHSLTMDLWIPNGQ

Show »
Length:484
Mass (Da):52,466
Checksum:i99D7065A5CD569A8
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti60 – 601T → I in AAH30585 (PubMed:15489334).Curated
Sequence conflicti161 – 1611Q → R in CAG38583 (Ref. 3) Curated
Sequence conflicti185 – 1851R → G in AAH30585 (PubMed:15489334).Curated
Sequence conflicti195 – 1951A → V in AAH30585 (PubMed:15489334).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti106 – 1061V → L in a breast cancer sample; somatic mutation. 1 Publication
VAR_035659
Natural varianti216 – 2161Q → R.
Corresponds to variant rs7074847 [ dbSNP | Ensembl ].
VAR_024282

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3939MSQRQ…ETLQN → MHSLTMDLWIPNGQ in isoform 5. 1 PublicationVSP_045337Add
BLAST
Alternative sequencei41 – 411G → GEPGARTPVAPRALSPRRLR PAALPVELLGSRSVGTGVRK SIHSFQRVFGGQAERVKLPD GCGRCALSLFPSSLHTG in isoform 3. CuratedVSP_013442
Alternative sequencei97 – 335239Missing in isoform 4. CuratedVSP_013443Add
BLAST
Alternative sequencei441 – 45818PHDSK…GGLKK → FPWIFRYTSAEGGQLSTT in isoform 2. 1 PublicationVSP_013444Add
BLAST
Alternative sequencei459 – 50951Missing in isoform 2. 1 PublicationVSP_013445Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF079363 mRNA. Translation: AAC32590.1.
AL080136 mRNA. Translation: CAB45730.1.
CR533552 mRNA. Translation: CAG38583.1.
AK289903 mRNA. Translation: BAF82592.1.
AK302194 mRNA. Translation: BAG63556.1.
AL513128, AL158211 Genomic DNA. Translation: CAH72207.1.
AL513128, AL158211 Genomic DNA. Translation: CAH72208.1.
AL513128, AL158211 Genomic DNA. Translation: CAH72209.1.
AL513128, AL158211 Genomic DNA. Translation: CAH72210.1.
AL158211, AL513128 Genomic DNA. Translation: CAI15960.1.
AL158211, AL513128 Genomic DNA. Translation: CAI15961.1.
AL158211, AL513128 Genomic DNA. Translation: CAI15962.1.
AL158211, AL513128 Genomic DNA. Translation: CAI15963.1.
CH471072 Genomic DNA. Translation: EAW86146.1.
BC030585 mRNA. Translation: AAH30585.1.
CCDSiCCDS58071.1. [O75602-5]
CCDS7139.1. [O75602-1]
CCDS7140.1. [O75602-2]
PIRiT12521.
RefSeqiNP_001240783.1. NM_001253854.1. [O75602-5]
NP_001240784.1. NM_001253855.1.
NP_036575.1. NM_012443.3. [O75602-1]
NP_758442.1. NM_172242.2. [O75602-2]
UniGeneiHs.655170.

Genome annotation databases

EnsembliENST00000313311; ENSP00000323599; ENSG00000077327. [O75602-2]
ENST00000376624; ENSP00000365811; ENSG00000077327. [O75602-1]
ENST00000538630; ENSP00000441325; ENSG00000077327. [O75602-5]
GeneIDi9576.
KEGGihsa:9576.
UCSCiuc001iri.4. human. [O75602-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF079363 mRNA. Translation: AAC32590.1.
AL080136 mRNA. Translation: CAB45730.1.
CR533552 mRNA. Translation: CAG38583.1.
AK289903 mRNA. Translation: BAF82592.1.
AK302194 mRNA. Translation: BAG63556.1.
AL513128, AL158211 Genomic DNA. Translation: CAH72207.1.
AL513128, AL158211 Genomic DNA. Translation: CAH72208.1.
AL513128, AL158211 Genomic DNA. Translation: CAH72209.1.
AL513128, AL158211 Genomic DNA. Translation: CAH72210.1.
AL158211, AL513128 Genomic DNA. Translation: CAI15960.1.
AL158211, AL513128 Genomic DNA. Translation: CAI15961.1.
AL158211, AL513128 Genomic DNA. Translation: CAI15962.1.
AL158211, AL513128 Genomic DNA. Translation: CAI15963.1.
CH471072 Genomic DNA. Translation: EAW86146.1.
BC030585 mRNA. Translation: AAH30585.1.
CCDSiCCDS58071.1. [O75602-5]
CCDS7139.1. [O75602-1]
CCDS7140.1. [O75602-2]
PIRiT12521.
RefSeqiNP_001240783.1. NM_001253854.1. [O75602-5]
NP_001240784.1. NM_001253855.1.
NP_036575.1. NM_012443.3. [O75602-1]
NP_758442.1. NM_172242.2. [O75602-2]
UniGeneiHs.655170.

3D structure databases

ProteinModelPortaliO75602.
SMRiO75602. Positions 24-407.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114945. 2 interactions.
MINTiMINT-4718003.
STRINGi9606.ENSP00000365811.

PTM databases

iPTMnetiO75602.
PhosphoSiteiO75602.

Polymorphism and mutation databases

BioMutaiSPAG6.

Proteomic databases

EPDiO75602.
PaxDbiO75602.
PRIDEiO75602.

Protocols and materials databases

DNASUi9576.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000313311; ENSP00000323599; ENSG00000077327. [O75602-2]
ENST00000376624; ENSP00000365811; ENSG00000077327. [O75602-1]
ENST00000538630; ENSP00000441325; ENSG00000077327. [O75602-5]
GeneIDi9576.
KEGGihsa:9576.
UCSCiuc001iri.4. human. [O75602-1]

Organism-specific databases

CTDi9576.
GeneCardsiSPAG6.
HGNCiHGNC:11215. SPAG6.
HPAiHPA038440.
MIMi605730. gene.
neXtProtiNX_O75602.
PharmGKBiPA36051.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0166. Eukaryota.
COG5064. LUCA.
GeneTreeiENSGT00760000119094.
HOVERGENiHBG055326.
InParanoidiO75602.
OMAiRVENYQP.
OrthoDBiEOG7WMCJ9.
PhylomeDBiO75602.
TreeFamiTF328894.

Enzyme and pathway databases

SignaLinkiO75602.

Miscellaneous databases

ChiTaRSiSPAG6. human.
GeneWikiiSPAG6.
GenomeRNAii9576.
PROiO75602.
SOURCEiSearch...

Gene expression databases

BgeeiO75602.
CleanExiHS_SPAG6.
ExpressionAtlasiO75602. baseline and differential.
GenevisibleiO75602. HS.

Family and domain databases

Gene3Di1.25.10.10. 2 hits.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR000225. Armadillo.
[Graphical view]
PfamiPF00514. Arm. 4 hits.
[Graphical view]
SMARTiSM00185. ARM. 7 hits.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "cDNA cloning and characterization of a human sperm antigen (SPAG6) with homology to the product of the Chlamydomonas PF16 locus."
    Neilson L.I., Schneider P.A., Van Deerlin P.G., Kiriakidou M., Driscoll D.A., Pellegrini M.C., Millinder S., Yamamoto K.K., French C.K., Strauss J.F. III
    Genomics 60:272-280(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION.
    Tissue: Testis.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.
  3. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5).
    Tissue: Corpus callosum and Testis.
  5. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] (ISOFORMS 1; 2; 3 AND 4).
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Testis.
  8. Cited for: VARIANT [LARGE SCALE ANALYSIS] LEU-106.

Entry informationi

Entry nameiSPAG6_HUMAN
AccessioniPrimary (citable) accession number: O75602
Secondary accession number(s): A8K1I8
, B4DXZ4, Q5VUX5, Q5VUX6, Q5VUX7, Q6FI74, Q8NHQ6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 26, 2005
Last sequence update: November 1, 1998
Last modified: June 8, 2016
This is version 131 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.