Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O75575

- RPC9_HUMAN

UniProt

O75575 - RPC9_HUMAN

Protein

DNA-directed RNA polymerase III subunit RPC9

Gene

CRCP

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
  1. Functioni

    DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts induce type I interferon and NF- Kappa-B through the RIG-I pathway By similarity.By similarity
    Accessory protein for the calcitonin gene-related peptide (CGRP) receptor. It modulates CGRP responsiveness in a variety of tissues.

    GO - Molecular functioni

    1. calcitonin gene-related peptide receptor activity Source: Ensembl
    2. DNA-directed RNA polymerase activity Source: UniProtKB
    3. nucleotide binding Source: InterPro

    GO - Biological processi

    1. defense response to virus Source: UniProtKB-KW
    2. innate immune response Source: UniProtKB-KW
    3. neuropeptide signaling pathway Source: Ensembl
    4. transcription from RNA polymerase III promoter Source: UniProtKB

    Keywords - Biological processi

    Antiviral defense, Immunity, Innate immunity, Transcription

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    DNA-directed RNA polymerase III subunit RPC9
    Short name:
    RNA polymerase III subunit C9
    Alternative name(s):
    Calcitonin gene-related peptide-receptor component protein
    Short name:
    CGRP-RCP
    Short name:
    CGRP-receptor component protein
    Short name:
    CGRPRCP
    Short name:
    HsC17
    Gene namesi
    Name:CRCP
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 7

    Organism-specific databases

    HGNCiHGNC:17888. CRCP.

    Subcellular locationi

    Nucleus By similarity. Cell membrane By similarity; Peripheral membrane protein By similarity; Cytoplasmic side By similarity

    GO - Cellular componenti

    1. acrosomal vesicle Source: Ensembl
    2. DNA polymerase III complex Source: UniProtKB
    3. nucleus Source: UniProtKB-SubCell
    4. plasma membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, DNA-directed RNA polymerase, Membrane, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA164718123.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 148148DNA-directed RNA polymerase III subunit RPC9PRO_0000079335Add
    BLAST

    Proteomic databases

    MaxQBiO75575.
    PaxDbiO75575.
    PeptideAtlasiO75575.
    PRIDEiO75575.

    PTM databases

    PhosphoSiteiO75575.

    Expressioni

    Tissue specificityi

    Ubiquitous. Most prevalent in testis.1 Publication

    Gene expression databases

    ArrayExpressiO75575.
    BgeeiO75575.
    GenevestigatoriO75575.

    Organism-specific databases

    HPAiHPA007216.

    Interactioni

    Subunit structurei

    Component of the RNA polymerase III (Pol III) complex consisting of 17 subunits By similarity. Interacts with POLR3H/RPC8. POLR3H/RPC8 and CRCP/RPC9 probably form a Pol III subcomplex.By similarity2 Publications

    Protein-protein interaction databases

    BioGridi118121. 10 interactions.
    IntActiO75575. 2 interactions.
    STRINGi9606.ENSP00000378736.

    Structurei

    3D structure databases

    ProteinModelPortaliO75575.
    SMRiO75575. Positions 1-122.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Phylogenomic databases

    eggNOGiNOG252343.
    HOGENOMiHOG000244081.
    HOVERGENiHBG023697.
    OMAiYLSKTPC.
    PhylomeDBiO75575.
    TreeFamiTF323294.

    Family and domain databases

    InterProiIPR010997. HRDC-like.
    IPR005574. RNA_pol_II_Rpb4.
    IPR006590. RNA_pol_II_Rpb4_core.
    [Graphical view]
    PfamiPF03874. RNA_pol_Rpb4. 1 hit.
    [Graphical view]
    SMARTiSM00657. RPOL4c. 1 hit.
    [Graphical view]
    SUPFAMiSSF47819. SSF47819. 1 hit.

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O75575-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEVKDANSAL LSNYEVFQLL TDLKEQRKES GKNKHSSGQQ NLNTITYETL    50
    KYISKTPCRH QSPEIVREFL TALKSHKLTK AEKLQLLNHR PVTAVEIQLM 100
    VEESEERLTE EQIEALLHTV TSILPAEPEA EQKKNTNSNV AMDEEDPA 148
    Length:148
    Mass (Da):16,871
    Last modified:November 1, 1998 - v1
    Checksum:i75943BA57A63AF3D
    GO
    Isoform 2 (identifier: O75575-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         14-46: Missing.

    Show »
    Length:115
    Mass (Da):13,054
    Checksum:i60F5C22410882C26
    GO
    Isoform 3 (identifier: O75575-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-13: MEVKDANSALLSN → MQRGDPGEHLGARSWHLGAVGGGGDSCEVKDANSALLSN
         14-46: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:141
    Mass (Da):15,613
    Checksum:i0A92F564E3A59C9A
    GO
    Isoform 4 (identifier: O75575-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         4-80: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:71
    Mass (Da):8,011
    Checksum:i9CF80A5EFAA7B63A
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 1313MEVKD…ALLSN → MQRGDPGEHLGARSWHLGAV GGGGDSCEVKDANSALLSN in isoform 3. 1 PublicationVSP_043249Add
    BLAST
    Alternative sequencei4 – 8077Missing in isoform 4. 1 PublicationVSP_046273Add
    BLAST
    Alternative sequencei14 – 4633Missing in isoform 2 and isoform 3. 3 PublicationsVSP_007538Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF073792 mRNA. Translation: AAC25992.1.
    U51134 mRNA. Translation: AAD05036.1.
    AK290553 mRNA. Translation: BAF83242.1.
    AK303737 mRNA. Translation: BAG64710.1.
    AK311829 mRNA. Translation: BAG34771.1.
    BP233211 mRNA. No translation available.
    BX647867 mRNA. Translation: CAI46069.1.
    AC068533 Genomic DNA. No translation available.
    CH471140 Genomic DNA. Translation: EAX07941.1.
    BC040107 mRNA. Translation: AAH40107.1.
    BC105808 mRNA. Translation: AAI05809.1.
    CCDSiCCDS47599.1. [O75575-2]
    CCDS47600.1. [O75575-4]
    CCDS55116.1. [O75575-3]
    CCDS5532.1. [O75575-1]
    RefSeqiNP_001035737.1. NM_001040647.1. [O75575-2]
    NP_001035738.1. NM_001040648.1. [O75575-4]
    NP_001135886.1. NM_001142414.1. [O75575-3]
    NP_055293.1. NM_014478.4. [O75575-1]
    UniGeneiHs.300684.

    Genome annotation databases

    EnsembliENST00000338592; ENSP00000340044; ENSG00000241258. [O75575-2]
    ENST00000395326; ENSP00000378736; ENSG00000241258. [O75575-1]
    ENST00000398684; ENSP00000381674; ENSG00000241258. [O75575-4]
    ENST00000431089; ENSP00000388653; ENSG00000241258. [O75575-3]
    GeneIDi27297.
    KEGGihsa:27297.
    UCSCiuc003tus.3. human. [O75575-1]
    uc003tut.3. human. [O75575-2]
    uc011kdw.2. human. [O75575-3]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF073792 mRNA. Translation: AAC25992.1 .
    U51134 mRNA. Translation: AAD05036.1 .
    AK290553 mRNA. Translation: BAF83242.1 .
    AK303737 mRNA. Translation: BAG64710.1 .
    AK311829 mRNA. Translation: BAG34771.1 .
    BP233211 mRNA. No translation available.
    BX647867 mRNA. Translation: CAI46069.1 .
    AC068533 Genomic DNA. No translation available.
    CH471140 Genomic DNA. Translation: EAX07941.1 .
    BC040107 mRNA. Translation: AAH40107.1 .
    BC105808 mRNA. Translation: AAI05809.1 .
    CCDSi CCDS47599.1. [O75575-2 ]
    CCDS47600.1. [O75575-4 ]
    CCDS55116.1. [O75575-3 ]
    CCDS5532.1. [O75575-1 ]
    RefSeqi NP_001035737.1. NM_001040647.1. [O75575-2 ]
    NP_001035738.1. NM_001040648.1. [O75575-4 ]
    NP_001135886.1. NM_001142414.1. [O75575-3 ]
    NP_055293.1. NM_014478.4. [O75575-1 ]
    UniGenei Hs.300684.

    3D structure databases

    ProteinModelPortali O75575.
    SMRi O75575. Positions 1-122.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 118121. 10 interactions.
    IntActi O75575. 2 interactions.
    STRINGi 9606.ENSP00000378736.

    PTM databases

    PhosphoSitei O75575.

    Proteomic databases

    MaxQBi O75575.
    PaxDbi O75575.
    PeptideAtlasi O75575.
    PRIDEi O75575.

    Protocols and materials databases

    DNASUi 27297.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000338592 ; ENSP00000340044 ; ENSG00000241258 . [O75575-2 ]
    ENST00000395326 ; ENSP00000378736 ; ENSG00000241258 . [O75575-1 ]
    ENST00000398684 ; ENSP00000381674 ; ENSG00000241258 . [O75575-4 ]
    ENST00000431089 ; ENSP00000388653 ; ENSG00000241258 . [O75575-3 ]
    GeneIDi 27297.
    KEGGi hsa:27297.
    UCSCi uc003tus.3. human. [O75575-1 ]
    uc003tut.3. human. [O75575-2 ]
    uc011kdw.2. human. [O75575-3 ]

    Organism-specific databases

    CTDi 27297.
    GeneCardsi GC07P065578.
    HGNCi HGNC:17888. CRCP.
    HPAi HPA007216.
    MIMi 606121. gene.
    neXtProti NX_O75575.
    PharmGKBi PA164718123.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG252343.
    HOGENOMi HOG000244081.
    HOVERGENi HBG023697.
    OMAi YLSKTPC.
    PhylomeDBi O75575.
    TreeFami TF323294.

    Miscellaneous databases

    GeneWikii RCP9.
    GenomeRNAii 27297.
    NextBioi 50270.
    PROi O75575.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O75575.
    Bgeei O75575.
    Genevestigatori O75575.

    Family and domain databases

    InterProi IPR010997. HRDC-like.
    IPR005574. RNA_pol_II_Rpb4.
    IPR006590. RNA_pol_II_Rpb4_core.
    [Graphical view ]
    Pfami PF03874. RNA_pol_Rpb4. 1 hit.
    [Graphical view ]
    SMARTi SM00657. RPOL4c. 1 hit.
    [Graphical view ]
    SUPFAMi SSF47819. SSF47819. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Human CGRP-receptor component protein (RCP) ORF."
      Luebke A.E., Dahl G.P., Dickerson I.M.
      Submitted (JUN-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "Testes exhibit elevated expression of calcitonin gene-related peptide receptor component protein."
      Balkan W., Oates E.L., Howard G.A., Roos B.A.
      Endocrinology 140:1459-1469(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
      Tissue: Adrenal gland, Brain and Kidney.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
      Tissue: Fetal muscle.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Adipose tissue.
    6. "The DNA sequence of human chromosome 7."
      Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
      , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
      Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Testis.
    9. "Characterization of human RNA polymerase III identifies orthologues for Saccharomyces cerevisiae RNA polymerase III subunits."
      Hu P., Wu S., Sun Y., Yuan C.-C., Kobayashi R., Myers M.P., Hernandez N.
      Mol. Cell. Biol. 22:8044-8055(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION IN THE RNA POL III COMPLEX, IDENTIFICATION BY MASS SPECTROMETRY, INTERACTION WITH RPC8.
    10. "An Rpb4/Rpb7-like complex in yeast RNA polymerase III contains the orthologue of mammalian CGRP-RCP."
      Siaut M., Zaros C., Levivier E., Ferri M.L., Court M., Werner M., Callebaut I., Thuriaux P., Sentenac A., Conesa C.
      Mol. Cell. Biol. 23:195-205(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION IN THE RNA POL III COMPLEX, IDENTIFICATION BY MASS SPECTROMETRY.

    Entry informationi

    Entry nameiRPC9_HUMAN
    AccessioniPrimary (citable) accession number: O75575
    Secondary accession number(s): A8MUZ4
    , A8MW23, B2R4H4, B4E198, Q3KRA3, Q5HYF1, Q8IXL4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 10, 2002
    Last sequence update: November 1, 1998
    Last modified: October 1, 2014
    This is version 106 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 7
      Human chromosome 7: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3