Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DNA-directed RNA polymerase III subunit RPC9

Gene

CRCP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts induce type I interferon and NF- Kappa-B through the RIG-I pathway (By similarity).By similarity
Accessory protein for the calcitonin gene-related peptide (CGRP) receptor. It modulates CGRP responsiveness in a variety of tissues.

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Antiviral defense, Immunity, Innate immunity, Transcription

Enzyme and pathway databases

BioCyciZFISH:ENSG00000126522-MONOMER.
ReactomeiR-HSA-1834949. Cytosolic sensors of pathogen-associated DNA.
R-HSA-73780. RNA Polymerase III Chain Elongation.
R-HSA-73980. RNA Polymerase III Transcription Termination.
R-HSA-749476. RNA Polymerase III Abortive And Retractive Initiation.
R-HSA-76061. RNA Polymerase III Transcription Initiation From Type 1 Promoter.
R-HSA-76066. RNA Polymerase III Transcription Initiation From Type 2 Promoter.
R-HSA-76071. RNA Polymerase III Transcription Initiation From Type 3 Promoter.

Names & Taxonomyi

Protein namesi
Recommended name:
DNA-directed RNA polymerase III subunit RPC9
Short name:
RNA polymerase III subunit C9
Alternative name(s):
Calcitonin gene-related peptide-receptor component protein
Short name:
CGRP-RCP
Short name:
CGRP-receptor component protein
Short name:
CGRPRCP
Short name:
HsC17
Gene namesi
Name:CRCP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:17888. CRCP.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, DNA-directed RNA polymerase, Membrane, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi27297.
OpenTargetsiENSG00000241258.
PharmGKBiPA164718123.

Polymorphism and mutation databases

BioMutaiCRCP.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000793351 – 148DNA-directed RNA polymerase III subunit RPC9Add BLAST148

Proteomic databases

EPDiO75575.
MaxQBiO75575.
PaxDbiO75575.
PeptideAtlasiO75575.
PRIDEiO75575.

PTM databases

iPTMnetiO75575.
PhosphoSitePlusiO75575.

Expressioni

Tissue specificityi

Ubiquitous. Most prevalent in testis.1 Publication

Gene expression databases

BgeeiENSG00000241258.
ExpressionAtlasiO75575. baseline and differential.
GenevisibleiO75575. HS.

Organism-specific databases

HPAiHPA007216.

Interactioni

Subunit structurei

Component of the RNA polymerase III (Pol III) complex consisting of 17 subunits (By similarity). Interacts with POLR3H/RPC8. POLR3H/RPC8 and CRCP/RPC9 probably form a Pol III subcomplex.By similarity2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
TCF12Q990813EBI-2654687,EBI-722877
ZMIZ2Q8NF643EBI-2654687,EBI-745786
ZMIZ2Q8NF64-23EBI-2654687,EBI-10182121

Protein-protein interaction databases

BioGridi118121. 25 interactors.
IntActiO75575. 6 interactors.
STRINGi9606.ENSP00000378736.

Structurei

3D structure databases

ProteinModelPortaliO75575.
SMRiO75575.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG4168. Eukaryota.
ENOG4111TUG. LUCA.
GeneTreeiENSGT00390000014189.
HOGENOMiHOG000244081.
HOVERGENiHBG023697.
InParanoidiO75575.
OMAiKNKHSAG.
OrthoDBiEOG091G0ZNH.
PhylomeDBiO75575.
TreeFamiTF323294.

Family and domain databases

InterProiIPR010997. HRDC-like.
IPR005574. RNA_pol_II_Rpb4.
IPR006590. RNA_pol_II_Rpb4_core.
[Graphical view]
PfamiPF03874. RNA_pol_Rpb4. 1 hit.
[Graphical view]
SMARTiSM00657. RPOL4c. 1 hit.
[Graphical view]
SUPFAMiSSF47819. SSF47819. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O75575-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEVKDANSAL LSNYEVFQLL TDLKEQRKES GKNKHSSGQQ NLNTITYETL
60 70 80 90 100
KYISKTPCRH QSPEIVREFL TALKSHKLTK AEKLQLLNHR PVTAVEIQLM
110 120 130 140
VEESEERLTE EQIEALLHTV TSILPAEPEA EQKKNTNSNV AMDEEDPA
Length:148
Mass (Da):16,871
Last modified:November 1, 1998 - v1
Checksum:i75943BA57A63AF3D
GO
Isoform 2 (identifier: O75575-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     14-46: Missing.

Show »
Length:115
Mass (Da):13,054
Checksum:i60F5C22410882C26
GO
Isoform 3 (identifier: O75575-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: MEVKDANSALLSN → MQRGDPGEHLGARSWHLGAVGGGGDSCEVKDANSALLSN
     14-46: Missing.

Note: No experimental confirmation available.
Show »
Length:141
Mass (Da):15,613
Checksum:i0A92F564E3A59C9A
GO
Isoform 4 (identifier: O75575-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     4-80: Missing.

Note: No experimental confirmation available.
Show »
Length:71
Mass (Da):8,011
Checksum:i9CF80A5EFAA7B63A
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0432491 – 13MEVKD…ALLSN → MQRGDPGEHLGARSWHLGAV GGGGDSCEVKDANSALLSN in isoform 3. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_0462734 – 80Missing in isoform 4. 1 PublicationAdd BLAST77
Alternative sequenceiVSP_00753814 – 46Missing in isoform 2 and isoform 3. 3 PublicationsAdd BLAST33

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF073792 mRNA. Translation: AAC25992.1.
U51134 mRNA. Translation: AAD05036.1.
AK290553 mRNA. Translation: BAF83242.1.
AK303737 mRNA. Translation: BAG64710.1.
AK311829 mRNA. Translation: BAG34771.1.
BP233211 mRNA. No translation available.
BX647867 mRNA. Translation: CAI46069.1.
AC068533 Genomic DNA. No translation available.
CH471140 Genomic DNA. Translation: EAX07941.1.
BC040107 mRNA. Translation: AAH40107.1.
BC105808 mRNA. Translation: AAI05809.1.
CCDSiCCDS47599.1. [O75575-2]
CCDS47600.1. [O75575-4]
CCDS55116.1. [O75575-3]
CCDS5532.1. [O75575-1]
RefSeqiNP_001035737.1. NM_001040647.1. [O75575-2]
NP_001035738.1. NM_001040648.1. [O75575-4]
NP_001135886.1. NM_001142414.1. [O75575-3]
NP_055293.1. NM_014478.4. [O75575-1]
UniGeneiHs.300684.

Genome annotation databases

EnsembliENST00000338592; ENSP00000340044; ENSG00000241258. [O75575-2]
ENST00000395326; ENSP00000378736; ENSG00000241258. [O75575-1]
ENST00000398684; ENSP00000381674; ENSG00000241258. [O75575-4]
ENST00000431089; ENSP00000388653; ENSG00000241258. [O75575-3]
GeneIDi27297.
KEGGihsa:27297.
UCSCiuc003tus.4. human. [O75575-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF073792 mRNA. Translation: AAC25992.1.
U51134 mRNA. Translation: AAD05036.1.
AK290553 mRNA. Translation: BAF83242.1.
AK303737 mRNA. Translation: BAG64710.1.
AK311829 mRNA. Translation: BAG34771.1.
BP233211 mRNA. No translation available.
BX647867 mRNA. Translation: CAI46069.1.
AC068533 Genomic DNA. No translation available.
CH471140 Genomic DNA. Translation: EAX07941.1.
BC040107 mRNA. Translation: AAH40107.1.
BC105808 mRNA. Translation: AAI05809.1.
CCDSiCCDS47599.1. [O75575-2]
CCDS47600.1. [O75575-4]
CCDS55116.1. [O75575-3]
CCDS5532.1. [O75575-1]
RefSeqiNP_001035737.1. NM_001040647.1. [O75575-2]
NP_001035738.1. NM_001040648.1. [O75575-4]
NP_001135886.1. NM_001142414.1. [O75575-3]
NP_055293.1. NM_014478.4. [O75575-1]
UniGeneiHs.300684.

3D structure databases

ProteinModelPortaliO75575.
SMRiO75575.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi118121. 25 interactors.
IntActiO75575. 6 interactors.
STRINGi9606.ENSP00000378736.

PTM databases

iPTMnetiO75575.
PhosphoSitePlusiO75575.

Polymorphism and mutation databases

BioMutaiCRCP.

Proteomic databases

EPDiO75575.
MaxQBiO75575.
PaxDbiO75575.
PeptideAtlasiO75575.
PRIDEiO75575.

Protocols and materials databases

DNASUi27297.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000338592; ENSP00000340044; ENSG00000241258. [O75575-2]
ENST00000395326; ENSP00000378736; ENSG00000241258. [O75575-1]
ENST00000398684; ENSP00000381674; ENSG00000241258. [O75575-4]
ENST00000431089; ENSP00000388653; ENSG00000241258. [O75575-3]
GeneIDi27297.
KEGGihsa:27297.
UCSCiuc003tus.4. human. [O75575-1]

Organism-specific databases

CTDi27297.
DisGeNETi27297.
GeneCardsiCRCP.
HGNCiHGNC:17888. CRCP.
HPAiHPA007216.
MIMi606121. gene.
neXtProtiNX_O75575.
OpenTargetsiENSG00000241258.
PharmGKBiPA164718123.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4168. Eukaryota.
ENOG4111TUG. LUCA.
GeneTreeiENSGT00390000014189.
HOGENOMiHOG000244081.
HOVERGENiHBG023697.
InParanoidiO75575.
OMAiKNKHSAG.
OrthoDBiEOG091G0ZNH.
PhylomeDBiO75575.
TreeFamiTF323294.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000126522-MONOMER.
ReactomeiR-HSA-1834949. Cytosolic sensors of pathogen-associated DNA.
R-HSA-73780. RNA Polymerase III Chain Elongation.
R-HSA-73980. RNA Polymerase III Transcription Termination.
R-HSA-749476. RNA Polymerase III Abortive And Retractive Initiation.
R-HSA-76061. RNA Polymerase III Transcription Initiation From Type 1 Promoter.
R-HSA-76066. RNA Polymerase III Transcription Initiation From Type 2 Promoter.
R-HSA-76071. RNA Polymerase III Transcription Initiation From Type 3 Promoter.

Miscellaneous databases

ChiTaRSiCRCP. human.
GeneWikiiRCP9.
GenomeRNAii27297.
PROiO75575.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000241258.
ExpressionAtlasiO75575. baseline and differential.
GenevisibleiO75575. HS.

Family and domain databases

InterProiIPR010997. HRDC-like.
IPR005574. RNA_pol_II_Rpb4.
IPR006590. RNA_pol_II_Rpb4_core.
[Graphical view]
PfamiPF03874. RNA_pol_Rpb4. 1 hit.
[Graphical view]
SMARTiSM00657. RPOL4c. 1 hit.
[Graphical view]
SUPFAMiSSF47819. SSF47819. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiRPC9_HUMAN
AccessioniPrimary (citable) accession number: O75575
Secondary accession number(s): A8MUZ4
, A8MW23, B2R4H4, B4E198, Q3KRA3, Q5HYF1, Q8IXL4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 10, 2002
Last sequence update: November 1, 1998
Last modified: November 2, 2016
This is version 125 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.