O75575 (RPC9_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 95.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: DNA-directed RNA polymerase III subunit RPC9 Short name=RNA polymerase III subunit C9 Alternative name(s): Calcitonin gene-related peptide-receptor component protein Short name=CGRP-RCP Short name=CGRP-receptor component protein Short name=CGRPRCP Short name=HsC17 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 148 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts induce type I interferon and NF- Kappa-B through the RIG-I pathway By similarity. Accessory protein for the calcitonin gene-related peptide (CGRP) receptor. It modulates CGRP responsiveness in a variety of tissues. |
| Subunit structure | Component of the RNA polymerase III (Pol III) complex consisting of 17 subunits By similarity. Interacts with POLR3H/RPC8. POLR3H/RPC8 and CRCP/RPC9 probably form a Pol III subcomplex. Ref.9 Ref.10 |
| Subcellular location | Nucleus By similarity. Cell membrane; Peripheral membrane protein; Cytoplasmic side By similarity. |
| Tissue specificity | Ubiquitous. Most prevalent in testis. Ref.2 |
| Sequence similarities | Belongs to the eukaryotic RPC9 RNA polymerase subunit family. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O75575-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O75575-2) The sequence of this isoform differs from the canonical sequence as follows: 14-46: Missing. | ||||||
| Isoform 3 (identifier: O75575-3) The sequence of this isoform differs from the canonical sequence as follows: 1-13: MEVKDANSALLSN → MQRGDPGEHLGARSWHLGAVGGGGDSCEVKDANSALLSN 14-46: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: O75575-4) The sequence of this isoform differs from the canonical sequence as follows: 4-80: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 148 | 148 | DNA-directed RNA polymerase III subunit RPC9 | PRO_0000079335 | |||||
Natural variations | |||||||||
| Alternative sequence | 1 – 13 | 13 | MEVKD…ALLSN → MQRGDPGEHLGARSWHLGAV GGGGDSCEVKDANSALLSN in isoform 3. | VSP_043249 | |||||
| Alternative sequence | 4 – 80 | 77 | Missing in isoform 4. | VSP_046273 | |||||
| Alternative sequence | 14 – 46 | 33 | Missing in isoform 2 and isoform 3. | VSP_007538 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human CGRP-receptor component protein (RCP) ORF." Luebke A.E., Dahl G.P., Dickerson I.M. Submitted (JUN-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Testes exhibit elevated expression of calcitonin gene-related peptide receptor component protein." Balkan W., Oates E.L., Howard G.A., Roos B.A. Endocrinology 140:1459-1469(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3). Tissue: Adrenal gland, Brain and Kidney. |
| [4] | "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." Kimura K., Wakamatsu A., Suzuki Y., Ota T., Nishikawa T., Yamashita R., Yamamoto J., Sekine M., Tsuritani K., Wakaguri H., Ishii S., Sugiyama T., Saito K., Isono Y., Irie R., Kushida N., Yoneyama T., Otsuka R. Sugano S.Genome Res. 16:55-65(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Fetal muscle. |
| [5] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Adipose tissue. |
| [6] | "The DNA sequence of human chromosome 7." Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. Wilson R.K.Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Testis. |
| [9] | "Characterization of human RNA polymerase III identifies orthologues for Saccharomyces cerevisiae RNA polymerase III subunits." Hu P., Wu S., Sun Y., Yuan C.-C., Kobayashi R., Myers M.P., Hernandez N. Mol. Cell. Biol. 22:8044-8055(2002) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN THE RNA POL III COMPLEX, MASS SPECTROMETRY, INTERACTION WITH RPC8. |
| [10] | "An Rpb4/Rpb7-like complex in yeast RNA polymerase III contains the orthologue of mammalian CGRP-RCP." Siaut M., Zaros C., Levivier E., Ferri M.L., Court M., Werner M., Callebaut I., Thuriaux P., Sentenac A., Conesa C. Mol. Cell. Biol. 23:195-205(2003) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN THE RNA POL III COMPLEX, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF073792 mRNA. Translation: AAC25992.1. U51134 mRNA. Translation: AAD05036.1. AK290553 mRNA. Translation: BAF83242.1. AK303737 mRNA. Translation: BAG64710.1. AK311829 mRNA. Translation: BAG34771.1. BP233211 mRNA. No translation available. BX647867 mRNA. Translation: CAI46069.1. AC068533 Genomic DNA. No translation available. CH471140 Genomic DNA. Translation: EAX07941.1. BC040107 mRNA. Translation: AAH40107.1. BC105808 mRNA. Translation: AAI05809.1. |
| IPI | IPI00004477. IPI00335708. IPI00759701. IPI00927312. |
| RefSeq | NP_001035737.1. NM_001040647.1. NP_001035738.1. NM_001040648.1. NP_001135886.1. NM_001142414.1. NP_055293.1. NM_014478.4. |
| UniGene | Hs.300684. |
3D structure databases | |
| ProteinModelPortal | O75575. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O75575. 2 interactions. |
| STRING | 9606.ENSP00000378736. |
PTM databases | |
| PhosphoSite | O75575. |
Proteomic databases | |
| PaxDb | O75575. |
| PeptideAtlas | O75575. |
| PRIDE | O75575. |
Protocols and materials databases | |
| DNASU | 27297. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000338592; ENSP00000340044; ENSG00000241258. ENST00000395326; ENSP00000378736; ENSG00000241258. ENST00000398684; ENSP00000381674; ENSG00000241258. ENST00000431089; ENSP00000388653; ENSG00000241258. |
| GeneID | 27297. |
| KEGG | hsa:27297. |
| UCSC | uc003tus.3. human. uc003tut.3. human. |
Organism-specific databases | |
| CTD | 27297. |
| GeneCards | GC07P065578. |
| HGNC | HGNC:17888. CRCP. |
| HPA | HPA007216. |
| MIM | 606121. gene. |
| neXtProt | NX_O75575. |
| PharmGKB | PA164718123. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG252343. |
| HOGENOM | HOG000244081. |
| HOVERGEN | HBG023697. |
| OMA | KHSAGQQ. |
| PhylomeDB | O75575. |
Gene expression databases | |
| ArrayExpress | O75575. |
| Bgee | O75575. |
| Genevestigator | O75575. |
| GermOnline | ENSG00000126522. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR010997. HRDC-like. IPR005574. RNA_pol_II_Rpb4. IPR006590. RNA_pol_II_Rpb4_core. [Graphical view] |
| Pfam | PF03874. RNA_pol_Rpb4. 1 hit. [Graphical view] |
| SMART | SM00657. RPOL4c. 1 hit. [Graphical view] |
| SUPFAM | SSF47819. HRDC_like. 1 hit. |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 27297. |
| NextBio | 50270. |
| SOURCE | Search... |
Entry information
| Entry name | RPC9_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O75575 Secondary accession number(s): A8MUZ4 Q8IXL4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
