Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O75575 (RPC9_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 105. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
DNA-directed RNA polymerase III subunit RPC9

Short name=RNA polymerase III subunit C9
Alternative name(s):
Calcitonin gene-related peptide-receptor component protein
Short name=CGRP-RCP
Short name=CGRP-receptor component protein
Short name=CGRPRCP
Short name=HsC17
Gene names
Name:CRCP
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length148 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts induce type I interferon and NF- Kappa-B through the RIG-I pathway By similarity.

Accessory protein for the calcitonin gene-related peptide (CGRP) receptor. It modulates CGRP responsiveness in a variety of tissues.

Subunit structure

Component of the RNA polymerase III (Pol III) complex consisting of 17 subunits By similarity. Interacts with POLR3H/RPC8. POLR3H/RPC8 and CRCP/RPC9 probably form a Pol III subcomplex. Ref.9 Ref.10

Subcellular location

Nucleus By similarity. Cell membrane; Peripheral membrane protein; Cytoplasmic side By similarity.

Tissue specificity

Ubiquitous. Most prevalent in testis. Ref.2

Sequence similarities

Belongs to the eukaryotic RPC9 RNA polymerase subunit family.

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: O75575-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O75575-2)

The sequence of this isoform differs from the canonical sequence as follows:
     14-46: Missing.
Isoform 3 (identifier: O75575-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: MEVKDANSALLSN → MQRGDPGEHLGARSWHLGAVGGGGDSCEVKDANSALLSN
     14-46: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: O75575-4)

The sequence of this isoform differs from the canonical sequence as follows:
     4-80: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 148148DNA-directed RNA polymerase III subunit RPC9
PRO_0000079335

Natural variations

Alternative sequence1 – 1313MEVKD…ALLSN → MQRGDPGEHLGARSWHLGAV GGGGDSCEVKDANSALLSN in isoform 3.
VSP_043249
Alternative sequence4 – 8077Missing in isoform 4.
VSP_046273
Alternative sequence14 – 4633Missing in isoform 2 and isoform 3.
VSP_007538

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified November 1, 1998. Version 1.
Checksum: 75943BA57A63AF3D

FASTA14816,871
        10         20         30         40         50         60 
MEVKDANSAL LSNYEVFQLL TDLKEQRKES GKNKHSSGQQ NLNTITYETL KYISKTPCRH 

        70         80         90        100        110        120 
QSPEIVREFL TALKSHKLTK AEKLQLLNHR PVTAVEIQLM VEESEERLTE EQIEALLHTV 

       130        140 
TSILPAEPEA EQKKNTNSNV AMDEEDPA 

« Hide

Isoform 2 [UniParc].

Checksum: 60F5C22410882C26
Show »

FASTA11513,054
Isoform 3 [UniParc].

Checksum: 0A92F564E3A59C9A
Show »

FASTA14115,613
Isoform 4 [UniParc].

Checksum: 9CF80A5EFAA7B63A
Show »

FASTA718,011

References

« Hide 'large scale' references
[1]"Human CGRP-receptor component protein (RCP) ORF."
Luebke A.E., Dahl G.P., Dickerson I.M.
Submitted (JUN-1998) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[2]"Testes exhibit elevated expression of calcitonin gene-related peptide receptor component protein."
Balkan W., Oates E.L., Howard G.A., Roos B.A.
Endocrinology 140:1459-1469(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
Tissue: Adrenal gland, Brain and Kidney.
[4]"Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes."
Kimura K., Wakamatsu A., Suzuki Y., Ota T., Nishikawa T., Yamashita R., Yamamoto J., Sekine M., Tsuritani K., Wakaguri H., Ishii S., Sugiyama T., Saito K., Isono Y., Irie R., Kushida N., Yoneyama T., Otsuka R. expand/collapse author list , Kanda K., Yokoi T., Kondo H., Wagatsuma M., Murakawa K., Ishida S., Ishibashi T., Takahashi-Fujii A., Tanase T., Nagai K., Kikuchi H., Nakai K., Isogai T., Sugano S.
Genome Res. 16:55-65(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
Tissue: Fetal muscle.
[5]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Adipose tissue.
[6]"The DNA sequence of human chromosome 7."
Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. expand/collapse author list , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[8]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Testis.
[9]"Characterization of human RNA polymerase III identifies orthologues for Saccharomyces cerevisiae RNA polymerase III subunits."
Hu P., Wu S., Sun Y., Yuan C.-C., Kobayashi R., Myers M.P., Hernandez N.
Mol. Cell. Biol. 22:8044-8055(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION IN THE RNA POL III COMPLEX, IDENTIFICATION BY MASS SPECTROMETRY, INTERACTION WITH RPC8.
[10]"An Rpb4/Rpb7-like complex in yeast RNA polymerase III contains the orthologue of mammalian CGRP-RCP."
Siaut M., Zaros C., Levivier E., Ferri M.L., Court M., Werner M., Callebaut I., Thuriaux P., Sentenac A., Conesa C.
Mol. Cell. Biol. 23:195-205(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION IN THE RNA POL III COMPLEX, IDENTIFICATION BY MASS SPECTROMETRY.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF073792 mRNA. Translation: AAC25992.1.
U51134 mRNA. Translation: AAD05036.1.
AK290553 mRNA. Translation: BAF83242.1.
AK303737 mRNA. Translation: BAG64710.1.
AK311829 mRNA. Translation: BAG34771.1.
BP233211 mRNA. No translation available.
BX647867 mRNA. Translation: CAI46069.1.
AC068533 Genomic DNA. No translation available.
CH471140 Genomic DNA. Translation: EAX07941.1.
BC040107 mRNA. Translation: AAH40107.1.
BC105808 mRNA. Translation: AAI05809.1.
CCDSCCDS47599.1. [O75575-2]
CCDS47600.1. [O75575-4]
CCDS55116.1. [O75575-3]
CCDS5532.1. [O75575-1]
RefSeqNP_001035737.1. NM_001040647.1. [O75575-2]
NP_001035738.1. NM_001040648.1. [O75575-4]
NP_001135886.1. NM_001142414.1. [O75575-3]
NP_055293.1. NM_014478.4. [O75575-1]
UniGeneHs.300684.

3D structure databases

ProteinModelPortalO75575.
SMRO75575. Positions 1-122.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid118121. 10 interactions.
IntActO75575. 2 interactions.
STRING9606.ENSP00000378736.

PTM databases

PhosphoSiteO75575.

Proteomic databases

MaxQBO75575.
PaxDbO75575.
PeptideAtlasO75575.
PRIDEO75575.

Protocols and materials databases

DNASU27297.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000338592; ENSP00000340044; ENSG00000241258. [O75575-2]
ENST00000395326; ENSP00000378736; ENSG00000241258. [O75575-1]
ENST00000398684; ENSP00000381674; ENSG00000241258. [O75575-4]
ENST00000431089; ENSP00000388653; ENSG00000241258. [O75575-3]
GeneID27297.
KEGGhsa:27297.
UCSCuc003tus.3. human. [O75575-1]
uc003tut.3. human. [O75575-2]
uc011kdw.2. human. [O75575-3]

Organism-specific databases

CTD27297.
GeneCardsGC07P065578.
HGNCHGNC:17888. CRCP.
HPAHPA007216.
MIM606121. gene.
neXtProtNX_O75575.
PharmGKBPA164718123.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG252343.
HOGENOMHOG000244081.
HOVERGENHBG023697.
OMAYLSKTPC.
PhylomeDBO75575.
TreeFamTF323294.

Gene expression databases

ArrayExpressO75575.
BgeeO75575.
GenevestigatorO75575.

Family and domain databases

InterProIPR010997. HRDC-like.
IPR005574. RNA_pol_II_Rpb4.
IPR006590. RNA_pol_II_Rpb4_core.
[Graphical view]
PfamPF03874. RNA_pol_Rpb4. 1 hit.
[Graphical view]
SMARTSM00657. RPOL4c. 1 hit.
[Graphical view]
SUPFAMSSF47819. SSF47819. 1 hit.
ProtoNetSearch...

Other

GeneWikiRCP9.
GenomeRNAi27297.
NextBio50270.
PROO75575.
SOURCESearch...

Entry information

Entry nameRPC9_HUMAN
AccessionPrimary (citable) accession number: O75575
Secondary accession number(s): A8MUZ4 expand/collapse secondary AC list , A8MW23, B2R4H4, B4E198, Q3KRA3, Q5HYF1, Q8IXL4
Entry history
Integrated into UniProtKB/Swiss-Prot: May 10, 2002
Last sequence update: November 1, 1998
Last modified: July 9, 2014
This is version 105 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 7

Human chromosome 7: entries, gene names and cross-references to MIM