Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transcription initiation protein SPT3 homolog

Gene

SUPT3H

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Probable transcriptional activator.1 Publication

GO - Molecular functioni

GO - Biological processi

  • histone deubiquitination Source: UniProtKB
  • histone H3 acetylation Source: UniProtKB
  • positive regulation of transcription, DNA-templated Source: UniProtKB
  • regulation of transcription, DNA-templated Source: UniProtKB
  • regulation of transcription by RNA polymerase II Source: ProtInc
  • transcription by RNA polymerase II Source: ProtInc

Keywordsi

Molecular functionActivator
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-HSA-3214847. HATs acetylate histones.

Names & Taxonomyi

Protein namesi
Recommended name:
Transcription initiation protein SPT3 homolog
Alternative name(s):
SPT3-like protein
Gene namesi
Name:SUPT3H
Synonyms:SPT3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

EuPathDBiHostDB:ENSG00000196284.13.
HGNCiHGNC:11466. SUPT3H.
MIMi602947. gene.
neXtProtiNX_O75486.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi8464.
OpenTargetsiENSG00000196284.
PharmGKBiPA36252.

Polymorphism and mutation databases

BioMutaiSUPT3H.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000723131 – 317Transcription initiation protein SPT3 homologAdd BLAST317

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionine1 Publication1
Cross-linki112Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki123Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki163Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Acetylation, Isopeptide bond, Ubl conjugation

Proteomic databases

EPDiO75486.
MaxQBiO75486.
PaxDbiO75486.
PeptideAtlasiO75486.
PRIDEiO75486.

PTM databases

iPTMnetiO75486.
PhosphoSitePlusiO75486.

Expressioni

Tissue specificityi

Expressed in all tissues tested including pancreas, kidney, skeletal muscle, liver, lung, placenta, brain and heart.

Gene expression databases

BgeeiENSG00000196284.
CleanExiHS_SUPT3H.
ExpressionAtlasiO75486. baseline and differential.
GenevisibleiO75486. HS.

Organism-specific databases

HPAiHPA024371.

Interactioni

Subunit structurei

Component of the PCAF complex, at least composed of TADA2L/ADA2, SUPT3H, TADA3L/ADA3, TAF5L/PAF65-beta, TAF6L/PAF65-alpha, TAF10/TAFII30, TAF12/TAFII20, TAF9/TAFII31 and TRRAP. Associates with TAFII31 and GCN5L2. Component of the TFTC-HAT complex, at least composed of TAF5L, TAF6L, TADA3L, SUPT3H/SPT3, TAF2/TAFII150, TAF4/TAFII135, TAF5/TAFII100, GCN5L2/GCN5, TAF10 and TRRAP. Component of the STAGA transcription coactivator-HAT complex, at least composed of SUPT3H, GCN5L2, TAF5L, TAF6L, SUPT7L, TADA3L, TAD1L, TAF10, TAF12, TRRAP and TAF9. The STAGA core complex is associated with a subcomplex required for histone deubiquitination composed of ATXN7L3, ENY2 and USP22.4 Publications

GO - Molecular functioni

Protein-protein interaction databases

BioGridi114042. 36 interactors.
CORUMiO75486.
DIPiDIP-28148N.
IntActiO75486. 5 interactors.
STRINGi9606.ENSP00000360515.

Structurei

3D structure databases

ProteinModelPortaliO75486.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the SPT3 family.Curated

Phylogenomic databases

eggNOGiKOG3902. Eukaryota.
ENOG410Z86C. LUCA.
GeneTreeiENSGT00390000010738.
HOGENOMiHOG000294119.
HOVERGENiHBG058560.
InParanoidiO75486.
KOiK11313.
OMAiMRNHPVK.
OrthoDBiEOG091G0NTZ.
PhylomeDBiO75486.
TreeFamiTF323574.

Family and domain databases

CDDicd07978. TAF13. 1 hit.
Gene3Di1.10.20.10. 1 hit.
InterProiView protein in InterPro
IPR009072. Histone-fold.
IPR003195. TFIID_TAF13.
PANTHERiPTHR11380. PTHR11380. 1 hit.
PfamiView protein in Pfam
PF02269. TFIID-18kDa. 1 hit.
SUPFAMiSSF47113. SSF47113. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O75486-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNNTAASPMS TATSSSGRST GKSISFATEL QSMMYSLGDA RRPLHETAVL
60 70 80 90 100
VEDVVHTQLI NLLQQAAEVS QLRGARVITP EDLLFLMRKD KKKLRRLLKY
110 120 130 140 150
MFIRDYKSKI VKGIDEDDLL EDKLSGSNNA NKRQKIAQDF LNSIDQTGEL
160 170 180 190 200
LAMFEDDEID EVKQERMERA ERQTRIMDSA QYAEFCESRQ LSFSKKASKF
210 220 230 240 250
RDWLDCSSME IKPNVVAMEI LAYLAYETVA QLVDLALLVR QDMVTKAGDP
260 270 280 290 300
FSHAISATFI QYHNSAESTA ACGVEAHSDA IQPCHIREAI RRYSHRIGPL
310
SPFTNAYRRN GMAFLAC
Length:317
Mass (Da):35,793
Last modified:March 28, 2018 - v3
Checksum:iAF339954A57DB5A6
GO
Isoform 2 (identifier: O75486-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MNNTAASPMSTATSSSGRSTGKSISFATELQSMM → MVVFGTTFFN...ILPLLNDSGR

Show »
Length:328
Mass (Da):37,427
Checksum:i3E2B1193CD0C5393
GO

Sequence cautioni

The sequence AAC70014 differs from that shown. Chimeric cDNA.Curated
The sequence AAC70014 differs from that shown. Reason: Frameshift at several positions.Curated
The sequence AAC70014 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti42 – 46RPLHE → SLFMR in AAC70014 (PubMed:9787080).Curated5
Sequence conflicti173 – 175QTR → HNS in AAC70014 (PubMed:9787080).Curated3
Sequence conflicti224L → S in BAG36602 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_057000242D → A. Corresponds to variant dbSNP:rs16872923Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0594961 – 34MNNTA…LQSMM → MVVFGTTFFNFDSFIGKTDS IEIIGKSVFPYCYHNILPLL NDSGR in isoform 2. Add BLAST34

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF064804 mRNA. Translation: AAC70014.1. Sequence problems.
AF069734 mRNA. Translation: AAC39904.1.
AF073930 mRNA. Translation: AAC36098.1.
AK313874 mRNA. Translation: BAG36602.1.
AL096865
, AL138880, AL161905, AL360272 Genomic DNA. Translation: CAI19927.1.
AL138880
, AL096865, AL161905, AL360272 Genomic DNA. Translation: CAI14627.1.
AL161905
, AL096865, AL138880, AL360272 Genomic DNA. Translation: CAI15666.1.
AL360272
, AL096865, AL138880, AL161905 Genomic DNA. Translation: CAH70848.1.
AL360272
, AL138880, AL161905, AL499610 Genomic DNA. Translation: CAH70846.1.
AL499610
, AL138880, AL161905, AL360272 Genomic DNA. Translation: CAH73344.1.
AL138880
, AL161905, AL360272, AL499610 Genomic DNA. Translation: CAI14625.1.
AL161905
, AL138880, AL360272, AL499610 Genomic DNA. Translation: CAI15664.1.
CH471081 Genomic DNA. Translation: EAX04274.1.
CH471081 Genomic DNA. Translation: EAX04275.1.
BC050384 mRNA. Translation: AAH50384.1.
RefSeqiXP_016866861.1. XM_017011372.1.
UniGeneiHs.368325.

Genome annotation databases

GeneIDi8464.
KEGGihsa:8464.
UCSCiuc003oxn.3. human. [O75486-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiSUPT3_HUMAN
AccessioniPrimary (citable) accession number: O75486
Secondary accession number(s): A6NKG9
, B2R9Q5, O76066, Q5TAV9, Q86VN7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 15, 2002
Last sequence update: March 28, 2018
Last modified: March 28, 2018
This is version 153 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome