Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O75478

- TAD2A_HUMAN

UniProt

O75478 - TAD2A_HUMAN

Protein

Transcriptional adapter 2-alpha

Gene

TADA2A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 151 (01 Oct 2014)
      Sequence version 3 (11 Jan 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4. Required for the function of some acidic activation domains, which activate transcription from a distant site By similarity. Binds double-stranded DNA. Binds dinucleosomes, probably at the linker region between neighboring nucleosomes. Plays a role in chromatin remodeling.By similarity1 Publication

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    DNA bindingi426 – 43510By similarity

    GO - Molecular functioni

    1. chromatin binding Source: InterPro
    2. DNA binding Source: UniProtKB-KW
    3. sequence-specific DNA binding transcription factor activity Source: ProtInc
    4. transcription cofactor activity Source: ProtInc
    5. zinc ion binding Source: InterPro

    GO - Biological processi

    1. chromatin organization Source: Reactome
    2. histone H3 acetylation Source: UniProtKB
    3. mitotic nuclear division Source: Ensembl
    4. regulation of histone deacetylation Source: Ensembl
    5. regulation of protein phosphorylation Source: Ensembl
    6. regulation of protein stability Source: Ensembl
    7. regulation of tubulin deacetylation Source: Ensembl
    8. transcription from RNA polymerase II promoter Source: ProtInc

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding

    Enzyme and pathway databases

    ReactomeiREACT_172610. HATs acetylate histones.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Transcriptional adapter 2-alpha
    Alternative name(s):
    Transcriptional adapter 2-like
    Short name:
    ADA2-like protein
    Gene namesi
    Name:TADA2A
    Synonyms:TADA2L
    ORF Names:KL04P
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 17

    Organism-specific databases

    HGNCiHGNC:11531. TADA2A.

    Subcellular locationi

    GO - Cellular componenti

    1. Ada2/Gcn5/Ada3 transcription activator complex Source: Ensembl
    2. chromosome Source: UniProtKB-SubCell
    3. mitotic spindle Source: Ensembl
    4. nucleus Source: ProtInc
    5. PCAF complex Source: UniProtKB

    Keywords - Cellular componenti

    Chromosome, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA36306.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 443443Transcriptional adapter 2-alphaPRO_0000197083Add
    BLAST

    Proteomic databases

    MaxQBiO75478.
    PaxDbiO75478.
    PRIDEiO75478.

    PTM databases

    PhosphoSiteiO75478.

    Expressioni

    Tissue specificityi

    Expressed in all tissues, but most abundantly in testis.

    Gene expression databases

    ArrayExpressiO75478.
    BgeeiO75478.
    CleanExiHS_TADA2L.
    GenevestigatoriO75478.

    Interactioni

    Subunit structurei

    Interacts with GCN5 and NR3C1. Associated with the P/CAF protein in the PCAF complex. Component of the PCAF complex, at least composed of TADA2L/ADA2, TADA3L/ADA3, TAF5L/PAF65-beta, TAF6L/PAF65-alpha, TAF10/TAFII30, TAF12/TAFII20, TAF9/TAFII31 and TRRAP. Component of the ADA2A-containing complex (ATAC), composed of CSRP2BP, KAT2A, TADA2L, TADA3L, ZZ3, MBIP, WDR5, YEATS2, CCDC101 and DR1.3 Publications

    Protein-protein interaction databases

    BioGridi112734. 117 interactions.
    DIPiDIP-28151N.
    IntActiO75478. 11 interactions.
    MINTiMINT-3001294.
    STRINGi9606.ENSP00000225396.

    Structurei

    Secondary structure

    1
    443
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi73 – 753
    Helixi77 – 8913
    Helixi95 – 1028
    Helixi107 – 11610

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1X41NMR-A72-116[»]
    ProteinModelPortaliO75478.
    SMRiO75478. Positions 72-118, 354-443.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiO75478.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini70 – 12253SANTPROSITE-ProRule annotationAdd
    BLAST
    Domaini356 – 44388SWIRMPROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi17 – 4529Cys-richAdd
    BLAST

    Sequence similaritiesi

    Contains 1 SANT domain.PROSITE-ProRule annotation
    Contains 1 SWIRM domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiCOG5114.
    HOGENOMiHOG000068147.
    HOVERGENiHBG057413.
    InParanoidiO75478.
    KOiK11314.
    OMAiFIESHAW.
    OrthoDBiEOG7RFTK1.
    PhylomeDBiO75478.
    TreeFamiTF313975.

    Family and domain databases

    Gene3Di1.10.10.60. 1 hit.
    InterProiIPR009057. Homeodomain-like.
    IPR001005. SANT/Myb.
    IPR017884. SANT_dom.
    IPR007526. SWIRM.
    IPR016827. Transcriptional_adaptor_2.
    IPR000433. Znf_ZZ.
    [Graphical view]
    PfamiPF00249. Myb_DNA-binding. 1 hit.
    PF04433. SWIRM. 1 hit.
    [Graphical view]
    PIRSFiPIRSF025024. Transcriptional_adaptor_2. 1 hit.
    SMARTiSM00717. SANT. 1 hit.
    SM00291. ZnF_ZZ. 1 hit.
    [Graphical view]
    SUPFAMiSSF46689. SSF46689. 2 hits.
    PROSITEiPS51293. SANT. 1 hit.
    PS50934. SWIRM. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O75478-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDRLGPFSND PSDKPPCRGC SSYLMEPYIK CAECGPPPFF LCLQCFTRGF    50
    EYKKHQSDHT YEIMTSDFPV LDPSWTAQEE MALLEAVMDC GFGNWQDVAN 100
    QMCTKTKEEC EKHYMKHFIN NPLFASTLLN LKQAEEAKTA DTAIPFHSTD 150
    DPPRPTFDSL LSRDMAGYMP ARADFIEEFD NYAEWDLRDI DFVEDDSDIL 200
    HALKMAVVDI YHSRLKERQR RKKIIRDHGL INLRKFQLME RRYPKEVQDL 250
    YETMRRFARI VGPVEHDKFI ESHALEFELR REIKRLQEYR TAGITNFCSA 300
    RTYDHLKKTR EEERLKRTML SEVLQYIQDS SACQQWLRRQ ADIDSGLSPS 350
    IPMASNSGRR SAPPLNLTGL PGTEKLNEKE KELCQMVRLV PGAYLEYKSA 400
    LLNECNKQGG LRLAQARALI KIDVNKTRKI YDFLIREGYI TKG 443
    Length:443
    Mass (Da):51,506
    Last modified:January 11, 2011 - v3
    Checksum:iA4E1D87B1B3F6BA5
    GO
    Isoform 2 (identifier: O75478-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         275-305: LEFELRREIKRLQEYRTAGITNFCSARTYDH → CRWFLSLEQYLCVYIYINRRDNGVFYVKFYK
         306-443: Missing.

    Show »
    Length:305
    Mass (Da):36,054
    Checksum:i51386043D3BB294C
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti117 – 1171H → Y in AAH01172. (PubMed:15489334)Curated
    Sequence conflicti153 – 1531P → L in AAC39902. (PubMed:9674425)Curated
    Sequence conflicti185 – 1851W → R in AAC26659. 1 PublicationCurated
    Sequence conflicti304 – 3041D → N in AAC26659. 1 PublicationCurated
    Sequence conflicti342 – 3421D → G in AAC26659. 1 PublicationCurated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti6 – 61P → S.4 Publications
    Corresponds to variant rs7211875 [ dbSNP | Ensembl ].
    VAR_047466
    Natural varianti115 – 1151M → V.1 Publication
    Corresponds to variant rs1054865 [ dbSNP | Ensembl ].
    VAR_047467
    Natural varianti351 – 3511I → M.
    Corresponds to variant rs2522969 [ dbSNP | Ensembl ].
    VAR_047468

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei275 – 30531LEFEL…RTYDH → CRWFLSLEQYLCVYIYINRR DNGVFYVKFYK in isoform 2. 1 PublicationVSP_040347Add
    BLAST
    Alternative sequencei306 – 443138Missing in isoform 2. 1 PublicationVSP_040348Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF064094 mRNA. Translation: AAC26659.1.
    AK022767 mRNA. Translation: BAG51111.1.
    AC004099 Genomic DNA. No translation available.
    AC068400 Genomic DNA. No translation available.
    AC068447 Genomic DNA. No translation available.
    BC001172 mRNA. Translation: AAH01172.1.
    BC011753 mRNA. Translation: AAH11753.1.
    AF069732 mRNA. Translation: AAC39902.1.
    CCDSiCCDS11319.1. [O75478-1]
    CCDS45656.1. [O75478-2]
    RefSeqiNP_001159577.2. NM_001166105.2.
    NP_001278847.1. NM_001291918.1.
    NP_001479.4. NM_001488.4.
    NP_597683.3. NM_133439.3.
    UniGeneiHs.500066.

    Genome annotation databases

    GeneIDi6871.
    KEGGihsa:6871.
    UCSCiuc002hnt.3. human. [O75478-1]
    uc002hnu.1. human. [O75478-2]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF064094 mRNA. Translation: AAC26659.1 .
    AK022767 mRNA. Translation: BAG51111.1 .
    AC004099 Genomic DNA. No translation available.
    AC068400 Genomic DNA. No translation available.
    AC068447 Genomic DNA. No translation available.
    BC001172 mRNA. Translation: AAH01172.1 .
    BC011753 mRNA. Translation: AAH11753.1 .
    AF069732 mRNA. Translation: AAC39902.1 .
    CCDSi CCDS11319.1. [O75478-1 ]
    CCDS45656.1. [O75478-2 ]
    RefSeqi NP_001159577.2. NM_001166105.2.
    NP_001278847.1. NM_001291918.1.
    NP_001479.4. NM_001488.4.
    NP_597683.3. NM_133439.3.
    UniGenei Hs.500066.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1X41 NMR - A 72-116 [» ]
    ProteinModelPortali O75478.
    SMRi O75478. Positions 72-118, 354-443.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 112734. 117 interactions.
    DIPi DIP-28151N.
    IntActi O75478. 11 interactions.
    MINTi MINT-3001294.
    STRINGi 9606.ENSP00000225396.

    PTM databases

    PhosphoSitei O75478.

    Proteomic databases

    MaxQBi O75478.
    PaxDbi O75478.
    PRIDEi O75478.

    Protocols and materials databases

    DNASUi 6871.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 6871.
    KEGGi hsa:6871.
    UCSCi uc002hnt.3. human. [O75478-1 ]
    uc002hnu.1. human. [O75478-2 ]

    Organism-specific databases

    CTDi 6871.
    GeneCardsi GC17P035767.
    H-InvDB HIX0013744.
    HGNCi HGNC:11531. TADA2A.
    MIMi 602276. gene.
    neXtProti NX_O75478.
    PharmGKBi PA36306.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5114.
    HOGENOMi HOG000068147.
    HOVERGENi HBG057413.
    InParanoidi O75478.
    KOi K11314.
    OMAi FIESHAW.
    OrthoDBi EOG7RFTK1.
    PhylomeDBi O75478.
    TreeFami TF313975.

    Enzyme and pathway databases

    Reactomei REACT_172610. HATs acetylate histones.

    Miscellaneous databases

    ChiTaRSi TADA2A. human.
    EvolutionaryTracei O75478.
    GeneWikii TADA2L.
    GenomeRNAii 6871.
    NextBioi 26821.
    PROi O75478.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O75478.
    Bgeei O75478.
    CleanExi HS_TADA2L.
    Genevestigatori O75478.

    Family and domain databases

    Gene3Di 1.10.10.60. 1 hit.
    InterProi IPR009057. Homeodomain-like.
    IPR001005. SANT/Myb.
    IPR017884. SANT_dom.
    IPR007526. SWIRM.
    IPR016827. Transcriptional_adaptor_2.
    IPR000433. Znf_ZZ.
    [Graphical view ]
    Pfami PF00249. Myb_DNA-binding. 1 hit.
    PF04433. SWIRM. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF025024. Transcriptional_adaptor_2. 1 hit.
    SMARTi SM00717. SANT. 1 hit.
    SM00291. ZnF_ZZ. 1 hit.
    [Graphical view ]
    SUPFAMi SSF46689. SSF46689. 2 hits.
    PROSITEi PS51293. SANT. 1 hit.
    PS50934. SWIRM. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identification of human proteins functionally conserved with the yeast putative adaptors ADA2 and GCN5."
      Candau R., Moore P.A., Wang L., Barlev N., Ying C.Y., Rosen C.A., Berger S.L.
      Mol. Cell. Biol. 16:593-602(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION, VARIANT SER-6.
      Tissue: Testis.
    2. "A novel gene from human dendritic cell."
      Huang X., Li N., Zhao Z., Zhu X., Cao X.
      Submitted (JUN-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT SER-6.
      Tissue: Dendritic cell.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS SER-6 AND VAL-115.
    4. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
      Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
      , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
      Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT SER-6.
      Tissue: Eye and Muscle.
    6. Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 81-443, IDENTIFICATION BY MASS SPECTROMETRY.
    7. "Role of the Ada adaptor complex in gene activation by the glucocorticoid receptor."
      Henriksson A., Almloef T., Ford J., McEwan I.J., Gustafsson J.-A., Wright A.P.H.
      Mol. Cell. Biol. 17:3065-3073(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH NR3C1.
    8. "The 400 kDa subunit of the PCAF histone acetylase complex belongs to the ATM superfamily."
      Vassilev A., Yamauchi J., Kotani T., Prives C., Avantaggiati M.L., Qin J., Nakatani Y.
      Mol. Cell 2:869-875(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION IN THE PCAF COMPLEX WITH TRRAP; TADA3L; TAF5L; SUPT3H; TAF6L; TAF10; TAF12 AND TAF9.
    9. "The double-histone-acetyltransferase complex ATAC is essential for mammalian development."
      Guelman S., Kozuka K., Mao Y., Pham V., Solloway M.J., Wang J., Wu J., Lill J.R., Zha J.
      Mol. Cell. Biol. 29:1176-1188(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, IDENTIFICATION IN ATAC COMPLEX.
    10. "Solution structure of the Myb-like DNA binding domain of human transcriptional adaptor 2-like, isoform B."
      RIKEN structural genomics initiative (RSGI)
      Submitted (NOV-2005) to the PDB data bank
      Cited for: STRUCTURE BY NMR OF 72-118.

    Entry informationi

    Entry nameiTAD2A_HUMAN
    AccessioniPrimary (citable) accession number: O75478
    Secondary accession number(s): A8MVD0
    , B3KMU9, Q9BVJ0, Q9UCW2, Q9UP49
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 27, 2001
    Last sequence update: January 11, 2011
    Last modified: October 1, 2014
    This is version 151 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 17
      Human chromosome 17: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3