O75478 (TAD2A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 123.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Transcriptional adapter 2-alpha Alternative name(s): Transcriptional adapter 2-like Short name=ADA2-like protein | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 443 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4. Required for the function of some acidic activation domains, which activate transcription from a distant site By similarity. Binds double-stranded DNA. Binds dinucleosomes, probably at the linker region between neighboring nucleosomes. Plays a role in chromatin remodeling. Ref.9 |
| Subunit structure | Interacts with GCN5 and NR3C1. Associated with the P/CAF protein in the PCAF complex. Component of the PCAF complex, at least composed of TADA2L/ADA2, TADA3L/ADA3, TAF5L/PAF65-beta, TAF6L/PAF65-alpha, TAF10/TAFII30, TAF12/TAFII20, TAF9/TAFII31 and TRRAP. Component of the ADA2A-containing complex (ATAC), composed of CSRP2BP, KAT2A, TADA2L, TADA3L, ZZ3, MBIP, WDR5, YEATS2, CCDC101 and DR1. Ref.7 |
| Subcellular location | |
| Tissue specificity | Expressed in all tissues, but most abundantly in testis. |
| Sequence similarities | Contains 1 SANT domain. Contains 1 SWIRM domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Chromosome Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | DNA-binding |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | histone H3 acetylation Inferred from direct assay Ref.6. Source: UniProtKB transcription from RNA polymerase II promoterTraceable author statement. Source: ProtInc |
| Cellular component | PCAF complex Inferred from direct assay Ref.6. Source: UniProtKB chromosomeInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | DNA binding Inferred from electronic annotation. Source: UniProtKB-KW sequence-specific DNA binding transcription factor activityTraceable author statement. Source: ProtInc transcription cofactor activityTraceable author statement. Source: ProtInc zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O75478-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O75478-2) The sequence of this isoform differs from the canonical sequence as follows: 275-305: LEFELRREIKRLQEYRTAGITNFCSARTYDH → CRWFLSLEQYLCVYIYINRRDNGVFYVKFYK 306-443: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||
Molecule processing | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 443 | 443 | Transcriptional adapter 2-alpha | PRO_0000197083 | |||||||||||||
Regions | |||||||||||||||||
| Domain | 70 – 122 | 53 | SANT | ||||||||||||||
| Domain | 356 – 443 | 88 | SWIRM | ||||||||||||||
| DNA binding | 426 – 435 | 10 | By similarity | ||||||||||||||
| Compositional bias | 17 – 45 | 29 | Cys-rich | ||||||||||||||
Natural variations | |||||||||||||||||
| Alternative sequence | 275 – 305 | 31 | LEFEL…RTYDH → CRWFLSLEQYLCVYIYINRR DNGVFYVKFYK in isoform 2. | VSP_040347 | |||||||||||||
| Alternative sequence | 306 – 443 | 138 | Missing in isoform 2. | VSP_040348 | |||||||||||||
| Natural variant | 6 | 1 | P → S. Ref.1 Ref.2 Ref.3 Ref.5 Corresponds to variant rs7211875 [ dbSNP | Ensembl ]. | VAR_047466 | |||||||||||||
| Natural variant | 115 | 1 | M → V. Ref.3 Corresponds to variant rs1054865 [ dbSNP | Ensembl ]. | VAR_047467 | |||||||||||||
| Natural variant | 351 | 1 | I → M. Corresponds to variant rs2522969 [ dbSNP | Ensembl ]. | VAR_047468 | |||||||||||||
Experimental info | |||||||||||||||||
| Sequence conflict | 117 | 1 | H → Y in AAH01172. Ref.5 | ||||||||||||||
| Sequence conflict | 153 | 1 | P → L in AAC39902. Ref.6 | ||||||||||||||
| Sequence conflict | 185 | 1 | W → R in AAC26659. Ref.2 | ||||||||||||||
| Sequence conflict | 304 | 1 | D → N in AAC26659. Ref.2 | ||||||||||||||
| Sequence conflict | 342 | 1 | D → G in AAC26659. Ref.2 | ||||||||||||||
Secondary structure | |||||||||||||||||
Helix Strand Turn | |||||||||||||||||
| Beta strand | 73 – 75 | 3 | |||||||||||||||
| Helix | 77 – 89 | 13 | |||||||||||||||
| Helix | 95 – 102 | 8 | |||||||||||||||
| Helix | 107 – 117 | 11 | |||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of human proteins functionally conserved with the yeast putative adaptors ADA2 and GCN5." Candau R., Moore P.A., Wang L., Barlev N., Ying C.Y., Rosen C.A., Berger S.L. Mol. Cell. Biol. 16:593-602(1996) [PubMed: 8552087] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION, VARIANT SER-6. Tissue: Testis. |
| [2] | "A novel gene from human dendritic cell." Huang X., Li N., Zhao Z., Zhu X., Cao X. Submitted (JUN-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT SER-6. Tissue: Dendritic cell. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS SER-6 AND VAL-115. |
| [4] | "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006) [PubMed: 16625196] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT SER-6. Tissue: Eye and Muscle. |
| [6] | "Histone-like TAFs within the PCAF histone acetylase complex." Ogryzko V.V., Kotani T., Zhang X., Schiltz R.L., Howard T., Yang X.-J., Howard B.H., Qin J., Nakatani Y. Cell 94:35-44(1998) [PubMed: 9674425] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 81-443, MASS SPECTROMETRY. |
| [7] | "Role of the Ada adaptor complex in gene activation by the glucocorticoid receptor." Henriksson A., Almloef T., Ford J., McEwan I.J., Gustafsson J.-A., Wright A.P.H. Mol. Cell. Biol. 17:3065-3073(1997) [PubMed: 9154805] [Abstract] Cited for: INTERACTION WITH NR3C1. |
| [8] | "The 400 kDa subunit of the PCAF histone acetylase complex belongs to the ATM superfamily." Vassilev A., Yamauchi J., Kotani T., Prives C., Avantaggiati M.L., Qin J., Nakatani Y. Mol. Cell 2:869-875(1998) [PubMed: 9885574] [Abstract] Cited for: IDENTIFICATION IN THE PCAF COMPLEX WITH TRRAP; TADA3L; TAF5L; SUPT3H; TAF6L; TAF10; TAF12 AND TAF9. |
| [9] | "The double-histone-acetyltransferase complex ATAC is essential for mammalian development." Guelman S., Kozuka K., Mao Y., Pham V., Solloway M.J., Wang J., Wu J., Lill J.R., Zha J. Mol. Cell. Biol. 29:1176-1188(2009) [PubMed: 19103755] [Abstract] Cited for: FUNCTION, IDENTIFICATION IN ATAC COMPLEX. |
| [10] | "Solution structure of the Myb-like DNA binding domain of human transcriptional adaptor 2-like, isoform B." RIKEN structural genomics initiative (RSGI) Submitted (NOV-2005) to the PDB data bank Cited for: STRUCTURE BY NMR OF 72-118. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF064094 mRNA. Translation: AAC26659.1. AK022767 mRNA. Translation: BAG51111.1. AC004099 Genomic DNA. No translation available. AC068400 Genomic DNA. No translation available. AC068447 Genomic DNA. No translation available. BC001172 mRNA. Translation: AAH01172.1. BC011753 mRNA. Translation: AAH11753.1. AF069732 mRNA. Translation: AAC39902.1. | ||||||||||||
| IPI | IPI00289581. IPI00306347. | ||||||||||||
| RefSeq | NP_001159577.1. NM_001166105.1. NP_001479.3. NM_001488.3. NP_597683.2. NM_133439.2. | ||||||||||||
| UniGene | Hs.500066. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | O75478. | ||||||||||||
| SMR | O75478. Positions 13-65, 72-118, 354-443. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| DIP | DIP-28151N. | ||||||||||||
| IntAct | O75478. 7 interactions. | ||||||||||||
| MINT | MINT-1447145. | ||||||||||||
| STRING | O75478. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | O75478. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000225396; ENSP00000225396; ENSG00000108264. ENST00000394395; ENSP00000377918; ENSG00000108264. ENST00000417170; ENSP00000406699; ENSG00000108264. | ||||||||||||
| GeneID | 6871. | ||||||||||||
| KEGG | hsa:6871. | ||||||||||||
| UCSC | uc002hnt.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 6871. | ||||||||||||
| GeneCards | GC17P035767. | ||||||||||||
| H-InvDB | HIX0013744. | ||||||||||||
| HGNC | HGNC:11531. TADA2A. | ||||||||||||
| MIM | 602276. gene. | ||||||||||||
| neXtProt | NX_O75478. | ||||||||||||
| PharmGKB | PA165433076. PA36306. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | prNOG08219. | ||||||||||||
| GeneTree | ENSGT00530000063657. | ||||||||||||
| HOGENOM | HBG714058. | ||||||||||||
| HOVERGEN | HBG057413. | ||||||||||||
| InParanoid | O75478. | ||||||||||||
| OMA | DPFDKPP. | ||||||||||||
| OrthoDB | EOG4BK53W. | ||||||||||||
| PhylomeDB | O75478. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | O75478. | ||||||||||||
| Bgee | O75478. | ||||||||||||
| CleanEx | HS_TADA2L. | ||||||||||||
| Genevestigator | O75478. | ||||||||||||
| GermOnline | ENSG00000108264. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR009057. Homeodomain-like. IPR012287. Homeodomain-rel. IPR014778. Myb_DNA-bd. IPR001005. SANT_DNA-bd. IPR017884. SANT_eukarya. IPR007526. SWIRM. IPR016827. Transcriptional_adaptor_2. IPR000433. Znf_ZZ. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:1.10.10.60. Homeodomain-rel. 1 hit. | ||||||||||||
| KO | K11314. | ||||||||||||
| Pfam | PF00249. Myb_DNA-binding. 1 hit. PF04433. SWIRM. 1 hit. [Graphical view] | ||||||||||||
| PIRSF | PIRSF025024. Transcriptional_adaptor_2. 1 hit. | ||||||||||||
| SMART | SM00717. SANT. 1 hit. SM00291. ZnF_ZZ. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF46689. Homeodomain_like. 2 hits. | ||||||||||||
| PROSITE | PS51293. SANT. 1 hit. PS50934. SWIRM. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| NextBio | 26821. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | TAD2A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O75478 Secondary accession number(s): A8MVD0 Q9UP49 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with