Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O75478

- TAD2A_HUMAN

UniProt

O75478 - TAD2A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Transcriptional adapter 2-alpha

Gene

TADA2A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4. Required for the function of some acidic activation domains, which activate transcription from a distant site (By similarity). Binds double-stranded DNA. Binds dinucleosomes, probably at the linker region between neighboring nucleosomes. Plays a role in chromatin remodeling.By similarity1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi426 – 43510By similarity

GO - Molecular functioni

  1. chromatin binding Source: InterPro
  2. DNA binding Source: UniProtKB-KW
  3. sequence-specific DNA binding transcription factor activity Source: ProtInc
  4. transcription cofactor activity Source: ProtInc
  5. zinc ion binding Source: InterPro

GO - Biological processi

  1. chromatin organization Source: Reactome
  2. histone H3 acetylation Source: UniProtKB
  3. transcription from RNA polymerase II promoter Source: ProtInc
Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Enzyme and pathway databases

ReactomeiREACT_172610. HATs acetylate histones.

Names & Taxonomyi

Protein namesi
Recommended name:
Transcriptional adapter 2-alpha
Alternative name(s):
Transcriptional adapter 2-like
Short name:
ADA2-like protein
Gene namesi
Name:TADA2A
Synonyms:TADA2L
ORF Names:KL04P
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 17

Organism-specific databases

HGNCiHGNC:11531. TADA2A.

Subcellular locationi

GO - Cellular componenti

  1. chromosome Source: UniProtKB-KW
  2. nucleus Source: ProtInc
  3. PCAF complex Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Chromosome, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA36306.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 443443Transcriptional adapter 2-alphaPRO_0000197083Add
BLAST

Proteomic databases

MaxQBiO75478.
PaxDbiO75478.
PRIDEiO75478.

PTM databases

PhosphoSiteiO75478.

Expressioni

Tissue specificityi

Expressed in all tissues, but most abundantly in testis.

Gene expression databases

BgeeiO75478.
CleanExiHS_TADA2L.
GenevestigatoriO75478.

Interactioni

Subunit structurei

Interacts with GCN5 and NR3C1. Associated with the P/CAF protein in the PCAF complex. Component of the PCAF complex, at least composed of TADA2L/ADA2, TADA3L/ADA3, TAF5L/PAF65-beta, TAF6L/PAF65-alpha, TAF10/TAFII30, TAF12/TAFII20, TAF9/TAFII31 and TRRAP. Component of the ADA2A-containing complex (ATAC), composed of CSRP2BP, KAT2A, TADA2L, TADA3L, ZZ3, MBIP, WDR5, YEATS2, CCDC101 and DR1.3 Publications

Protein-protein interaction databases

BioGridi112734. 123 interactions.
DIPiDIP-28151N.
IntActiO75478. 11 interactions.
MINTiMINT-3001294.
STRINGi9606.ENSP00000225396.

Structurei

Secondary structure

1
443
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi73 – 753
Helixi77 – 8913
Helixi95 – 1028
Helixi107 – 11610

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1X41NMR-A72-116[»]
ProteinModelPortaliO75478.
SMRiO75478. Positions 72-118, 354-443.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO75478.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini70 – 12253SANTPROSITE-ProRule annotationAdd
BLAST
Domaini356 – 44388SWIRMPROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi17 – 4529Cys-richAdd
BLAST

Sequence similaritiesi

Contains 1 SANT domain.PROSITE-ProRule annotation
Contains 1 SWIRM domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiCOG5114.
HOGENOMiHOG000068147.
HOVERGENiHBG057413.
InParanoidiO75478.
KOiK11314.
OMAiFIESHAW.
OrthoDBiEOG7RFTK1.
PhylomeDBiO75478.
TreeFamiTF313975.

Family and domain databases

Gene3Di1.10.10.60. 1 hit.
InterProiIPR009057. Homeodomain-like.
IPR001005. SANT/Myb.
IPR017884. SANT_dom.
IPR007526. SWIRM.
IPR016827. Transcriptional_adaptor_2.
IPR000433. Znf_ZZ.
[Graphical view]
PfamiPF00249. Myb_DNA-binding. 1 hit.
PF04433. SWIRM. 1 hit.
[Graphical view]
PIRSFiPIRSF025024. Transcriptional_adaptor_2. 1 hit.
SMARTiSM00717. SANT. 1 hit.
SM00291. ZnF_ZZ. 1 hit.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 2 hits.
PROSITEiPS51293. SANT. 1 hit.
PS50934. SWIRM. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O75478-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDRLGPFSND PSDKPPCRGC SSYLMEPYIK CAECGPPPFF LCLQCFTRGF
60 70 80 90 100
EYKKHQSDHT YEIMTSDFPV LDPSWTAQEE MALLEAVMDC GFGNWQDVAN
110 120 130 140 150
QMCTKTKEEC EKHYMKHFIN NPLFASTLLN LKQAEEAKTA DTAIPFHSTD
160 170 180 190 200
DPPRPTFDSL LSRDMAGYMP ARADFIEEFD NYAEWDLRDI DFVEDDSDIL
210 220 230 240 250
HALKMAVVDI YHSRLKERQR RKKIIRDHGL INLRKFQLME RRYPKEVQDL
260 270 280 290 300
YETMRRFARI VGPVEHDKFI ESHALEFELR REIKRLQEYR TAGITNFCSA
310 320 330 340 350
RTYDHLKKTR EEERLKRTML SEVLQYIQDS SACQQWLRRQ ADIDSGLSPS
360 370 380 390 400
IPMASNSGRR SAPPLNLTGL PGTEKLNEKE KELCQMVRLV PGAYLEYKSA
410 420 430 440
LLNECNKQGG LRLAQARALI KIDVNKTRKI YDFLIREGYI TKG
Length:443
Mass (Da):51,506
Last modified:January 11, 2011 - v3
Checksum:iA4E1D87B1B3F6BA5
GO
Isoform 2 (identifier: O75478-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     275-305: LEFELRREIKRLQEYRTAGITNFCSARTYDH → CRWFLSLEQYLCVYIYINRRDNGVFYVKFYK
     306-443: Missing.

Show »
Length:305
Mass (Da):36,054
Checksum:i51386043D3BB294C
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti117 – 1171H → Y in AAH01172. (PubMed:15489334)Curated
Sequence conflicti153 – 1531P → L in AAC39902. (PubMed:9674425)Curated
Sequence conflicti185 – 1851W → R in AAC26659. 1 PublicationCurated
Sequence conflicti304 – 3041D → N in AAC26659. 1 PublicationCurated
Sequence conflicti342 – 3421D → G in AAC26659. 1 PublicationCurated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti6 – 61P → S.4 Publications
Corresponds to variant rs7211875 [ dbSNP | Ensembl ].
VAR_047466
Natural varianti115 – 1151M → V.1 Publication
Corresponds to variant rs1054865 [ dbSNP | Ensembl ].
VAR_047467
Natural varianti351 – 3511I → M.
Corresponds to variant rs2522969 [ dbSNP | Ensembl ].
VAR_047468

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei275 – 30531LEFEL…RTYDH → CRWFLSLEQYLCVYIYINRR DNGVFYVKFYK in isoform 2. 1 PublicationVSP_040347Add
BLAST
Alternative sequencei306 – 443138Missing in isoform 2. 1 PublicationVSP_040348Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF064094 mRNA. Translation: AAC26659.1.
AK022767 mRNA. Translation: BAG51111.1.
AC004099 Genomic DNA. No translation available.
AC068400 Genomic DNA. No translation available.
AC068447 Genomic DNA. No translation available.
BC001172 mRNA. Translation: AAH01172.1.
BC011753 mRNA. Translation: AAH11753.1.
AF069732 mRNA. Translation: AAC39902.1.
CCDSiCCDS11319.1. [O75478-1]
CCDS45656.1. [O75478-2]
RefSeqiNP_001159577.2. NM_001166105.2.
NP_001278847.1. NM_001291918.1.
NP_001479.4. NM_001488.4.
NP_597683.3. NM_133439.3.
UniGeneiHs.500066.

Genome annotation databases

GeneIDi6871.
KEGGihsa:6871.
UCSCiuc002hnt.3. human. [O75478-1]
uc002hnu.1. human. [O75478-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF064094 mRNA. Translation: AAC26659.1 .
AK022767 mRNA. Translation: BAG51111.1 .
AC004099 Genomic DNA. No translation available.
AC068400 Genomic DNA. No translation available.
AC068447 Genomic DNA. No translation available.
BC001172 mRNA. Translation: AAH01172.1 .
BC011753 mRNA. Translation: AAH11753.1 .
AF069732 mRNA. Translation: AAC39902.1 .
CCDSi CCDS11319.1. [O75478-1 ]
CCDS45656.1. [O75478-2 ]
RefSeqi NP_001159577.2. NM_001166105.2.
NP_001278847.1. NM_001291918.1.
NP_001479.4. NM_001488.4.
NP_597683.3. NM_133439.3.
UniGenei Hs.500066.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1X41 NMR - A 72-116 [» ]
ProteinModelPortali O75478.
SMRi O75478. Positions 72-118, 354-443.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 112734. 123 interactions.
DIPi DIP-28151N.
IntActi O75478. 11 interactions.
MINTi MINT-3001294.
STRINGi 9606.ENSP00000225396.

PTM databases

PhosphoSitei O75478.

Proteomic databases

MaxQBi O75478.
PaxDbi O75478.
PRIDEi O75478.

Protocols and materials databases

DNASUi 6871.
Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 6871.
KEGGi hsa:6871.
UCSCi uc002hnt.3. human. [O75478-1 ]
uc002hnu.1. human. [O75478-2 ]

Organism-specific databases

CTDi 6871.
GeneCardsi GC17P035767.
H-InvDB HIX0013744.
HGNCi HGNC:11531. TADA2A.
MIMi 602276. gene.
neXtProti NX_O75478.
PharmGKBi PA36306.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5114.
HOGENOMi HOG000068147.
HOVERGENi HBG057413.
InParanoidi O75478.
KOi K11314.
OMAi FIESHAW.
OrthoDBi EOG7RFTK1.
PhylomeDBi O75478.
TreeFami TF313975.

Enzyme and pathway databases

Reactomei REACT_172610. HATs acetylate histones.

Miscellaneous databases

ChiTaRSi TADA2A. human.
EvolutionaryTracei O75478.
GeneWikii TADA2L.
GenomeRNAii 6871.
NextBioi 26821.
PROi O75478.
SOURCEi Search...

Gene expression databases

Bgeei O75478.
CleanExi HS_TADA2L.
Genevestigatori O75478.

Family and domain databases

Gene3Di 1.10.10.60. 1 hit.
InterProi IPR009057. Homeodomain-like.
IPR001005. SANT/Myb.
IPR017884. SANT_dom.
IPR007526. SWIRM.
IPR016827. Transcriptional_adaptor_2.
IPR000433. Znf_ZZ.
[Graphical view ]
Pfami PF00249. Myb_DNA-binding. 1 hit.
PF04433. SWIRM. 1 hit.
[Graphical view ]
PIRSFi PIRSF025024. Transcriptional_adaptor_2. 1 hit.
SMARTi SM00717. SANT. 1 hit.
SM00291. ZnF_ZZ. 1 hit.
[Graphical view ]
SUPFAMi SSF46689. SSF46689. 2 hits.
PROSITEi PS51293. SANT. 1 hit.
PS50934. SWIRM. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of human proteins functionally conserved with the yeast putative adaptors ADA2 and GCN5."
    Candau R., Moore P.A., Wang L., Barlev N., Ying C.Y., Rosen C.A., Berger S.L.
    Mol. Cell. Biol. 16:593-602(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION, VARIANT SER-6.
    Tissue: Testis.
  2. "A novel gene from human dendritic cell."
    Huang X., Li N., Zhao Z., Zhu X., Cao X.
    Submitted (JUN-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT SER-6.
    Tissue: Dendritic cell.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS SER-6 AND VAL-115.
  4. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT SER-6.
    Tissue: Eye and Muscle.
  6. Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 81-443, IDENTIFICATION BY MASS SPECTROMETRY.
  7. "Role of the Ada adaptor complex in gene activation by the glucocorticoid receptor."
    Henriksson A., Almloef T., Ford J., McEwan I.J., Gustafsson J.-A., Wright A.P.H.
    Mol. Cell. Biol. 17:3065-3073(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH NR3C1.
  8. "The 400 kDa subunit of the PCAF histone acetylase complex belongs to the ATM superfamily."
    Vassilev A., Yamauchi J., Kotani T., Prives C., Avantaggiati M.L., Qin J., Nakatani Y.
    Mol. Cell 2:869-875(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION IN THE PCAF COMPLEX WITH TRRAP; TADA3L; TAF5L; SUPT3H; TAF6L; TAF10; TAF12 AND TAF9.
  9. "The double-histone-acetyltransferase complex ATAC is essential for mammalian development."
    Guelman S., Kozuka K., Mao Y., Pham V., Solloway M.J., Wang J., Wu J., Lill J.R., Zha J.
    Mol. Cell. Biol. 29:1176-1188(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, IDENTIFICATION IN ATAC COMPLEX.
  10. "Solution structure of the Myb-like DNA binding domain of human transcriptional adaptor 2-like, isoform B."
    RIKEN structural genomics initiative (RSGI)
    Submitted (NOV-2005) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 72-118.

Entry informationi

Entry nameiTAD2A_HUMAN
AccessioniPrimary (citable) accession number: O75478
Secondary accession number(s): A8MVD0
, B3KMU9, Q9BVJ0, Q9UCW2, Q9UP49
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: January 11, 2011
Last modified: October 29, 2014
This is version 152 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3