Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transcriptional adapter 2-alpha

Gene

TADA2A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4. Required for the function of some acidic activation domains, which activate transcription from a distant site (By similarity). Binds double-stranded DNA. Binds dinucleosomes, probably at the linker region between neighboring nucleosomes. Plays a role in chromatin remodeling.By similarity1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi426 – 435By similarity10

GO - Molecular functioni

  • chromatin binding Source: GO_Central
  • DNA binding Source: UniProtKB-KW
  • transcription coactivator activity Source: GO_Central
  • transcription cofactor activity Source: ProtInc
  • transcription factor activity, sequence-specific DNA binding Source: ProtInc

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000108264-MONOMER.
ReactomeiR-HSA-3214847. HATs acetylate histones.

Names & Taxonomyi

Protein namesi
Recommended name:
Transcriptional adapter 2-alpha
Alternative name(s):
Transcriptional adapter 2-like
Short name:
ADA2-like protein
Gene namesi
Name:TADA2A
Synonyms:TADA2L
ORF Names:KL04P
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:11531. TADA2A.

Subcellular locationi

GO - Cellular componenti

  • chromosome Source: UniProtKB-SubCell
  • nucleus Source: ProtInc
  • PCAF complex Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Chromosome, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi6871.
OpenTargetsiENSG00000277104.
PharmGKBiPA36306.

Polymorphism and mutation databases

BioMutaiTADA2A.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001970831 – 443Transcriptional adapter 2-alphaAdd BLAST443

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei6Phosphoserine; in variant Ser-6Combined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiO75478.
PaxDbiO75478.
PeptideAtlasiO75478.
PRIDEiO75478.

PTM databases

iPTMnetiO75478.
PhosphoSitePlusiO75478.

Expressioni

Tissue specificityi

Expressed in all tissues, but most abundantly in testis.

Gene expression databases

BgeeiENSG00000108264.
CleanExiHS_TADA2L.

Interactioni

Subunit structurei

Interacts with GCN5 and NR3C1. Associated with the P/CAF protein in the PCAF complex. Component of the PCAF complex, at least composed of TADA2L/ADA2, TADA3L/ADA3, TAF5L/PAF65-beta, TAF6L/PAF65-alpha, TAF10/TAFII30, TAF12/TAFII20, TAF9/TAFII31 and TRRAP. Component of the ADA2A-containing complex (ATAC), composed of KAT14, KAT2A, TADA2L, TADA3L, ZZ3, MBIP, WDR5, YEATS2, CCDC101 and DR1.3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Q5W1503EBI-742268,EBI-10248148
C1orf109Q9NX043EBI-742268,EBI-8643161
CCHCR1Q8TD31-33EBI-742268,EBI-10175300
CDCA7LQ96GN53EBI-742268,EBI-5278764
EIF4E2O605733EBI-742268,EBI-398610
FAM127CQ17RB03EBI-742268,EBI-10238588
FARS2O953633EBI-742268,EBI-2513774
FBF1Q8TES7-63EBI-742268,EBI-10244131
GPSM3Q9Y4H43EBI-742268,EBI-347538
KLC4Q9NSK03EBI-742268,EBI-949319
KLHL38Q2WGJ63EBI-742268,EBI-6426443
KPNA2Q6NVW73EBI-742268,EBI-9377406
MAGOHP613263EBI-742268,EBI-299134
MFAP1P550813EBI-742268,EBI-1048159
MTX2O754313EBI-742268,EBI-7415268
PPP1R16BQ96T493EBI-742268,EBI-10293968
PRPF31F1T0A53EBI-742268,EBI-10177194
SF3A3Q128743EBI-742268,EBI-1051880
TEKT4Q8WW243EBI-742268,EBI-750487
TTC23Q5W5X93EBI-742268,EBI-6447954
TTC9CQ8N5M43EBI-742268,EBI-2851213
ZFYVE26Q96H433EBI-742268,EBI-10286915
ZNF564Q8TBZ83EBI-742268,EBI-10273713

Protein-protein interaction databases

BioGridi112734. 149 interactors.
DIPiDIP-28151N.
IntActiO75478. 35 interactors.
MINTiMINT-3001294.
STRINGi9606.ENSP00000225396.

Structurei

Secondary structure

1443
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi73 – 75Combined sources3
Helixi77 – 89Combined sources13
Helixi95 – 102Combined sources8
Helixi107 – 116Combined sources10

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1X41NMR-A72-116[»]
ProteinModelPortaliO75478.
SMRiO75478.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO75478.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini70 – 122SANTPROSITE-ProRule annotationAdd BLAST53
Domaini356 – 443SWIRMPROSITE-ProRule annotationAdd BLAST88

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi17 – 45Cys-richAdd BLAST29

Sequence similaritiesi

Contains 1 SANT domain.PROSITE-ProRule annotation
Contains 1 SWIRM domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0457. Eukaryota.
COG5114. LUCA.
HOGENOMiHOG000068147.
HOVERGENiHBG057413.
InParanoidiO75478.
KOiK11314.
OMAiYAMNTRR.
OrthoDBiEOG091G06WT.
PhylomeDBiO75478.
TreeFamiTF313975.

Family and domain databases

Gene3Di1.10.10.60. 1 hit.
InterProiIPR016827. Ada2/TADA2.
IPR009057. Homeodomain-like.
IPR001005. SANT/Myb.
IPR017884. SANT_dom.
IPR007526. SWIRM.
[Graphical view]
PfamiPF00249. Myb_DNA-binding. 1 hit.
PF04433. SWIRM. 1 hit.
[Graphical view]
PIRSFiPIRSF025024. Transcriptional_adaptor_2. 1 hit.
SMARTiSM00717. SANT. 1 hit.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 2 hits.
PROSITEiPS51293. SANT. 1 hit.
PS50934. SWIRM. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O75478-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDRLGPFSND PSDKPPCRGC SSYLMEPYIK CAECGPPPFF LCLQCFTRGF
60 70 80 90 100
EYKKHQSDHT YEIMTSDFPV LDPSWTAQEE MALLEAVMDC GFGNWQDVAN
110 120 130 140 150
QMCTKTKEEC EKHYMKHFIN NPLFASTLLN LKQAEEAKTA DTAIPFHSTD
160 170 180 190 200
DPPRPTFDSL LSRDMAGYMP ARADFIEEFD NYAEWDLRDI DFVEDDSDIL
210 220 230 240 250
HALKMAVVDI YHSRLKERQR RKKIIRDHGL INLRKFQLME RRYPKEVQDL
260 270 280 290 300
YETMRRFARI VGPVEHDKFI ESHALEFELR REIKRLQEYR TAGITNFCSA
310 320 330 340 350
RTYDHLKKTR EEERLKRTML SEVLQYIQDS SACQQWLRRQ ADIDSGLSPS
360 370 380 390 400
IPMASNSGRR SAPPLNLTGL PGTEKLNEKE KELCQMVRLV PGAYLEYKSA
410 420 430 440
LLNECNKQGG LRLAQARALI KIDVNKTRKI YDFLIREGYI TKG
Length:443
Mass (Da):51,506
Last modified:January 11, 2011 - v3
Checksum:iA4E1D87B1B3F6BA5
GO
Isoform 2 (identifier: O75478-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     275-305: LEFELRREIKRLQEYRTAGITNFCSARTYDH → CRWFLSLEQYLCVYIYINRRDNGVFYVKFYK
     306-443: Missing.

Show »
Length:305
Mass (Da):36,054
Checksum:i51386043D3BB294C
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti117H → Y in AAH01172 (PubMed:15489334).Curated1
Sequence conflicti153P → L in AAC39902 (PubMed:9674425).Curated1
Sequence conflicti185W → R in AAC26659 (Ref. 2) Curated1
Sequence conflicti304D → N in AAC26659 (Ref. 2) Curated1
Sequence conflicti342D → G in AAC26659 (Ref. 2) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0474666P → S.Combined sources4 PublicationsCorresponds to variant rs7211875dbSNPEnsembl.1
Natural variantiVAR_047467115M → V.1 PublicationCorresponds to variant rs1054865dbSNPEnsembl.1
Natural variantiVAR_047468351I → M.Corresponds to variant rs2522969dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_040347275 – 305LEFEL…RTYDH → CRWFLSLEQYLCVYIYINRR DNGVFYVKFYK in isoform 2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_040348306 – 443Missing in isoform 2. 1 PublicationAdd BLAST138

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF064094 mRNA. Translation: AAC26659.1.
AK022767 mRNA. Translation: BAG51111.1.
AC004099 Genomic DNA. No translation available.
AC068400 Genomic DNA. No translation available.
AC068447 Genomic DNA. No translation available.
BC001172 mRNA. Translation: AAH01172.1.
BC011753 mRNA. Translation: AAH11753.1.
AF069732 mRNA. Translation: AAC39902.1.
CCDSiCCDS11319.1. [O75478-1]
CCDS45656.1. [O75478-2]
RefSeqiNP_001159577.2. NM_001166105.2.
NP_001278847.1. NM_001291918.1.
NP_001479.4. NM_001488.4.
NP_597683.3. NM_133439.3.
UniGeneiHs.500066.
Hs.633101.

Genome annotation databases

EnsembliENST00000617828; ENSP00000482484; ENSG00000277104. [O75478-1]
ENST00000622522; ENSP00000481283; ENSG00000277104. [O75478-1]
ENST00000633468; ENSP00000488016; ENSG00000277104. [O75478-1]
ENST00000633584; ENSP00000487973; ENSG00000277104. [O75478-2]
GeneIDi6871.
KEGGihsa:6871.
UCSCiuc032ghw.2. human. [O75478-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF064094 mRNA. Translation: AAC26659.1.
AK022767 mRNA. Translation: BAG51111.1.
AC004099 Genomic DNA. No translation available.
AC068400 Genomic DNA. No translation available.
AC068447 Genomic DNA. No translation available.
BC001172 mRNA. Translation: AAH01172.1.
BC011753 mRNA. Translation: AAH11753.1.
AF069732 mRNA. Translation: AAC39902.1.
CCDSiCCDS11319.1. [O75478-1]
CCDS45656.1. [O75478-2]
RefSeqiNP_001159577.2. NM_001166105.2.
NP_001278847.1. NM_001291918.1.
NP_001479.4. NM_001488.4.
NP_597683.3. NM_133439.3.
UniGeneiHs.500066.
Hs.633101.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1X41NMR-A72-116[»]
ProteinModelPortaliO75478.
SMRiO75478.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112734. 149 interactors.
DIPiDIP-28151N.
IntActiO75478. 35 interactors.
MINTiMINT-3001294.
STRINGi9606.ENSP00000225396.

PTM databases

iPTMnetiO75478.
PhosphoSitePlusiO75478.

Polymorphism and mutation databases

BioMutaiTADA2A.

Proteomic databases

MaxQBiO75478.
PaxDbiO75478.
PeptideAtlasiO75478.
PRIDEiO75478.

Protocols and materials databases

DNASUi6871.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000617828; ENSP00000482484; ENSG00000277104. [O75478-1]
ENST00000622522; ENSP00000481283; ENSG00000277104. [O75478-1]
ENST00000633468; ENSP00000488016; ENSG00000277104. [O75478-1]
ENST00000633584; ENSP00000487973; ENSG00000277104. [O75478-2]
GeneIDi6871.
KEGGihsa:6871.
UCSCiuc032ghw.2. human. [O75478-1]

Organism-specific databases

CTDi6871.
DisGeNETi6871.
GeneCardsiTADA2A.
H-InvDBHIX0013744.
HGNCiHGNC:11531. TADA2A.
MIMi602276. gene.
neXtProtiNX_O75478.
OpenTargetsiENSG00000277104.
PharmGKBiPA36306.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0457. Eukaryota.
COG5114. LUCA.
HOGENOMiHOG000068147.
HOVERGENiHBG057413.
InParanoidiO75478.
KOiK11314.
OMAiYAMNTRR.
OrthoDBiEOG091G06WT.
PhylomeDBiO75478.
TreeFamiTF313975.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000108264-MONOMER.
ReactomeiR-HSA-3214847. HATs acetylate histones.

Miscellaneous databases

ChiTaRSiTADA2A. human.
EvolutionaryTraceiO75478.
GeneWikiiTADA2L.
GenomeRNAii6871.
PROiO75478.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000108264.
CleanExiHS_TADA2L.

Family and domain databases

Gene3Di1.10.10.60. 1 hit.
InterProiIPR016827. Ada2/TADA2.
IPR009057. Homeodomain-like.
IPR001005. SANT/Myb.
IPR017884. SANT_dom.
IPR007526. SWIRM.
[Graphical view]
PfamiPF00249. Myb_DNA-binding. 1 hit.
PF04433. SWIRM. 1 hit.
[Graphical view]
PIRSFiPIRSF025024. Transcriptional_adaptor_2. 1 hit.
SMARTiSM00717. SANT. 1 hit.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 2 hits.
PROSITEiPS51293. SANT. 1 hit.
PS50934. SWIRM. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTAD2A_HUMAN
AccessioniPrimary (citable) accession number: O75478
Secondary accession number(s): A8MVD0
, B3KMU9, Q9BVJ0, Q9UCW2, Q9UP49
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: January 11, 2011
Last modified: November 30, 2016
This is version 172 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.