Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transcriptional adapter 2-alpha

Gene

TADA2A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4. Required for the function of some acidic activation domains, which activate transcription from a distant site (By similarity). Binds double-stranded DNA. Binds dinucleosomes, probably at the linker region between neighboring nucleosomes. Plays a role in chromatin remodeling. May promote TP53/p53 'Lys-321' acetylation, leading to reduced TP53 stability and transcriptional activity (PubMed:22644376). May also promote XRCC6 acetylation thus facilitating cell apoptosis in response to DNA damage (PubMed:22644376).By similarity2 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi426 – 435By similarity10

GO - Molecular functioni

GO - Biological processi

  • chromatin remodeling Source: GO_Central
  • histone H3 acetylation Source: UniProtKB
  • positive regulation of histone acetylation Source: GO_Central
  • regulation of transcription by RNA polymerase II Source: GO_Central
  • transcription by RNA polymerase II Source: ProtInc

Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-HSA-3214847 HATs acetylate histones

Names & Taxonomyi

Protein namesi
Recommended name:
Transcriptional adapter 2-alpha
Alternative name(s):
Transcriptional adapter 2-like
Short name:
ADA2-like protein
Gene namesi
Name:TADA2A
Synonyms:TADA2L
ORF Names:KL04P
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:11531 TADA2A
MIMi602276 gene
neXtProtiNX_O75478

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Chromosome, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi6871
PharmGKBiPA36306

Polymorphism and mutation databases

BioMutaiTADA2A

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001970831 – 443Transcriptional adapter 2-alphaAdd BLAST443

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei6Phosphoserine; in variant Ser-6Combined sources1
Cross-linki132Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki138Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiO75478
PaxDbiO75478
PeptideAtlasiO75478
PRIDEiO75478
ProteomicsDBi50040
50041 [O75478-2]

PTM databases

iPTMnetiO75478
PhosphoSitePlusiO75478

Expressioni

Tissue specificityi

Expressed in all tissues, but most abundantly in testis.

Gene expression databases

CleanExiHS_TADA2L

Organism-specific databases

HPAiHPA076497

Interactioni

Subunit structurei

Interacts with GCN5 and NR3C1. Associated with the P/CAF protein in the PCAF complex. Component of the PCAF complex, at least composed of TADA2L/ADA2, TADA3L/ADA3, TAF5L/PAF65-beta, TAF6L/PAF65-alpha, TAF10/TAFII30, TAF12/TAFII20, TAF9/TAFII31 and TRRAP. Component of the ADA2A-containing complex (ATAC), composed of KAT14, KAT2A, TADA2L, TADA3L, ZZ3, MBIP, WDR5, YEATS2, CCDC101 and DR1. Interacts with CCDC134 (PubMed:22644376).4 Publications

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi112734, 154 interactors
ComplexPortaliCPX-1004 PCAF-containing ATAC complex
CPX-989 PCAF histone acetylase complex
CPX-997 GCN5-containing ATAC complex
CORUMiO75478
DIPiDIP-28151N
IntActiO75478, 51 interactors
MINTiO75478
STRINGi9606.ENSP00000225396

Structurei

Secondary structure

1443
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi73 – 75Combined sources3
Helixi77 – 89Combined sources13
Helixi95 – 102Combined sources8
Helixi107 – 117Combined sources11

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1X41NMR-A72-116[»]
ProteinModelPortaliO75478
SMRiO75478
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO75478

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini70 – 122SANTPROSITE-ProRule annotationAdd BLAST53
Domaini356 – 443SWIRMPROSITE-ProRule annotationAdd BLAST88

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi17 – 45Cys-richAdd BLAST29

Phylogenomic databases

eggNOGiKOG0457 Eukaryota
COG5114 LUCA
HOGENOMiHOG000068147
HOVERGENiHBG057413
InParanoidiO75478
KOiK11314
OrthoDBiEOG091G06WT
PhylomeDBiO75478
TreeFamiTF313975

Family and domain databases

CDDicd00167 SANT, 1 hit
InterProiView protein in InterPro
IPR016827 Ada2/TADA2
IPR009057 Homeobox-like_sf
IPR001005 SANT/Myb
IPR017884 SANT_dom
IPR007526 SWIRM
PfamiView protein in Pfam
PF00249 Myb_DNA-binding, 1 hit
PF04433 SWIRM, 1 hit
PIRSFiPIRSF025024 Transcriptional_adaptor_2, 1 hit
SMARTiView protein in SMART
SM00717 SANT, 1 hit
SUPFAMiSSF46689 SSF46689, 2 hits
PROSITEiView protein in PROSITE
PS51293 SANT, 1 hit
PS50934 SWIRM, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O75478-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDRLGPFSND PSDKPPCRGC SSYLMEPYIK CAECGPPPFF LCLQCFTRGF
60 70 80 90 100
EYKKHQSDHT YEIMTSDFPV LDPSWTAQEE MALLEAVMDC GFGNWQDVAN
110 120 130 140 150
QMCTKTKEEC EKHYMKHFIN NPLFASTLLN LKQAEEAKTA DTAIPFHSTD
160 170 180 190 200
DPPRPTFDSL LSRDMAGYMP ARADFIEEFD NYAEWDLRDI DFVEDDSDIL
210 220 230 240 250
HALKMAVVDI YHSRLKERQR RKKIIRDHGL INLRKFQLME RRYPKEVQDL
260 270 280 290 300
YETMRRFARI VGPVEHDKFI ESHALEFELR REIKRLQEYR TAGITNFCSA
310 320 330 340 350
RTYDHLKKTR EEERLKRTML SEVLQYIQDS SACQQWLRRQ ADIDSGLSPS
360 370 380 390 400
IPMASNSGRR SAPPLNLTGL PGTEKLNEKE KELCQMVRLV PGAYLEYKSA
410 420 430 440
LLNECNKQGG LRLAQARALI KIDVNKTRKI YDFLIREGYI TKG
Length:443
Mass (Da):51,506
Last modified:January 11, 2011 - v3
Checksum:iA4E1D87B1B3F6BA5
GO
Isoform 2 (identifier: O75478-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     275-305: LEFELRREIKRLQEYRTAGITNFCSARTYDH → CRWFLSLEQYLCVYIYINRRDNGVFYVKFYK
     306-443: Missing.

Show »
Length:305
Mass (Da):36,054
Checksum:i51386043D3BB294C
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti117H → Y in AAH01172 (PubMed:15489334).Curated1
Sequence conflicti153P → L in AAC39902 (PubMed:9674425).Curated1
Sequence conflicti185W → R in AAC26659 (Ref. 2) Curated1
Sequence conflicti304D → N in AAC26659 (Ref. 2) Curated1
Sequence conflicti342D → G in AAC26659 (Ref. 2) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0474666P → SCombined sources4 PublicationsCorresponds to variant dbSNP:rs7211875Ensembl.1
Natural variantiVAR_047467115M → V1 PublicationCorresponds to variant dbSNP:rs1054865Ensembl.1
Natural variantiVAR_047468351I → M. Corresponds to variant dbSNP:rs2522969Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_040347275 – 305LEFEL…RTYDH → CRWFLSLEQYLCVYIYINRR DNGVFYVKFYK in isoform 2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_040348306 – 443Missing in isoform 2. 1 PublicationAdd BLAST138

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF064094 mRNA Translation: AAC26659.1
AK022767 mRNA Translation: BAG51111.1
AC004099 Genomic DNA No translation available.
AC068400 Genomic DNA No translation available.
AC068447 Genomic DNA No translation available.
BC001172 mRNA Translation: AAH01172.1
BC011753 mRNA Translation: AAH11753.1
AF069732 mRNA Translation: AAC39902.1
CCDSiCCDS11319.1 [O75478-1]
CCDS45656.1 [O75478-2]
RefSeqiNP_001159577.2, NM_001166105.2
NP_001278847.1, NM_001291918.1
NP_001479.4, NM_001488.4
NP_597683.3, NM_133439.3
UniGeneiHs.500066
Hs.633101

Genome annotation databases

EnsembliENST00000617828; ENSP00000482484; ENSG00000277104 [O75478-1]
ENST00000622522; ENSP00000481283; ENSG00000277104 [O75478-1]
ENST00000633468; ENSP00000488016; ENSG00000277104 [O75478-1]
ENST00000633584; ENSP00000487973; ENSG00000277104 [O75478-2]
GeneIDi6871
KEGGihsa:6871
UCSCiuc032ghw.2 human [O75478-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiTAD2A_HUMAN
AccessioniPrimary (citable) accession number: O75478
Secondary accession number(s): A8MVD0
, B3KMU9, Q9BVJ0, Q9UCW2, Q9UP49
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: January 11, 2011
Last modified: June 20, 2018
This is version 187 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health