Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O75478 (TAD2A_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 149. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Transcriptional adapter 2-alpha
Alternative name(s):
Transcriptional adapter 2-like
Short name=ADA2-like protein
Gene names
Name:TADA2A
Synonyms:TADA2L
ORF Names:KL04P
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length443 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4. Required for the function of some acidic activation domains, which activate transcription from a distant site By similarity. Binds double-stranded DNA. Binds dinucleosomes, probably at the linker region between neighboring nucleosomes. Plays a role in chromatin remodeling. Ref.9

Subunit structure

Interacts with GCN5 and NR3C1. Associated with the P/CAF protein in the PCAF complex. Component of the PCAF complex, at least composed of TADA2L/ADA2, TADA3L/ADA3, TAF5L/PAF65-beta, TAF6L/PAF65-alpha, TAF10/TAFII30, TAF12/TAFII20, TAF9/TAFII31 and TRRAP. Component of the ADA2A-containing complex (ATAC), composed of CSRP2BP, KAT2A, TADA2L, TADA3L, ZZ3, MBIP, WDR5, YEATS2, CCDC101 and DR1. Ref.7 Ref.8 Ref.9

Subcellular location

Nucleus. Chromosome.

Tissue specificity

Expressed in all tissues, but most abundantly in testis.

Sequence similarities

Contains 1 SANT domain.

Contains 1 SWIRM domain.

Ontologies

Keywords
   Biological processTranscription
Transcription regulation
   Cellular componentChromosome
Nucleus
   Coding sequence diversityAlternative splicing
Polymorphism
   LigandDNA-binding
   Technical term3D-structure
Complete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processchromatin organization

Traceable author statement. Source: Reactome

histone H3 acetylation

Inferred from direct assay Ref.6. Source: UniProtKB

mitotic nuclear division

Inferred from electronic annotation. Source: Ensembl

regulation of histone deacetylation

Inferred from electronic annotation. Source: Ensembl

regulation of protein phosphorylation

Inferred from electronic annotation. Source: Ensembl

regulation of protein stability

Inferred from electronic annotation. Source: Ensembl

regulation of tubulin deacetylation

Inferred from electronic annotation. Source: Ensembl

transcription from RNA polymerase II promoter

Traceable author statement Ref.1. Source: ProtInc

   Cellular_componentAda2/Gcn5/Ada3 transcription activator complex

Inferred from electronic annotation. Source: Ensembl

PCAF complex

Inferred from direct assay Ref.6. Source: UniProtKB

chromosome

Inferred from electronic annotation. Source: UniProtKB-SubCell

mitotic spindle

Inferred from electronic annotation. Source: Ensembl

nucleus

Traceable author statement Ref.1. Source: ProtInc

   Molecular_functionDNA binding

Inferred from electronic annotation. Source: UniProtKB-KW

chromatin binding

Inferred from electronic annotation. Source: InterPro

sequence-specific DNA binding transcription factor activity

Traceable author statement Ref.1. Source: ProtInc

transcription cofactor activity

Traceable author statement Ref.1. Source: ProtInc

zinc ion binding

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: O75478-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O75478-2)

The sequence of this isoform differs from the canonical sequence as follows:
     275-305: LEFELRREIKRLQEYRTAGITNFCSARTYDH → CRWFLSLEQYLCVYIYINRRDNGVFYVKFYK
     306-443: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 443443Transcriptional adapter 2-alpha
PRO_0000197083

Regions

Domain70 – 12253SANT
Domain356 – 44388SWIRM
DNA binding426 – 43510 By similarity
Compositional bias17 – 4529Cys-rich

Natural variations

Alternative sequence275 – 30531LEFEL…RTYDH → CRWFLSLEQYLCVYIYINRR DNGVFYVKFYK in isoform 2.
VSP_040347
Alternative sequence306 – 443138Missing in isoform 2.
VSP_040348
Natural variant61P → S. Ref.1 Ref.2 Ref.3 Ref.5
Corresponds to variant rs7211875 [ dbSNP | Ensembl ].
VAR_047466
Natural variant1151M → V. Ref.3
Corresponds to variant rs1054865 [ dbSNP | Ensembl ].
VAR_047467
Natural variant3511I → M.
Corresponds to variant rs2522969 [ dbSNP | Ensembl ].
VAR_047468

Experimental info

Sequence conflict1171H → Y in AAH01172. Ref.5
Sequence conflict1531P → L in AAC39902. Ref.6
Sequence conflict1851W → R in AAC26659. Ref.2
Sequence conflict3041D → N in AAC26659. Ref.2
Sequence conflict3421D → G in AAC26659. Ref.2

Secondary structure

......... 443
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified January 11, 2011. Version 3.
Checksum: A4E1D87B1B3F6BA5

FASTA44351,506
        10         20         30         40         50         60 
MDRLGPFSND PSDKPPCRGC SSYLMEPYIK CAECGPPPFF LCLQCFTRGF EYKKHQSDHT 

        70         80         90        100        110        120 
YEIMTSDFPV LDPSWTAQEE MALLEAVMDC GFGNWQDVAN QMCTKTKEEC EKHYMKHFIN 

       130        140        150        160        170        180 
NPLFASTLLN LKQAEEAKTA DTAIPFHSTD DPPRPTFDSL LSRDMAGYMP ARADFIEEFD 

       190        200        210        220        230        240 
NYAEWDLRDI DFVEDDSDIL HALKMAVVDI YHSRLKERQR RKKIIRDHGL INLRKFQLME 

       250        260        270        280        290        300 
RRYPKEVQDL YETMRRFARI VGPVEHDKFI ESHALEFELR REIKRLQEYR TAGITNFCSA 

       310        320        330        340        350        360 
RTYDHLKKTR EEERLKRTML SEVLQYIQDS SACQQWLRRQ ADIDSGLSPS IPMASNSGRR 

       370        380        390        400        410        420 
SAPPLNLTGL PGTEKLNEKE KELCQMVRLV PGAYLEYKSA LLNECNKQGG LRLAQARALI 

       430        440 
KIDVNKTRKI YDFLIREGYI TKG 

« Hide

Isoform 2 [UniParc].

Checksum: 51386043D3BB294C
Show »

FASTA30536,054

References

« Hide 'large scale' references
[1]"Identification of human proteins functionally conserved with the yeast putative adaptors ADA2 and GCN5."
Candau R., Moore P.A., Wang L., Barlev N., Ying C.Y., Rosen C.A., Berger S.L.
Mol. Cell. Biol. 16:593-602(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION, VARIANT SER-6.
Tissue: Testis.
[2]"A novel gene from human dendritic cell."
Huang X., Li N., Zhao Z., Zhu X., Cao X.
Submitted (JUN-1998) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT SER-6.
Tissue: Dendritic cell.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS SER-6 AND VAL-115.
[4]"DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. expand/collapse author list , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT SER-6.
Tissue: Eye and Muscle.
[6]"Histone-like TAFs within the PCAF histone acetylase complex."
Ogryzko V.V., Kotani T., Zhang X., Schiltz R.L., Howard T., Yang X.-J., Howard B.H., Qin J., Nakatani Y.
Cell 94:35-44(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 81-443, IDENTIFICATION BY MASS SPECTROMETRY.
[7]"Role of the Ada adaptor complex in gene activation by the glucocorticoid receptor."
Henriksson A., Almloef T., Ford J., McEwan I.J., Gustafsson J.-A., Wright A.P.H.
Mol. Cell. Biol. 17:3065-3073(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH NR3C1.
[8]"The 400 kDa subunit of the PCAF histone acetylase complex belongs to the ATM superfamily."
Vassilev A., Yamauchi J., Kotani T., Prives C., Avantaggiati M.L., Qin J., Nakatani Y.
Mol. Cell 2:869-875(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION IN THE PCAF COMPLEX WITH TRRAP; TADA3L; TAF5L; SUPT3H; TAF6L; TAF10; TAF12 AND TAF9.
[9]"The double-histone-acetyltransferase complex ATAC is essential for mammalian development."
Guelman S., Kozuka K., Mao Y., Pham V., Solloway M.J., Wang J., Wu J., Lill J.R., Zha J.
Mol. Cell. Biol. 29:1176-1188(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, IDENTIFICATION IN ATAC COMPLEX.
[10]"Solution structure of the Myb-like DNA binding domain of human transcriptional adaptor 2-like, isoform B."
RIKEN structural genomics initiative (RSGI)
Submitted (NOV-2005) to the PDB data bank
Cited for: STRUCTURE BY NMR OF 72-118.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF064094 mRNA. Translation: AAC26659.1.
AK022767 mRNA. Translation: BAG51111.1.
AC004099 Genomic DNA. No translation available.
AC068400 Genomic DNA. No translation available.
AC068447 Genomic DNA. No translation available.
BC001172 mRNA. Translation: AAH01172.1.
BC011753 mRNA. Translation: AAH11753.1.
AF069732 mRNA. Translation: AAC39902.1.
RefSeqNP_001159577.2. NM_001166105.2. [O75478-1]
NP_001278847.1. NM_001291918.1.
NP_001479.4. NM_001488.4. [O75478-1]
NP_597683.3. NM_133439.3. [O75478-2]
UniGeneHs.500066.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
1X41NMR-A72-116[»]
ProteinModelPortalO75478.
SMRO75478. Positions 72-118, 354-443.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid112734. 117 interactions.
DIPDIP-28151N.
IntActO75478. 11 interactions.
MINTMINT-3001294.
STRING9606.ENSP00000225396.

PTM databases

PhosphoSiteO75478.

Proteomic databases

MaxQBO75478.
PaxDbO75478.
PRIDEO75478.

Protocols and materials databases

DNASU6871.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000225396; ENSP00000225396; ENSG00000108264. [O75478-1]
ENST00000394395; ENSP00000377918; ENSG00000108264. [O75478-1]
ENST00000417170; ENSP00000406699; ENSG00000108264. [O75478-2]
ENST00000490992; ENSP00000432503; ENSG00000108264. [O75478-1]
ENST00000586023; ENSP00000466884; ENSG00000108264. [O75478-2]
GeneID6871.
KEGGhsa:6871.
UCSCuc002hnt.3. human. [O75478-1]
uc002hnu.1. human. [O75478-2]

Organism-specific databases

CTD6871.
GeneCardsGC17P035767.
H-InvDBHIX0013744.
HGNCHGNC:11531. TADA2A.
MIM602276. gene.
neXtProtNX_O75478.
PharmGKBPA36306.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5114.
HOGENOMHOG000068147.
HOVERGENHBG057413.
InParanoidO75478.
KOK11314.
OMAFIESHAW.
OrthoDBEOG7RFTK1.
PhylomeDBO75478.
TreeFamTF313975.

Enzyme and pathway databases

ReactomeREACT_172623. Chromatin organization.

Gene expression databases

ArrayExpressO75478.
BgeeO75478.
CleanExHS_TADA2L.
GenevestigatorO75478.

Family and domain databases

Gene3D1.10.10.60. 1 hit.
InterProIPR009057. Homeodomain-like.
IPR001005. SANT/Myb.
IPR017884. SANT_dom.
IPR007526. SWIRM.
IPR016827. Transcriptional_adaptor_2.
IPR000433. Znf_ZZ.
[Graphical view]
PfamPF00249. Myb_DNA-binding. 1 hit.
PF04433. SWIRM. 1 hit.
[Graphical view]
PIRSFPIRSF025024. Transcriptional_adaptor_2. 1 hit.
SMARTSM00717. SANT. 1 hit.
SM00291. ZnF_ZZ. 1 hit.
[Graphical view]
SUPFAMSSF46689. SSF46689. 2 hits.
PROSITEPS51293. SANT. 1 hit.
PS50934. SWIRM. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSTADA2A. human.
EvolutionaryTraceO75478.
GeneWikiTADA2L.
GenomeRNAi6871.
NextBio26821.
PROO75478.
SOURCESearch...

Entry information

Entry nameTAD2A_HUMAN
AccessionPrimary (citable) accession number: O75478
Secondary accession number(s): A8MVD0 expand/collapse secondary AC list , B3KMU9, Q9BVJ0, Q9UCW2, Q9UP49
Entry history
Integrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: January 11, 2011
Last modified: July 9, 2014
This is version 149 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 17

Human chromosome 17: entries, gene names and cross-references to MIM