SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O75469

- NR1I2_HUMAN

UniProt

O75469 - NR1I2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Nuclear receptor subfamily 1 group I member 2
Gene
NR1I2, PXR
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Nuclear receptor that binds and is activated by variety of endogenous and xenobiotic compounds. Transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics, drugs and endogenous compounds. Activated by the antibiotic rifampicin and various plant metabolites, such as hyperforin, guggulipid, colupulone, and isoflavones. Response to specific ligands is species-specific. Activated by naturally occurring steroids, such as pregnenolone and progesterone. Binds to a response element in the promoters of the CYP3A4 and ABCB1/MDR1 genes.6 Publications

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei247 – 2471Agonist
Binding sitei285 – 2851Agonist
Binding sitei288 – 2881Agonist
Binding sitei299 – 2991Agonist
Binding sitei407 – 4071Agonist

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi38 – 10770Nuclear receptor
Add
BLAST
Zinc fingeri41 – 6121NR C4-type
Add
BLAST
Zinc fingeri77 – 10226NR C4-type
Add
BLAST

GO - Molecular functioni

  1. drug binding Source: UniProtKB
  2. ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity Source: UniProtKB
  3. protein binding Source: UniProtKB
  4. sequence-specific DNA binding Source: InterPro
  5. steroid hormone receptor activity Source: InterPro
  6. transcription coactivator activity Source: ProtInc
  7. zinc ion binding Source: InterPro

GO - Biological processi

  1. drug export Source: UniProtKB
  2. exogenous drug catabolic process Source: UniProtKB
  3. gene expression Source: Reactome
  4. intracellular receptor signaling pathway Source: GOC
  5. negative regulation of transcription, DNA-templated Source: MGI
  6. positive regulation of transcription, DNA-templated Source: UniProtKB
  7. signal transduction Source: ProtInc
  8. steroid metabolic process Source: ProtInc
  9. transcription initiation from RNA polymerase II promoter Source: Reactome
  10. xenobiotic metabolic process Source: UniProtKB
  11. xenobiotic transport Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Activator, Receptor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiREACT_15525. Nuclear Receptor transcription pathway.
SignaLinkiO75469.

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear receptor subfamily 1 group I member 2
Alternative name(s):
Orphan nuclear receptor PAR1
Orphan nuclear receptor PXR
Pregnane X receptor
Steroid and xenobiotic receptor
Short name:
SXR
Gene namesi
Name:NR1I2
Synonyms:PXR
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:7968. NR1I2.

Subcellular locationi

Nucleus 1 Publication

GO - Cellular componenti

  1. nucleoplasm Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi66 – 672RR → AA: Abolishes nuclear localization; when associated with 91-A-A-92. 1 Publication
Mutagenesisi91 – 922RR → AA: Abolishes nuclear localization; when associated with 66-A-A-67. 1 Publication

Organism-specific databases

PharmGKBiPA378.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 434434Nuclear receptor subfamily 1 group I member 2
PRO_0000053547Add
BLAST

Proteomic databases

PaxDbiO75469.
PRIDEiO75469.

PTM databases

PhosphoSiteiO75469.

Expressioni

Tissue specificityi

Expressed in liver, colon and small intestine.

Gene expression databases

ArrayExpressiO75469.
BgeeiO75469.
GenevestigatoriO75469.

Interactioni

Subunit structurei

Heterodimer with RXR. Interacts with NCOA1.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
HSP90AB1P082382EBI-3905991,EBI-352572

Protein-protein interaction databases

BioGridi114380. 36 interactions.
IntActiO75469. 9 interactions.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi145 – 16117
Helixi193 – 20614
Helixi207 – 2093
Beta strandi211 – 2166
Beta strandi222 – 2265
Beta strandi231 – 2333
Helixi234 – 2374
Helixi240 – 26021
Helixi262 – 2654
Helixi269 – 29022
Turni294 – 2974
Beta strandi298 – 3014
Beta strandi304 – 3085
Beta strandi311 – 3133
Helixi315 – 3184
Helixi322 – 33211
Helixi337 – 34812
Beta strandi351 – 3533
Helixi359 – 38022
Helixi384 – 3863
Helixi389 – 41729
Helixi423 – 4286

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1ILGX-ray2.52A130-434[»]
1ILHX-ray2.76A130-434[»]
1M13X-ray2.15A130-434[»]
1NRLX-ray2.00A/B130-434[»]
1SKXX-ray2.80A130-431[»]
2O9IX-ray2.80A/B142-434[»]
2QNVX-ray2.80A130-434[»]
3CTBX-ray2.00A/B130-434[»]
3HVLX-ray2.10A/B130-434[»]
3R8DX-ray2.80A130-434[»]
4J5WX-ray2.80A/B130-434[»]
4J5XX-ray2.80A/B130-434[»]
DisProtiDP00323.
ProteinModelPortaliO75469.
SMRiO75469. Positions 39-124, 142-433.

Miscellaneous databases

EvolutionaryTraceiO75469.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni108 – 20497Hinge
Add
BLAST
Regioni205 – 434230Ligand-binding
Add
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi66 – 9227Bipartite nuclear localization signal
Add
BLAST

Sequence similaritiesi

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiNOG238483.
HOVERGENiHBG108655.
InParanoidiO75469.
KOiK08540.
OMAiHFKNFRL.
PhylomeDBiO75469.
TreeFamiTF316304.

Family and domain databases

Gene3Di1.10.565.10. 2 hits.
3.30.50.10. 1 hit.
InterProiIPR008946. Nucl_hormone_rcpt_ligand-bd.
IPR000536. Nucl_hrmn_rcpt_lig-bd_core.
IPR001723. Str_hrmn_rcpt.
IPR001628. Znf_hrmn_rcpt.
IPR013088. Znf_NHR/GATA.
[Graphical view]
PfamiPF00104. Hormone_recep. 1 hit.
PF00105. zf-C4. 1 hit.
[Graphical view]
PRINTSiPR00398. STRDHORMONER.
PR00047. STROIDFINGER.
SMARTiSM00430. HOLI. 1 hit.
SM00399. ZnF_C4. 1 hit.
[Graphical view]
SUPFAMiSSF48508. SSF48508. 1 hit.
PROSITEiPS00031. NUCLEAR_REC_DBD_1. 1 hit.
PS51030. NUCLEAR_REC_DBD_2. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. Align

Isoform 1A (identifier: O75469-1) [UniParc]FASTAAdd to Basket

Also known as: 1, PRR1-A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MEVRPKESWN HADFVHCEDT ESVPGKPSVN ADEEVGGPQI CRVCGDKATG    50
YHFNVMTCEG CKGFFRRAMK RNARLRCPFR KGACEITRKT RRQCQACRLR 100
KCLESGMKKE MIMSDEAVEE RRALIKRKKS ERTGTQPLGV QGLTEEQRMM 150
IRELMDAQMK TFDTTFSHFK NFRLPGVLSS GCELPESLQA PSREEAAKWS 200
QVRKDLCSLK VSLQLRGEDG SVWNYKPPAD SGGKEIFSLL PHMADMSTYM 250
FKGIISFAKV ISYFRDLPIE DQISLLKGAA FELCQLRFNT VFNAETGTWE 300
CGRLSYCLED TAGGFQQLLL EPMLKFHYML KKLQLHEEEY VLMQAISLFS 350
PDRPGVLQHR VVDQLQEQFA ITLKSYIECN RPQPAHRFLF LKIMAMLTEL 400
RSINAQHTQR LLRIQDIHPF ATPLMQELFG ITGS 434
Length:434
Mass (Da):49,762
Last modified:November 1, 1998 - v1
Checksum:i1DF6A2AE3109C4DA
GO
Isoform 1B (identifier: O75469-2) [UniParc]FASTAAdd to Basket

Also known as: PRR1-B

The sequence of this isoform differs from the canonical sequence as follows:
     1-55: Missing.

Show »
Length:379
Mass (Da):43,706
Checksum:i7B79CBF8A100C0F0
GO
Isoform 1C (identifier: O75469-3) [UniParc]FASTAAdd to Basket

Also known as: PRR1-C

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MDPRGEVGAKNLPPNSPRGPEANL

Show »
Length:457
Mass (Da):52,129
Checksum:i37EFF759461EFE94
GO
Isoform 2A (identifier: O75469-4) [UniParc]FASTAAdd to Basket

Also known as: 2, PRR2-A

The sequence of this isoform differs from the canonical sequence as follows:
     174-210: Missing.

Show »
Length:397
Mass (Da):45,766
Checksum:i5F0007EFD27260F9
GO
Isoform 2B (identifier: O75469-5) [UniParc]FASTAAdd to Basket

Also known as: PRR2-B

The sequence of this isoform differs from the canonical sequence as follows:
     1-55: Missing.
     174-210: Missing.

Show »
Length:342
Mass (Da):39,710
Checksum:i7D4EA16E5A132B0B
GO
Isoform 2C (identifier: O75469-6) [UniParc]FASTAAdd to Basket

Also known as: PRR2-C

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MDPRGEVGAKNLPPNSPRGPEANL
     174-210: Missing.

Show »
Length:420
Mass (Da):48,134
Checksum:iCE6179469491C1EF
GO
Isoform 3 (identifier: O75469-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTVTRTHHFKEGSLRAPAIPLHSAAAELASNHPRGPEANL

Show »
Length:473
Mass (Da):53,899
Checksum:i3049D23C9B903016
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti12 – 121A → T.1 Publication
Corresponds to variant rs1063955 [ dbSNP | Ensembl ].
VAR_050581
Natural varianti18 – 181E → K.1 Publication
Corresponds to variant rs59371185 [ dbSNP | Ensembl ].
VAR_033237
Natural varianti27 – 271P → S in allele PXR*2. 2 Publications
Corresponds to variant rs12721613 [ dbSNP | Ensembl ].
VAR_012228
Natural varianti36 – 361G → R in allele PXR*3. 1 Publication
VAR_012229
Natural varianti98 – 981R → C.1 Publication
VAR_018340
Natural varianti122 – 1221R → Q in allele PXR*4; rare polymorphism. 1 Publication
VAR_012230
Natural varianti148 – 1481R → Q.1 Publication
VAR_018341
Natural varianti370 – 3701A → T.1 Publication
Corresponds to variant rs35761343 [ dbSNP | Ensembl ].
VAR_033238
Natural varianti381 – 3811R → W.1 Publication
VAR_018342
Natural varianti403 – 4031I → V.1 Publication
VAR_018343

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5555Missing in isoform 1B and isoform 2B.
VSP_003668Add
BLAST
Alternative sequencei1 – 11M → MDPRGEVGAKNLPPNSPRGP EANL in isoform 1C and isoform 2C.
VSP_003667
Alternative sequencei1 – 11M → MTVTRTHHFKEGSLRAPAIP LHSAAAELASNHPRGPEANL in isoform 3.
VSP_026669
Alternative sequencei174 – 21037Missing in isoform 2A, isoform 2B and isoform 2C.
VSP_003669Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti109 – 1091K → N in CAB55489. 1 Publication
Sequence conflicti109 – 1091K → N in CAB55490. 1 Publication
Sequence conflicti109 – 1091K → N in CAB55491. 1 Publication
Sequence conflicti109 – 1091K → N in CAB55492. 1 Publication
Sequence conflicti109 – 1091K → N in CAB55493. 1 Publication
Sequence conflicti109 – 1091K → N in CAB55494. 1 Publication
Sequence conflicti174 – 1741Missing in AAH17304. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY091855 mRNA. Translation: AAM26736.1.
AF061056 mRNA. Translation: AAD05436.1.
AF084644 mRNA. Translation: AAC64557.1.
AF084645 mRNA. Translation: AAC64558.1.
AF364606 Genomic DNA. Translation: AAK38720.1.
AF364606 Genomic DNA. Translation: AAK38721.1.
AF364606 Genomic DNA. Translation: AAK38722.1.
AJ009936 mRNA. Translation: CAB55489.1.
AJ009936 mRNA. Translation: CAB55490.1.
AJ009936 mRNA. Translation: CAB55491.1.
AJ009937 mRNA. Translation: CAB55492.1.
AJ009937 mRNA. Translation: CAB55493.1.
AJ009937 mRNA. Translation: CAB55494.1.
DQ911122 Genomic DNA. Translation: ABJ52965.1.
DQ923326 Genomic DNA. Translation: ABJ52966.1.
EF614253 Genomic DNA. Translation: ABR09276.1.
BC017304 mRNA. Translation: AAH17304.2.
CCDSiCCDS2995.1. [O75469-7]
CCDS43136.1. [O75469-1]
CCDS54627.1. [O75469-4]
RefSeqiNP_003880.3. NM_003889.3. [O75469-1]
NP_071285.1. NM_022002.2. [O75469-7]
NP_148934.1. NM_033013.2. [O75469-4]
UniGeneiHs.7303.

Genome annotation databases

EnsembliENST00000337940; ENSP00000336528; ENSG00000144852. [O75469-7]
GeneIDi8856.
KEGGihsa:8856.
UCSCiuc003edi.3. human. [O75469-4]
uc003edj.3. human. [O75469-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

SeattleSNPs

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY091855 mRNA. Translation: AAM26736.1 .
AF061056 mRNA. Translation: AAD05436.1 .
AF084644 mRNA. Translation: AAC64557.1 .
AF084645 mRNA. Translation: AAC64558.1 .
AF364606 Genomic DNA. Translation: AAK38720.1 .
AF364606 Genomic DNA. Translation: AAK38721.1 .
AF364606 Genomic DNA. Translation: AAK38722.1 .
AJ009936 mRNA. Translation: CAB55489.1 .
AJ009936 mRNA. Translation: CAB55490.1 .
AJ009936 mRNA. Translation: CAB55491.1 .
AJ009937 mRNA. Translation: CAB55492.1 .
AJ009937 mRNA. Translation: CAB55493.1 .
AJ009937 mRNA. Translation: CAB55494.1 .
DQ911122 Genomic DNA. Translation: ABJ52965.1 .
DQ923326 Genomic DNA. Translation: ABJ52966.1 .
EF614253 Genomic DNA. Translation: ABR09276.1 .
BC017304 mRNA. Translation: AAH17304.2 .
CCDSi CCDS2995.1. [O75469-7 ]
CCDS43136.1. [O75469-1 ]
CCDS54627.1. [O75469-4 ]
RefSeqi NP_003880.3. NM_003889.3. [O75469-1 ]
NP_071285.1. NM_022002.2. [O75469-7 ]
NP_148934.1. NM_033013.2. [O75469-4 ]
UniGenei Hs.7303.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1ILG X-ray 2.52 A 130-434 [» ]
1ILH X-ray 2.76 A 130-434 [» ]
1M13 X-ray 2.15 A 130-434 [» ]
1NRL X-ray 2.00 A/B 130-434 [» ]
1SKX X-ray 2.80 A 130-431 [» ]
2O9I X-ray 2.80 A/B 142-434 [» ]
2QNV X-ray 2.80 A 130-434 [» ]
3CTB X-ray 2.00 A/B 130-434 [» ]
3HVL X-ray 2.10 A/B 130-434 [» ]
3R8D X-ray 2.80 A 130-434 [» ]
4J5W X-ray 2.80 A/B 130-434 [» ]
4J5X X-ray 2.80 A/B 130-434 [» ]
DisProti DP00323.
ProteinModelPortali O75469.
SMRi O75469. Positions 39-124, 142-433.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 114380. 36 interactions.
IntActi O75469. 9 interactions.

Chemistry

BindingDBi O75469.
ChEMBLi CHEMBL3401.
DrugBanki DB00783. Estradiol.
DB00977. Ethinyl Estradiol.
DB01045. Rifampin.
DB00163. Vitamin E.
GuidetoPHARMACOLOGYi 606.

PTM databases

PhosphoSitei O75469.

Proteomic databases

PaxDbi O75469.
PRIDEi O75469.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000337940 ; ENSP00000336528 ; ENSG00000144852 . [O75469-7 ]
GeneIDi 8856.
KEGGi hsa:8856.
UCSCi uc003edi.3. human. [O75469-4 ]
uc003edj.3. human. [O75469-1 ]

Organism-specific databases

CTDi 8856.
GeneCardsi GC03P119499.
HGNCi HGNC:7968. NR1I2.
MIMi 603065. gene.
neXtProti NX_O75469.
PharmGKBi PA378.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG238483.
HOVERGENi HBG108655.
InParanoidi O75469.
KOi K08540.
OMAi HFKNFRL.
PhylomeDBi O75469.
TreeFami TF316304.

Enzyme and pathway databases

Reactomei REACT_15525. Nuclear Receptor transcription pathway.
SignaLinki O75469.

Miscellaneous databases

EvolutionaryTracei O75469.
GeneWikii Pregnane_X_receptor.
GenomeRNAii 8856.
NextBioi 33249.
PROi O75469.
SOURCEi Search...

Gene expression databases

ArrayExpressi O75469.
Bgeei O75469.
Genevestigatori O75469.

Family and domain databases

Gene3Di 1.10.565.10. 2 hits.
3.30.50.10. 1 hit.
InterProi IPR008946. Nucl_hormone_rcpt_ligand-bd.
IPR000536. Nucl_hrmn_rcpt_lig-bd_core.
IPR001723. Str_hrmn_rcpt.
IPR001628. Znf_hrmn_rcpt.
IPR013088. Znf_NHR/GATA.
[Graphical view ]
Pfami PF00104. Hormone_recep. 1 hit.
PF00105. zf-C4. 1 hit.
[Graphical view ]
PRINTSi PR00398. STRDHORMONER.
PR00047. STROIDFINGER.
SMARTi SM00430. HOLI. 1 hit.
SM00399. ZnF_C4. 1 hit.
[Graphical view ]
SUPFAMi SSF48508. SSF48508. 1 hit.
PROSITEi PS00031. NUCLEAR_REC_DBD_1. 1 hit.
PS51030. NUCLEAR_REC_DBD_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1A).
  2. "The human orphan nuclear receptor PXR is activated by compounds that regulate CYP3A4 gene expression and cause drug interactions."
    Lehmann J.M., McKee D.D., Watson M.A., Willson T.M., Moore J.T., Kliewer S.A.
    J. Clin. Invest. 102:1016-1023(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1A), FUNCTION.
    Tissue: Liver.
  3. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1A AND 3).
    Tissue: Liver.
  4. "The human pregnane X receptor: genomic structure and identification and functional characterization of natural allelic variants."
    Zhang J., Kuehl P., Green E.D., Touchman J.W., Watkins P.B., Daly A., Hall S.D., Maurel P., Relling M., Brimer C., Yasuda K., Wrighton S.A., Hancock M., Kim R.B., Strom S., Thummel K., Russell C.G., Hudson J.R. Jr., Schuetz E.G., Boguski M.S.
    Pharmacogenetics 11:555-572(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1A AND 3), FUNCTION, VARIANTS SER-27; ARG-36 AND GLN-122.
  5. "Identification of a novel protein isoform of the human nuclear hormone receptor PXR/SXR and localization to chromosome 3q12.1 -13.3."
    Heard D.J., Holloway J., Hansen C., Tommerup N., Aagaard L., Vissing H.
    Submitted (JUL-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1A; 1B; 1C; 2A; 2B AND 2C), VARIANT THR-12.
    Tissue: Liver.
  6. Wang X., Li J., Deng X., Chen J., Huang M.
    Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  7. SeattleSNPs variation discovery resource
    Submitted (MAY-2007) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS LYS-18; SER-27 AND THR-370.
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1A).
    Tissue: Hepatoma.
  9. "Nuclear receptor response elements mediate induction of intestinal MDR1 by rifampin."
    Geick A., Eichelbaum M., Burk O.
    J. Biol. Chem. 276:14581-14587(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  10. "Molecular mechanism of nuclear translocation of an orphan nuclear receptor, SXR."
    Kawana K., Ikuta T., Kobayashi Y., Gotoh O., Takeda K., Kawajiri K.
    Mol. Pharmacol. 63:524-531(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, MUTAGENESIS OF 66-ARG-ARG-67 AND 91-ARG-ARG-92, NUCLEAR LOCALIZATION SIGNAL.
  11. "Human CYP3A4 and murine Cyp3A11 are regulated by equol and genistein via the pregnane X receptor in a species-specific manner."
    Li Y., Ross-Viola J.S., Shay N.F., Moore D.D., Ricketts M.L.
    J. Nutr. 139:898-904(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  12. "The human nuclear xenobiotic receptor PXR: structural determinants of directed promiscuity."
    Watkins R.E., Wisely G.B., Moore L.B., Collins J.L., Lambert M.H., Williams S.P., Willson T.M., Kliewer S.A., Redinbo M.R.
    Science 292:2329-2333(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.52 ANGSTROMS) OF 130-434.
  13. "2.1 A crystal structure of human PXR in complex with the St. John's wort compound hyperforin."
    Watkins R.E., Maglich J.M., Moore L.B., Wisely G.B., Noble S.M., Davis-Searles P.R., Lambert M.H., Kliewer S.A., Redinbo M.R.
    Biochemistry 42:1430-1438(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.15 ANGSTROMS) OF 130-434 IN COMPLEX WITH HYPERFORIN, FUNCTION, INTERACTION WITH NCOA1.
  14. "Coactivator binding promotes the specific interaction between ligand and the pregnane X receptor."
    Watkins R.E., Davis-Searles P.R., Lambert M.H., Redinbo M.R.
    J. Mol. Biol. 331:815-828(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 130-434 IN COMPLEX WITH THE CHOLESTEROL-LOWERING COMPOUND SR12813 AND NCOA1.
  15. "Structural disorder in the complex of human pregnane X receptor and the macrolide antibiotic rifampicin."
    Chrencik J.E., Orans J., Moore L.B., Xue Y., Peng L., Collins J.L., Wisely G.B., Lambert M.H., Kliewer S.A., Redinbo M.R.
    Mol. Endocrinol. 19:1125-1134(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.8 ANGSTROMS) OF 130-431 IN COMPLEX WITH RIFAMPICIN.
  16. "Crystal structure of the PXR-T1317 complex provides a scaffold to examine the potential for receptor antagonism."
    Xue Y., Chao E., Zuercher W.J., Willson T.M., Collins J.L., Redinbo M.R.
    Bioorg. Med. Chem. 15:2156-2166(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.8 ANGSTROMS) OF 142-434 IN COMPLEX WITH T0901317 AND NCOA1, INTERACTION WITH NCOA1.
  17. "Structural basis of human pregnane X receptor activation by the hops constituent colupulone."
    Teotico D.G., Bischof J.J., Peng L., Kliewer S.A., Redinbo M.R.
    Mol. Pharmacol. 74:1512-1520(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.8 ANGSTROMS) OF 130-434 IN COMPLEX WITH COLUPULONE, FUNCTION.
  18. "Eleven novel single nucleotide polymorphisms in the NR1I2 (PXR) gene, four of which induce non-synonymous amino acid alterations."
    Koyano S., Kurose K., Ozawa S., Saeki M., Nakajima Y., Hasegawa R., Komamura K., Ueno K., Kamakura S., Nakajima T., Saito H., Kimura H., Goto Y., Saitoh O., Katoh M., Ohnuma T., Kawai M., Sugai K.
    , Ohtsuki T., Suzuki C., Minami N., Saito Y., Sawada J.
    Drug Metab. Pharmacokinet. 17:561-565(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS CYS-98; GLN-148; TRP-381 AND VAL-403.

Entry informationi

Entry nameiNR1I2_HUMAN
AccessioniPrimary (citable) accession number: O75469
Secondary accession number(s): Q006P5
, Q008C8, Q96AC7, Q9UJ22, Q9UJ23, Q9UJ24, Q9UJ25, Q9UJ26, Q9UJ27, Q9UNW4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: November 1, 1998
Last modified: September 3, 2014
This is version 162 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi