Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O75469 (NR1I2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 161. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Nuclear receptor subfamily 1 group I member 2
Alternative name(s):
Orphan nuclear receptor PAR1
Orphan nuclear receptor PXR
Pregnane X receptor
Steroid and xenobiotic receptor
Short name=SXR
Gene names
Name:NR1I2
Synonyms:PXR
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length434 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Nuclear receptor that binds and is activated by variety of endogenous and xenobiotic compounds. Transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics, drugs and endogenous compounds. Activated by the antibiotic rifampicin and various plant metabolites, such as hyperforin, guggulipid, colupulone, and isoflavones. Response to specific ligands is species-specific. Activated by naturally occurring steroids, such as pregnenolone and progesterone. Binds to a response element in the promoters of the CYP3A4 and ABCB1/MDR1 genes. Ref.2 Ref.4 Ref.9 Ref.11 Ref.13 Ref.17

Subunit structure

Heterodimer with RXR. Interacts with NCOA1. Ref.13 Ref.16

Subcellular location

Nucleus Ref.10.

Tissue specificity

Expressed in liver, colon and small intestine.

Sequence similarities

Belongs to the nuclear hormone receptor family. NR1 subfamily.

Contains 1 nuclear receptor DNA-binding domain.

Ontologies

Keywords
   Biological processTranscription
Transcription regulation
   Cellular componentNucleus
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainZinc-finger
   LigandDNA-binding
Metal-binding
Zinc
   Molecular functionActivator
Receptor
   Technical term3D-structure
Complete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processdrug export

Inferred from direct assay Ref.13. Source: UniProtKB

exogenous drug catabolic process

Inferred from direct assay Ref.13. Source: UniProtKB

gene expression

Traceable author statement. Source: Reactome

intracellular receptor signaling pathway

Inferred from direct assay Ref.13. Source: GOC

negative regulation of transcription, DNA-templated

Inferred from direct assay PubMed 11891224. Source: MGI

positive regulation of transcription, DNA-templated

Inferred from direct assay Ref.13. Source: UniProtKB

signal transduction

Traceable author statement Ref.1. Source: ProtInc

steroid metabolic process

Traceable author statement Ref.1. Source: ProtInc

transcription initiation from RNA polymerase II promoter

Traceable author statement. Source: Reactome

xenobiotic metabolic process

Inferred from direct assay Ref.13. Source: UniProtKB

xenobiotic transport

Inferred from direct assay Ref.13. Source: UniProtKB

   Cellular_componentnucleoplasm

Traceable author statement. Source: Reactome

   Molecular_functiondrug binding

Inferred from direct assay Ref.13. Source: UniProtKB

ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity

Inferred from direct assay Ref.13. Source: UniProtKB

protein binding

Inferred from physical interaction Ref.13PubMed 20413580. Source: UniProtKB

sequence-specific DNA binding

Inferred from electronic annotation. Source: InterPro

steroid hormone receptor activity

Inferred from electronic annotation. Source: InterPro

transcription coactivator activity

Traceable author statement Ref.2. Source: ProtInc

zinc ion binding

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Binary interactions

With

Entry

#Exp.

IntAct

Notes

HSP90AB1P082382EBI-3905991,EBI-352572

Alternative products

This entry describes 7 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1A (identifier: O75469-1)

Also known as: 1; PRR1-A;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 1B (identifier: O75469-2)

Also known as: PRR1-B;

The sequence of this isoform differs from the canonical sequence as follows:
     1-55: Missing.
Isoform 1C (identifier: O75469-3)

Also known as: PRR1-C;

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MDPRGEVGAKNLPPNSPRGPEANL
Isoform 2A (identifier: O75469-4)

Also known as: 2; PRR2-A;

The sequence of this isoform differs from the canonical sequence as follows:
     174-210: Missing.
Isoform 2B (identifier: O75469-5)

Also known as: PRR2-B;

The sequence of this isoform differs from the canonical sequence as follows:
     1-55: Missing.
     174-210: Missing.
Isoform 2C (identifier: O75469-6)

Also known as: PRR2-C;

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MDPRGEVGAKNLPPNSPRGPEANL
     174-210: Missing.
Isoform 3 (identifier: O75469-7)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTVTRTHHFKEGSLRAPAIPLHSAAAELASNHPRGPEANL

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 434434Nuclear receptor subfamily 1 group I member 2
PRO_0000053547

Regions

DNA binding38 – 10770Nuclear receptor
Zinc finger41 – 6121NR C4-type
Zinc finger77 – 10226NR C4-type
Region108 – 20497Hinge
Region205 – 434230Ligand-binding
Motif66 – 9227Bipartite nuclear localization signal

Sites

Binding site2471Agonist
Binding site2851Agonist
Binding site2881Agonist
Binding site2991Agonist
Binding site4071Agonist

Natural variations

Alternative sequence1 – 5555Missing in isoform 1B and isoform 2B.
VSP_003668
Alternative sequence11M → MDPRGEVGAKNLPPNSPRGP EANL in isoform 1C and isoform 2C.
VSP_003667
Alternative sequence11M → MTVTRTHHFKEGSLRAPAIP LHSAAAELASNHPRGPEANL in isoform 3.
VSP_026669
Alternative sequence174 – 21037Missing in isoform 2A, isoform 2B and isoform 2C.
VSP_003669
Natural variant121A → T. Ref.5
Corresponds to variant rs1063955 [ dbSNP | Ensembl ].
VAR_050581
Natural variant181E → K. Ref.7
Corresponds to variant rs59371185 [ dbSNP | Ensembl ].
VAR_033237
Natural variant271P → S in allele PXR*2. Ref.4 Ref.7
Corresponds to variant rs12721613 [ dbSNP | Ensembl ].
VAR_012228
Natural variant361G → R in allele PXR*3. Ref.4
VAR_012229
Natural variant981R → C. Ref.18
VAR_018340
Natural variant1221R → Q in allele PXR*4; rare polymorphism. Ref.4
VAR_012230
Natural variant1481R → Q. Ref.18
VAR_018341
Natural variant3701A → T. Ref.7
Corresponds to variant rs35761343 [ dbSNP | Ensembl ].
VAR_033238
Natural variant3811R → W. Ref.18
VAR_018342
Natural variant4031I → V. Ref.18
VAR_018343

Experimental info

Mutagenesis66 – 672RR → AA: Abolishes nuclear localization; when associated with 91-A-A-92. Ref.10
Mutagenesis91 – 922RR → AA: Abolishes nuclear localization; when associated with 66-A-A-67. Ref.10
Sequence conflict1091K → N in CAB55489. Ref.5
Sequence conflict1091K → N in CAB55490. Ref.5
Sequence conflict1091K → N in CAB55491. Ref.5
Sequence conflict1091K → N in CAB55492. Ref.5
Sequence conflict1091K → N in CAB55493. Ref.5
Sequence conflict1091K → N in CAB55494. Ref.5
Sequence conflict1741Missing in AAH17304. Ref.8

Secondary structure

.......................................... 434
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1A (1) (PRR1-A) [UniParc].

Last modified November 1, 1998. Version 1.
Checksum: 1DF6A2AE3109C4DA

FASTA43449,762
        10         20         30         40         50         60 
MEVRPKESWN HADFVHCEDT ESVPGKPSVN ADEEVGGPQI CRVCGDKATG YHFNVMTCEG 

        70         80         90        100        110        120 
CKGFFRRAMK RNARLRCPFR KGACEITRKT RRQCQACRLR KCLESGMKKE MIMSDEAVEE 

       130        140        150        160        170        180 
RRALIKRKKS ERTGTQPLGV QGLTEEQRMM IRELMDAQMK TFDTTFSHFK NFRLPGVLSS 

       190        200        210        220        230        240 
GCELPESLQA PSREEAAKWS QVRKDLCSLK VSLQLRGEDG SVWNYKPPAD SGGKEIFSLL 

       250        260        270        280        290        300 
PHMADMSTYM FKGIISFAKV ISYFRDLPIE DQISLLKGAA FELCQLRFNT VFNAETGTWE 

       310        320        330        340        350        360 
CGRLSYCLED TAGGFQQLLL EPMLKFHYML KKLQLHEEEY VLMQAISLFS PDRPGVLQHR 

       370        380        390        400        410        420 
VVDQLQEQFA ITLKSYIECN RPQPAHRFLF LKIMAMLTEL RSINAQHTQR LLRIQDIHPF 

       430 
ATPLMQELFG ITGS 

« Hide

Isoform 1B (PRR1-B) [UniParc].

Checksum: 7B79CBF8A100C0F0
Show »

FASTA37943,706
Isoform 1C (PRR1-C) [UniParc].

Checksum: 37EFF759461EFE94
Show »

FASTA45752,129
Isoform 2A (2) (PRR2-A) [UniParc].

Checksum: 5F0007EFD27260F9
Show »

FASTA39745,766
Isoform 2B (PRR2-B) [UniParc].

Checksum: 7D4EA16E5A132B0B
Show »

FASTA34239,710
Isoform 2C (PRR2-C) [UniParc].

Checksum: CE6179469491C1EF
Show »

FASTA42048,134
Isoform 3 [UniParc].

Checksum: 3049D23C9B903016
Show »

FASTA47353,899

References

« Hide 'large scale' references
[1]"SXR, a novel steroid and xenobiotic-sensing nuclear receptor."
Blumberg B., Sabbagh W. Jr., Juguilon H., Bolado J. Jr., van Meter C.M., Ong E.S., Evans R.M.
Genes Dev. 12:3195-3205(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1A).
[2]"The human orphan nuclear receptor PXR is activated by compounds that regulate CYP3A4 gene expression and cause drug interactions."
Lehmann J.M., McKee D.D., Watson M.A., Willson T.M., Moore J.T., Kliewer S.A.
J. Clin. Invest. 102:1016-1023(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1A), FUNCTION.
Tissue: Liver.
[3]"Identification of a human nuclear receptor defines a new signaling pathway for CYP3A induction."
Bertilsson G., Heidrich J., Svensson K., Asman M., Jendeberg L., Sydow-Baeckman M., Ohlsson R., Postlind H., Blomquist P., Berkenstam A.
Proc. Natl. Acad. Sci. U.S.A. 95:12208-12213(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1A AND 3).
Tissue: Liver.
[4]"The human pregnane X receptor: genomic structure and identification and functional characterization of natural allelic variants."
Zhang J., Kuehl P., Green E.D., Touchman J.W., Watkins P.B., Daly A., Hall S.D., Maurel P., Relling M., Brimer C., Yasuda K., Wrighton S.A., Hancock M., Kim R.B., Strom S., Thummel K., Russell C.G., Hudson J.R. Jr., Schuetz E.G., Boguski M.S.
Pharmacogenetics 11:555-572(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1A AND 3), FUNCTION, VARIANTS SER-27; ARG-36 AND GLN-122.
[5]"Identification of a novel protein isoform of the human nuclear hormone receptor PXR/SXR and localization to chromosome 3q12.1 -13.3."
Heard D.J., Holloway J., Hansen C., Tommerup N., Aagaard L., Vissing H.
Submitted (JUL-1998) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1A; 1B; 1C; 2A; 2B AND 2C), VARIANT THR-12.
Tissue: Liver.
[6]Wang X., Li J., Deng X., Chen J., Huang M.
Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
[7]SeattleSNPs variation discovery resource
Submitted (MAY-2007) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS LYS-18; SER-27 AND THR-370.
[8]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1A).
Tissue: Hepatoma.
[9]"Nuclear receptor response elements mediate induction of intestinal MDR1 by rifampin."
Geick A., Eichelbaum M., Burk O.
J. Biol. Chem. 276:14581-14587(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
[10]"Molecular mechanism of nuclear translocation of an orphan nuclear receptor, SXR."
Kawana K., Ikuta T., Kobayashi Y., Gotoh O., Takeda K., Kawajiri K.
Mol. Pharmacol. 63:524-531(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBCELLULAR LOCATION, MUTAGENESIS OF 66-ARG-ARG-67 AND 91-ARG-ARG-92, NUCLEAR LOCALIZATION SIGNAL.
[11]"Human CYP3A4 and murine Cyp3A11 are regulated by equol and genistein via the pregnane X receptor in a species-specific manner."
Li Y., Ross-Viola J.S., Shay N.F., Moore D.D., Ricketts M.L.
J. Nutr. 139:898-904(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
[12]"The human nuclear xenobiotic receptor PXR: structural determinants of directed promiscuity."
Watkins R.E., Wisely G.B., Moore L.B., Collins J.L., Lambert M.H., Williams S.P., Willson T.M., Kliewer S.A., Redinbo M.R.
Science 292:2329-2333(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (2.52 ANGSTROMS) OF 130-434.
[13]"2.1 A crystal structure of human PXR in complex with the St. John's wort compound hyperforin."
Watkins R.E., Maglich J.M., Moore L.B., Wisely G.B., Noble S.M., Davis-Searles P.R., Lambert M.H., Kliewer S.A., Redinbo M.R.
Biochemistry 42:1430-1438(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (2.15 ANGSTROMS) OF 130-434 IN COMPLEX WITH HYPERFORIN, FUNCTION, INTERACTION WITH NCOA1.
[14]"Coactivator binding promotes the specific interaction between ligand and the pregnane X receptor."
Watkins R.E., Davis-Searles P.R., Lambert M.H., Redinbo M.R.
J. Mol. Biol. 331:815-828(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 130-434 IN COMPLEX WITH THE CHOLESTEROL-LOWERING COMPOUND SR12813 AND NCOA1.
[15]"Structural disorder in the complex of human pregnane X receptor and the macrolide antibiotic rifampicin."
Chrencik J.E., Orans J., Moore L.B., Xue Y., Peng L., Collins J.L., Wisely G.B., Lambert M.H., Kliewer S.A., Redinbo M.R.
Mol. Endocrinol. 19:1125-1134(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (2.8 ANGSTROMS) OF 130-431 IN COMPLEX WITH RIFAMPICIN.
[16]"Crystal structure of the PXR-T1317 complex provides a scaffold to examine the potential for receptor antagonism."
Xue Y., Chao E., Zuercher W.J., Willson T.M., Collins J.L., Redinbo M.R.
Bioorg. Med. Chem. 15:2156-2166(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (2.8 ANGSTROMS) OF 142-434 IN COMPLEX WITH T0901317 AND NCOA1, INTERACTION WITH NCOA1.
[17]"Structural basis of human pregnane X receptor activation by the hops constituent colupulone."
Teotico D.G., Bischof J.J., Peng L., Kliewer S.A., Redinbo M.R.
Mol. Pharmacol. 74:1512-1520(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (2.8 ANGSTROMS) OF 130-434 IN COMPLEX WITH COLUPULONE, FUNCTION.
[18]"Eleven novel single nucleotide polymorphisms in the NR1I2 (PXR) gene, four of which induce non-synonymous amino acid alterations."
Koyano S., Kurose K., Ozawa S., Saeki M., Nakajima Y., Hasegawa R., Komamura K., Ueno K., Kamakura S., Nakajima T., Saito H., Kimura H., Goto Y., Saitoh O., Katoh M., Ohnuma T., Kawai M., Sugai K. expand/collapse author list , Ohtsuki T., Suzuki C., Minami N., Saito Y., Sawada J.
Drug Metab. Pharmacokinet. 17:561-565(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANTS CYS-98; GLN-148; TRP-381 AND VAL-403.
+Additional computationally mapped references.

Web resources

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY091855 mRNA. Translation: AAM26736.1.
AF061056 mRNA. Translation: AAD05436.1.
AF084644 mRNA. Translation: AAC64557.1.
AF084645 mRNA. Translation: AAC64558.1.
AF364606 Genomic DNA. Translation: AAK38720.1.
AF364606 Genomic DNA. Translation: AAK38721.1.
AF364606 Genomic DNA. Translation: AAK38722.1.
AJ009936 mRNA. Translation: CAB55489.1.
AJ009936 mRNA. Translation: CAB55490.1.
AJ009936 mRNA. Translation: CAB55491.1.
AJ009937 mRNA. Translation: CAB55492.1.
AJ009937 mRNA. Translation: CAB55493.1.
AJ009937 mRNA. Translation: CAB55494.1.
DQ911122 Genomic DNA. Translation: ABJ52965.1.
DQ923326 Genomic DNA. Translation: ABJ52966.1.
EF614253 Genomic DNA. Translation: ABR09276.1.
BC017304 mRNA. Translation: AAH17304.2.
CCDSCCDS2995.1. [O75469-7]
CCDS43136.1. [O75469-1]
CCDS54627.1. [O75469-4]
RefSeqNP_003880.3. NM_003889.3. [O75469-1]
NP_071285.1. NM_022002.2. [O75469-7]
NP_148934.1. NM_033013.2. [O75469-4]
UniGeneHs.7303.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
1ILGX-ray2.52A130-434[»]
1ILHX-ray2.76A130-434[»]
1M13X-ray2.15A130-434[»]
1NRLX-ray2.00A/B130-434[»]
1SKXX-ray2.80A130-431[»]
2O9IX-ray2.80A/B142-434[»]
2QNVX-ray2.80A130-434[»]
3CTBX-ray2.00A/B130-434[»]
3HVLX-ray2.10A/B130-434[»]
3R8DX-ray2.80A130-434[»]
4J5WX-ray2.80A/B130-434[»]
4J5XX-ray2.80A/B130-434[»]
DisProtDP00323.
ProteinModelPortalO75469.
SMRO75469. Positions 39-124, 142-433.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid114380. 36 interactions.
IntActO75469. 9 interactions.

Chemistry

BindingDBO75469.
ChEMBLCHEMBL3401.
DrugBankDB00783. Estradiol.
DB00977. Ethinyl Estradiol.
DB01045. Rifampin.
DB00163. Vitamin E.
GuidetoPHARMACOLOGY606.

PTM databases

PhosphoSiteO75469.

Proteomic databases

PaxDbO75469.
PRIDEO75469.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000337940; ENSP00000336528; ENSG00000144852. [O75469-7]
GeneID8856.
KEGGhsa:8856.
UCSCuc003edi.3. human. [O75469-4]
uc003edj.3. human. [O75469-1]

Organism-specific databases

CTD8856.
GeneCardsGC03P119499.
HGNCHGNC:7968. NR1I2.
MIM603065. gene.
neXtProtNX_O75469.
PharmGKBPA378.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG238483.
HOVERGENHBG108655.
InParanoidO75469.
KOK08540.
OMAHFKNFRL.
PhylomeDBO75469.
TreeFamTF316304.

Enzyme and pathway databases

ReactomeREACT_71. Gene Expression.
SignaLinkO75469.

Gene expression databases

ArrayExpressO75469.
BgeeO75469.
GenevestigatorO75469.

Family and domain databases

Gene3D1.10.565.10. 2 hits.
3.30.50.10. 1 hit.
InterProIPR008946. Nucl_hormone_rcpt_ligand-bd.
IPR000536. Nucl_hrmn_rcpt_lig-bd_core.
IPR001723. Str_hrmn_rcpt.
IPR001628. Znf_hrmn_rcpt.
IPR013088. Znf_NHR/GATA.
[Graphical view]
PfamPF00104. Hormone_recep. 1 hit.
PF00105. zf-C4. 1 hit.
[Graphical view]
PRINTSPR00398. STRDHORMONER.
PR00047. STROIDFINGER.
SMARTSM00430. HOLI. 1 hit.
SM00399. ZnF_C4. 1 hit.
[Graphical view]
SUPFAMSSF48508. SSF48508. 1 hit.
PROSITEPS00031. NUCLEAR_REC_DBD_1. 1 hit.
PS51030. NUCLEAR_REC_DBD_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

EvolutionaryTraceO75469.
GeneWikiPregnane_X_receptor.
GenomeRNAi8856.
NextBio33249.
PROO75469.
SOURCESearch...

Entry information

Entry nameNR1I2_HUMAN
AccessionPrimary (citable) accession number: O75469
Secondary accession number(s): Q006P5 expand/collapse secondary AC list , Q008C8, Q96AC7, Q9UJ22, Q9UJ23, Q9UJ24, Q9UJ25, Q9UJ26, Q9UJ27, Q9UNW4
Entry history
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: November 1, 1998
Last modified: July 9, 2014
This is version 161 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 3

Human chromosome 3: entries, gene names and cross-references to MIM