O75469 (NR1I2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 138.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Nuclear receptor subfamily 1 group I member 2 Alternative name(s): Orphan nuclear receptor PAR1 Orphan nuclear receptor PXR Pregnane X receptor Steroid and xenobiotic receptor Short name=SXR | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 434 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Nuclear receptor that binds and is activated by variety of endogenous and xenobiotic compounds. Transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics, drugs and endogenous compounds. Activated by the antibiotic rifampicin and various plant metabolites, such as hyperforin, guggulipid, colupulone, and isoflavones. Response to specific ligands is species-specific. Activated by naturally occurring steroids, such as pregnenolone and progesterone. Binds to a response element in the promoters of the CYP3A4 and ABCB1/MDR1 genes. Ref.2 Ref.4 Ref.9 Ref.11 Ref.13 Ref.17 |
| Subunit structure | |
| Subcellular location | |
| Tissue specificity | Expressed in liver, colon and small intestine. |
| Sequence similarities | Belongs to the nuclear hormone receptor family. NR1 subfamily. Contains 1 nuclear receptor DNA-binding domain. |
Ontologies
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1A (identifier: O75469-1) Also known as: 1; PRR1-A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1B (identifier: O75469-2) Also known as: PRR1-B; The sequence of this isoform differs from the canonical sequence as follows: 1-55: Missing. | ||||||
| Isoform 1C (identifier: O75469-3) Also known as: PRR1-C; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MDPRGEVGAKNLPPNSPRGPEANL | ||||||
| Isoform 2A (identifier: O75469-4) Also known as: 2; PRR2-A; The sequence of this isoform differs from the canonical sequence as follows: 174-210: Missing. | ||||||
| Isoform 2B (identifier: O75469-5) Also known as: PRR2-B; The sequence of this isoform differs from the canonical sequence as follows: 1-55: Missing. 174-210: Missing. | ||||||
| Isoform 2C (identifier: O75469-6) Also known as: PRR2-C; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MDPRGEVGAKNLPPNSPRGPEANL 174-210: Missing. | ||||||
| Isoform 3 (identifier: O75469-7) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MTVTRTHHFKEGSLRAPAIPLHSAAAELASNHPRGPEANL |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 434 | 434 | Nuclear receptor subfamily 1 group I member 2 | PRO_0000053547 | ||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||
| DNA binding | 38 – 107 | 70 | Nuclear receptor | |||||||||||||||||||||||||||||||||||||||||||
| Zinc finger | 41 – 61 | 21 | NR C4-type | |||||||||||||||||||||||||||||||||||||||||||
| Zinc finger | 77 – 102 | 26 | NR C4-type | |||||||||||||||||||||||||||||||||||||||||||
| Region | 108 – 204 | 97 | Hinge | |||||||||||||||||||||||||||||||||||||||||||
| Region | 205 – 434 | 230 | Ligand-binding | |||||||||||||||||||||||||||||||||||||||||||
| Motif | 66 – 92 | 27 | Bipartite nuclear localization signal | |||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 247 | 1 | Agonist | |||||||||||||||||||||||||||||||||||||||||||
| Binding site | 285 | 1 | Agonist | |||||||||||||||||||||||||||||||||||||||||||
| Binding site | 288 | 1 | Agonist | |||||||||||||||||||||||||||||||||||||||||||
| Binding site | 299 | 1 | Agonist | |||||||||||||||||||||||||||||||||||||||||||
| Binding site | 407 | 1 | Agonist | |||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 55 | 55 | Missing in isoform 1B and isoform 2B. | VSP_003668 | ||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MDPRGEVGAKNLPPNSPRGP EANL in isoform 1C and isoform 2C. | VSP_003667 | ||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MTVTRTHHFKEGSLRAPAIP LHSAAAELASNHPRGPEANL in isoform 3. | VSP_026669 | ||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 174 – 210 | 37 | Missing in isoform 2A, isoform 2B and isoform 2C. | VSP_003669 | ||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 12 | 1 | A → T. Ref.5 Corresponds to variant rs1063955 [ dbSNP | Ensembl ]. | VAR_050581 | ||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 18 | 1 | E → K. Ref.7 Corresponds to variant rs59371185 [ dbSNP | Ensembl ]. | VAR_033237 | ||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 27 | 1 | P → S in allele PXR*2. Ref.4 Ref.7 Corresponds to variant rs12721613 [ dbSNP | Ensembl ]. | VAR_012228 | ||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 36 | 1 | G → R in allele PXR*3. Ref.4 | VAR_012229 | ||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 98 | 1 | R → C. Ref.18 | VAR_018340 | ||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 122 | 1 | R → Q in allele PXR*4; rare polymorphism. Ref.4 | VAR_012230 | ||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 148 | 1 | R → Q. Ref.18 | VAR_018341 | ||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 370 | 1 | A → T. Ref.7 Corresponds to variant rs35761343 [ dbSNP | Ensembl ]. | VAR_033238 | ||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 381 | 1 | R → W. Ref.18 | VAR_018342 | ||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 403 | 1 | I → V. Ref.18 | VAR_018343 | ||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 66 – 67 | 2 | RR → AA: Abolishes nuclear localization; when associated with 91-A-A-92. Ref.10 | |||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 91 – 92 | 2 | RR → AA: Abolishes nuclear localization; when associated with 66-A-A-67. Ref.10 | |||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 109 | 1 | K → N in CAB55489. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 109 | 1 | K → N in CAB55490. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 109 | 1 | K → N in CAB55491. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 109 | 1 | K → N in CAB55492. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 109 | 1 | K → N in CAB55493. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 109 | 1 | K → N in CAB55494. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 174 | 1 | Missing in AAH17304. Ref.8 | |||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 145 – 161 | 17 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 199 – 203 | 5 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 204 – 208 | 5 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 211 – 216 | 6 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 222 – 226 | 5 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 231 – 233 | 3 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 234 – 237 | 4 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 240 – 260 | 21 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 262 – 265 | 4 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 269 – 290 | 22 | ||||||||||||||||||||||||||||||||||||||||||||
| Turn | 294 – 297 | 4 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 298 – 301 | 4 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 304 – 308 | 5 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 314 – 318 | 5 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 322 – 332 | 11 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 337 – 348 | 12 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 359 – 380 | 22 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 384 – 386 | 3 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 389 – 417 | 29 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 423 – 429 | 7 | ||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "SXR, a novel steroid and xenobiotic-sensing nuclear receptor." Blumberg B., Sabbagh W. Jr., Juguilon H., Bolado J. Jr., van Meter C.M., Ong E.S., Evans R.M. Genes Dev. 12:3195-3205(1998) [PubMed: 9784494] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1A). |
| [2] | "The human orphan nuclear receptor PXR is activated by compounds that regulate CYP3A4 gene expression and cause drug interactions." Lehmann J.M., McKee D.D., Watson M.A., Willson T.M., Moore J.T., Kliewer S.A. J. Clin. Invest. 102:1016-1023(1998) [PubMed: 9727070] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1A), FUNCTION. Tissue: Liver. |
| [3] | "Identification of a human nuclear receptor defines a new signaling pathway for CYP3A induction." Bertilsson G., Heidrich J., Svensson K., Asman M., Jendeberg L., Sydow-Baeckman M., Ohlsson R., Postlind H., Blomquist P., Berkenstam A. Proc. Natl. Acad. Sci. U.S.A. 95:12208-12213(1998) [PubMed: 9770465] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1A AND 3). Tissue: Liver. |
| [4] | "The human pregnane X receptor: genomic structure and identification and functional characterization of natural allelic variants." Zhang J., Kuehl P., Green E.D., Touchman J.W., Watkins P.B., Daly A., Hall S.D., Maurel P., Relling M., Brimer C., Yasuda K., Wrighton S.A., Hancock M., Kim R.B., Strom S., Thummel K., Russell C.G., Hudson J.R. Jr., Schuetz E.G., Boguski M.S. Pharmacogenetics 11:555-572(2001) [PubMed: 11668216] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1A AND 3), FUNCTION, VARIANTS SER-27; ARG-36 AND GLN-122. |
| [5] | "Identification of a novel protein isoform of the human nuclear hormone receptor PXR/SXR and localization to chromosome 3q12.1 -13.3." Heard D.J., Holloway J., Hansen C., Tommerup N., Aagaard L., Vissing H. Submitted (JUL-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1A; 1B; 1C; 2A; 2B AND 2C), VARIANT THR-12. Tissue: Liver. |
| [6] | Wang X., Li J., Deng X., Chen J., Huang M. Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [7] | SeattleSNPs variation discovery resource Submitted (MAY-2007) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS LYS-18; SER-27 AND THR-370. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1A). Tissue: Hepatoma. |
| [9] | "Nuclear receptor response elements mediate induction of intestinal MDR1 by rifampin." Geick A., Eichelbaum M., Burk O. J. Biol. Chem. 276:14581-14587(2001) [PubMed: 11297522] [Abstract] Cited for: FUNCTION. |
| [10] | "Molecular mechanism of nuclear translocation of an orphan nuclear receptor, SXR." Kawana K., Ikuta T., Kobayashi Y., Gotoh O., Takeda K., Kawajiri K. Mol. Pharmacol. 63:524-531(2003) [PubMed: 12606758] [Abstract] Cited for: SUBCELLULAR LOCATION, MUTAGENESIS OF 66-ARG-ARG-67 AND 91-ARG-ARG-92, NUCLEAR LOCALIZATION SIGNAL. |
| [11] | "Human CYP3A4 and murine Cyp3A11 are regulated by equol and genistein via the pregnane X receptor in a species-specific manner." Li Y., Ross-Viola J.S., Shay N.F., Moore D.D., Ricketts M.L. J. Nutr. 139:898-904(2009) [PubMed: 19297428] [Abstract] Cited for: FUNCTION. |
| [12] | "The human nuclear xenobiotic receptor PXR: structural determinants of directed promiscuity." Watkins R.E., Wisely G.B., Moore L.B., Collins J.L., Lambert M.H., Williams S.P., Willson T.M., Kliewer S.A., Redinbo M.R. Science 292:2329-2333(2001) [PubMed: 11408620] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.52 ANGSTROMS) OF 130-434. |
| [13] | "2.1 A crystal structure of human PXR in complex with the St. John's wort compound hyperforin." Watkins R.E., Maglich J.M., Moore L.B., Wisely G.B., Noble S.M., Davis-Searles P.R., Lambert M.H., Kliewer S.A., Redinbo M.R. Biochemistry 42:1430-1438(2003) [PubMed: 12578355] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.15 ANGSTROMS) OF 130-434 IN COMPLEX WITH HYPERFORIN, FUNCTION, INTERACTION WITH NCOA1. |
| [14] | "Coactivator binding promotes the specific interaction between ligand and the pregnane X receptor." Watkins R.E., Davis-Searles P.R., Lambert M.H., Redinbo M.R. J. Mol. Biol. 331:815-828(2003) [PubMed: 12909012] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 130-434 IN COMPLEX WITH THE CHOLESTEROL-LOWERING COMPOUND SR12813 AND NCOA1. |
| [15] | "Structural disorder in the complex of human pregnane X receptor and the macrolide antibiotic rifampicin." Chrencik J.E., Orans J., Moore L.B., Xue Y., Peng L., Collins J.L., Wisely G.B., Lambert M.H., Kliewer S.A., Redinbo M.R. Mol. Endocrinol. 19:1125-1134(2005) [PubMed: 15705662] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.8 ANGSTROMS) OF 130-431 IN COMPLEX WITH RIFAMPICIN. |
| [16] | "Crystal structure of the PXR-T1317 complex provides a scaffold to examine the potential for receptor antagonism." Xue Y., Chao E., Zuercher W.J., Willson T.M., Collins J.L., Redinbo M.R. Bioorg. Med. Chem. 15:2156-2166(2007) [PubMed: 17215127] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.8 ANGSTROMS) OF 142-434 IN COMPLEX WITH T0901317 AND NCOA1, INTERACTION WITH NCOA1. |
| [17] | "Structural basis of human pregnane X receptor activation by the hops constituent colupulone." Teotico D.G., Bischof J.J., Peng L., Kliewer S.A., Redinbo M.R. Mol. Pharmacol. 74:1512-1520(2008) [PubMed: 18768384] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.8 ANGSTROMS) OF 130-434 IN COMPLEX WITH COLUPULONE, FUNCTION. |
| [18] | "Eleven novel single nucleotide polymorphisms in the NR1I2 (PXR) gene, four of which induce non-synonymous amino acid alterations." Koyano S., Kurose K., Ozawa S., Saeki M., Nakajima Y., Hasegawa R., Komamura K., Ueno K., Kamakura S., Nakajima T., Saito H., Kimura H., Goto Y., Saitoh O., Katoh M., Ohnuma T., Kawai M., Sugai K. Sawada J.Drug Metab. Pharmacokinet. 17:561-565(2002) [PubMed: 15618712] [Abstract] Cited for: VARIANTS CYS-98; GLN-148; TRP-381 AND VAL-403. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AY091855 mRNA. Translation: AAM26736.1. AF061056 mRNA. Translation: AAD05436.1. AF084644 mRNA. Translation: AAC64557.1. AF084645 mRNA. Translation: AAC64558.1. AF364606 Genomic DNA. Translation: AAK38720.1. AF364606 Genomic DNA. Translation: AAK38721.1. AF364606 Genomic DNA. Translation: AAK38722.1. AJ009936 mRNA. Translation: CAB55489.1. AJ009936 mRNA. Translation: CAB55490.1. AJ009936 mRNA. Translation: CAB55491.1. AJ009937 mRNA. Translation: CAB55492.1. AJ009937 mRNA. Translation: CAB55493.1. AJ009937 mRNA. Translation: CAB55494.1. DQ911122 Genomic DNA. Translation: ABJ52965.1. DQ923326 Genomic DNA. Translation: ABJ52966.1. EF614253 Genomic DNA. Translation: ABR09276.1. BC017304 mRNA. Translation: AAH17304.2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00004364. IPI00220084. IPI00220085. IPI00220086. IPI00334983. IPI00783954. IPI00852956. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_003880.3. NM_003889.3. NP_071285.1. NM_022002.2. NP_148934.1. NM_033013.2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.7303. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | O75469. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMR | O75469. Positions 39-124, 142-433. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DisProt | DP00323. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | O75469. 6 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | O75469. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | O75469. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | O75469. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000337940; ENSP00000336528; ENSG00000144852. ENST00000393716; ENSP00000377319; ENSG00000144852. ENST00000393719; ENSP00000377321; ENSG00000144852. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 8856. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:8856. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc003edi.1. human. uc003edj.1. human. uc003edk.1. human. uc003edl.1. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 8856. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC03P119499. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:7968. NR1I2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 603065. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_O75469. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA378. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | prNOG09718. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneTree | ENSGT00570000079102. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG108655. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | O75469. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | GGKEIFS. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4QVCBX. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_71. Gene Expression. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | O75469. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | O75469. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | O75469. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000144852. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR008946. Nucl_hormone_rcpt_ligand-bd. IPR000536. Nucl_hrmn_rcpt_lig-bd_core. IPR001723. Str_hrmn_rcpt. IPR001628. Znf_hrmn_rcpt. IPR013088. Znf_NHR/GATA. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | G3DSA:1.10.565.10. Nucl_hrmn_rcpt_lig_bd. 2 hits. G3DSA:3.30.50.10. Znf_NHR/GATA. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K08540. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00104. Hormone_recep. 1 hit. PF00105. zf-C4. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR00398. STRDHORMONER. PR00047. STROIDFINGER. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00430. HOLI. 1 hit. SM00399. ZnF_C4. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF48508. Str_ncl_receptor. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS00031. NUCLEAR_REC_DBD_1. 1 hit. PS51030. NUCLEAR_REC_DBD_2. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DrugBank | DB00783. Estradiol. DB00977. Ethinyl Estradiol. DB01045. Rifampin. DB00163. Vitamin E. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 33249. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | NR1I2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O75469 Secondary accession number(s): Q006P5 Q9UNW4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with