Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transcription factor E2F6

Gene

E2F6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Inhibitor of E2F-dependent transcription. Binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3'. Has a preference for the 5'-TTTCCCGC-3' E2F recognition site. E2F6 lacks the transcriptional activation and pocket protein binding domains. Appears to regulate a subset of E2F-dependent genes whose products are required for entry into the cell cycle but not for normal cell cycle progression. May silence expression via the recruitment of a chromatin remodeling complex containing histone H3-K9 methyltransferase activity. Overexpression delays the exit of cells from the S-phase.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi50 – 129Sequence analysisAdd BLAST80

GO - Molecular functioni

  • DNA binding Source: ProtInc
  • protein dimerization activity Source: InterPro
  • RNA polymerase II transcription factor activity, sequence-specific DNA binding Source: NTNU_SB
  • transcription corepressor activity Source: ProtInc

GO - Biological processi

Keywordsi

Molecular functionDNA-binding, Repressor
Biological processCell cycle, Transcription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-HSA-539107 Activation of E2F1 target genes at G1/S
R-HSA-8953750 Transcriptional Regulation by E2F6
SignaLinkiO75461

Names & Taxonomyi

Protein namesi
Recommended name:
Transcription factor E2F6
Short name:
E2F-6
Gene namesi
Name:E2F6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000169016.16
HGNCiHGNC:3120 E2F6
MIMi602944 gene
neXtProtiNX_O75461

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi68L → E: Reduction in repressor activity, little effect on S-phase entry. 1

Organism-specific databases

DisGeNETi1876
OpenTargetsiENSG00000169016
PharmGKBiPA27578

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002194721 – 281Transcription factor E2F6Add BLAST281

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Cross-linki9Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Ubl conjugation

Proteomic databases

EPDiO75461
MaxQBiO75461
PaxDbiO75461
PeptideAtlasiO75461
PRIDEiO75461
ProteomicsDBi50023
50024 [O75461-2]

PTM databases

iPTMnetiO75461
PhosphoSitePlusiO75461

Expressioni

Tissue specificityi

Expressed in all tissues examined. Highest levels in placenta, skeletal muscle, heart, ovary, kidney, small intestine and spleen.

Gene expression databases

BgeeiENSG00000169016
CleanExiHS_E2F6
ExpressionAtlasiO75461 baseline and differential
GenevisibleiO75461 HS

Organism-specific databases

HPAiHPA075185

Interactioni

Subunit structurei

Component of the DRTF1/E2F transcription factor complex. Forms heterodimers with DP family members. Part of the E2F6.com-1 complex in G0 phase composed of E2F6, MGA, MAX, TFDP1, CBX3, BAT8, EUHMTASE1, RING1, RNF2, MBLR, L3MBTL2 and YAF2. Component of some MLL1/MLL complex, at least composed of the core components KMT2A/MLL1, ASH2L, HCFC1/HCF1, WDR5 and RBBP5, as well as the facultative components BAP18, CHD8, E2F6, HSP70, INO80C, KANSL1, LAS1L, MAX, MCRS1, MGA, KAT8/MOF, PELP1, PHF20, PRP31, RING2, RUVB1/TIP49A, RUVB2/TIP49B, SENP3, TAF1, TAF4, TAF6, TAF7, TAF9 and TEX10.2 Publications

Binary interactionsi

Show more details

GO - Molecular functioni

Protein-protein interaction databases

BioGridi108208, 48 interactors
CORUMiO75461
DIPiDIP-41699N
IntActiO75461, 50 interactors
MINTiO75461
STRINGi9606.ENSP00000370936

Structurei

3D structure databases

ProteinModelPortaliO75461
SMRiO75461
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni130 – 222DimerizationSequence analysisAdd BLAST93
Regioni143 – 164Leucine-zipperAdd BLAST22
Regioni173 – 281Transcription repressionAdd BLAST109

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi95 – 129DEF boxAdd BLAST35

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi265 – 268Poly-Glu4

Sequence similaritiesi

Belongs to the E2F/DP family.Curated

Phylogenomic databases

eggNOGiKOG2577 Eukaryota
ENOG410XNYI LUCA
GeneTreeiENSGT00550000074403
HOGENOMiHOG000112309
HOVERGENiHBG002227
InParanoidiO75461
KOiK09390
OMAiSKNLIQW
OrthoDBiEOG091G087U
PhylomeDBiO75461
TreeFamiTF105566

Family and domain databases

CDDicd14660 E2F_DD, 1 hit
Gene3Di1.10.10.10, 1 hit
InterProiView protein in InterPro
IPR015633 E2F
IPR037241 E2F-DP_heterodim
IPR032198 E2F_CC-MB
IPR003316 E2F_WHTH_DNA-bd_dom
IPR015635 Transcription_factor_E2F6
IPR036388 WH-like_DNA-bd_sf
IPR036390 WH_DNA-bd_sf
PANTHERiPTHR12081 PTHR12081, 1 hit
PTHR12081:SF19 PTHR12081:SF19, 1 hit
PfamiView protein in Pfam
PF16421 E2F_CC-MB, 1 hit
PF02319 E2F_TDP, 1 hit
SMARTiView protein in SMART
SM01372 E2F_TDP, 1 hit
SUPFAMiSSF144074 SSF144074, 1 hit
SSF46785 SSF46785, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O75461-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSQQRPARKL PSLLLDPTEE TVRRRCRDPI NVEGLLPSKI RINLEDNVQY
60 70 80 90 100
VSMRKALKVK RPRFDVSLVY LTRKFMDLVR SAPGGILDLN KVATKLGVRK
110 120 130 140 150
RRVYDITNVL DGIDLVEKKS KNHIRWIGSD LSNFGAVPQQ KKLQEELSDL
160 170 180 190 200
SAMEDALDEL IKDCAQQLFE LTDDKENERL AYVTYQDIHS IQAFHEQIVI
210 220 230 240 250
AVKAPAETRL DVPAPREDSI TVHIRSTNGP IDVYLCEVEQ GQTSNKRSEG
260 270 280
VGTSSSESTH PEGPEEEENP QQSEELLEVS N
Length:281
Mass (Da):31,844
Last modified:November 1, 1998 - v1
Checksum:i539E049C15AD3508
GO
Isoform 2 (identifier: O75461-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-75: Missing.

Show »
Length:206
Mass (Da):22,982
Checksum:i6C79669AFD6F42EC
GO
Isoform 3 (identifier: O75461-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MSQQRPARKLPSLLLDPTEETVRRRCRDPINVEGLL → MNPS

Show »
Length:249
Mass (Da):28,103
Checksum:i49DE2FD637490D32
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti7 – 8AR → HE in AAC14694 (PubMed:9501179).Curated2
Sequence conflicti66V → A in AAT02637 (PubMed:15081404).Curated1
Sequence conflicti220I → V in AAC14694 (PubMed:9501179).Curated1
Sequence conflicti229G → E in AAC14694 (PubMed:9501179).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0087711 – 75Missing in isoform 2. 1 PublicationAdd BLAST75
Alternative sequenceiVSP_0547541 – 36MSQQR…VEGLL → MNPS in isoform 3. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF059292 mRNA Translation: AAC31426.1
AY083996 mRNA Translation: AAM10783.1
AY083997 Genomic DNA Translation: AAM10784.1
AY083997 Genomic DNA Translation: AAM10785.1
AY551347 mRNA Translation: AAT02637.1
AJ493061 Genomic DNA Translation: CAD37950.1
AK290413 mRNA Translation: BAF83102.1
AC099344 Genomic DNA Translation: AAY14826.1
CH471053 Genomic DNA Translation: EAX00931.1
BC008348 mRNA Translation: AAH08348.1
BC107740 mRNA Translation: AAI07741.1
AF041381 mRNA Translation: AAC14694.1
CCDSiCCDS1680.2 [O75461-1]
CCDS62858.1 [O75461-2]
CCDS62859.1 [O75461-3]
RefSeqiNP_001265204.1, NM_001278275.1 [O75461-3]
NP_001265205.1, NM_001278276.1 [O75461-2]
NP_001265206.1, NM_001278277.1 [O75461-2]
NP_001265207.1, NM_001278278.1 [O75461-2]
NP_937987.2, NM_198256.3 [O75461-1]
UniGeneiHs.603093

Genome annotation databases

EnsembliENST00000307236; ENSP00000302159; ENSG00000169016 [O75461-3]
ENST00000381525; ENSP00000370936; ENSG00000169016 [O75461-1]
ENST00000542100; ENSP00000446315; ENSG00000169016 [O75461-2]
ENST00000546212; ENSP00000438864; ENSG00000169016 [O75461-2]
GeneIDi1876
KEGGihsa:1876
UCSCiuc002rbf.4 human [O75461-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiE2F6_HUMAN
AccessioniPrimary (citable) accession number: O75461
Secondary accession number(s): A8K2Z8
, G5E936, O60544, Q53QY9, Q6Q9Z6, Q7Z2H6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: November 1, 1998
Last modified: June 20, 2018
This is version 168 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health