Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transcription factor E2F6

Gene

E2F6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Inhibitor of E2F-dependent transcription. Binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3'. Has a preference for the 5'-TTTCCCGC-3' E2F recognition site. E2F6 lacks the transcriptional activation and pocket protein binding domains. Appears to regulate a subset of E2F-dependent genes whose products are required for entry into the cell cycle but not for normal cell cycle progression. May silence expression via the recruitment of a chromatin remodeling complex containing histone H3-K9 methyltransferase activity. Overexpression delays the exit of cells from the S-phase.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi50 – 129Sequence analysisAdd BLAST80

GO - Molecular functioni

  • DNA binding Source: ProtInc
  • transcription corepressor activity Source: ProtInc
  • transcription factor activity, sequence-specific DNA binding Source: Ensembl

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Repressor

Keywords - Biological processi

Cell cycle, Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000169016-MONOMER.
SignaLinkiO75461.

Names & Taxonomyi

Protein namesi
Recommended name:
Transcription factor E2F6
Short name:
E2F-6
Gene namesi
Name:E2F6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:3120. E2F6.

Subcellular locationi

GO - Cellular componenti

  • MLL1 complex Source: UniProtKB
  • nucleus Source: MGI
  • transcription factor complex Source: InterPro
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi68L → E: Reduction in repressor activity, little effect on S-phase entry. 1

Organism-specific databases

DisGeNETi1876.
OpenTargetsiENSG00000169016.
PharmGKBiPA27578.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002194721 – 281Transcription factor E2F6Add BLAST281

Proteomic databases

EPDiO75461.
MaxQBiO75461.
PaxDbiO75461.
PeptideAtlasiO75461.
PRIDEiO75461.

PTM databases

iPTMnetiO75461.
PhosphoSitePlusiO75461.

Expressioni

Tissue specificityi

Expressed in all tissues examined. Highest levels in placenta, skeletal muscle, heart, ovary, kidney, small intestine and spleen.

Gene expression databases

BgeeiENSG00000169016.
CleanExiHS_E2F6.
ExpressionAtlasiO75461. baseline and differential.
GenevisibleiO75461. HS.

Interactioni

Subunit structurei

Component of the DRTF1/E2F transcription factor complex. Forms heterodimers with DP family members. Part of the E2F6.com-1 complex in G0 phase composed of E2F6, MGA, MAX, TFDP1, CBX3, BAT8, EUHMTASE1, RING1, RNF2, MBLR, L3MBTL2 and YAF2. Component of some MLL1/MLL complex, at least composed of the core components KMT2A/MLL1, ASH2L, HCFC1/HCF1, WDR5 and RBBP5, as well as the facultative components BAP18, CHD8, E2F6, HSP70, INO80C, KANSL1, LAS1L, MAX, MCRS1, MGA, KAT8/MOF, PELP1, PHF20, PRP31, RING2, RUVB1/TIP49A, RUVB2/TIP49B, SENP3, TAF1, TAF4, TAF6, TAF7, TAF9 and TEX10.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
KRTAP10-7P604093EBI-749694,EBI-10172290
MAXP612444EBI-749694,EBI-751711
TFDP1Q1418612EBI-749694,EBI-749713
TFDP2Q141888EBI-749694,EBI-752268

Protein-protein interaction databases

BioGridi108208. 47 interactors.
DIPiDIP-41699N.
IntActiO75461. 47 interactors.
MINTiMINT-158232.
STRINGi9606.ENSP00000370936.

Structurei

3D structure databases

ProteinModelPortaliO75461.
SMRiO75461.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni130 – 222DimerizationSequence analysisAdd BLAST93
Regioni143 – 164Leucine-zipperAdd BLAST22
Regioni173 – 281Transcription repressionAdd BLAST109

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi95 – 129DEF boxAdd BLAST35

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi265 – 268Poly-Glu4

Sequence similaritiesi

Belongs to the E2F/DP family.Curated

Phylogenomic databases

eggNOGiKOG2577. Eukaryota.
ENOG410XNYI. LUCA.
GeneTreeiENSGT00550000074403.
HOGENOMiHOG000112309.
HOVERGENiHBG002227.
InParanoidiO75461.
KOiK09390.
OMAiSESTHAE.
OrthoDBiEOG091G087U.
PhylomeDBiO75461.
TreeFamiTF105566.

Family and domain databases

CDDicd14660. E2F_DD. 1 hit.
Gene3Di1.10.10.10. 1 hit.
InterProiIPR015633. E2F.
IPR032198. E2F_CC-MB.
IPR003316. E2F_WHTH_DNA-bd_dom.
IPR015635. Transcription_factor_E2F6.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view]
PANTHERiPTHR12081. PTHR12081. 1 hit.
PTHR12081:SF19. PTHR12081:SF19. 1 hit.
PfamiPF16421. E2F_CC-MB. 1 hit.
PF02319. E2F_TDP. 1 hit.
[Graphical view]
SMARTiSM01372. E2F_TDP. 1 hit.
[Graphical view]
SUPFAMiSSF46785. SSF46785. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O75461-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSQQRPARKL PSLLLDPTEE TVRRRCRDPI NVEGLLPSKI RINLEDNVQY
60 70 80 90 100
VSMRKALKVK RPRFDVSLVY LTRKFMDLVR SAPGGILDLN KVATKLGVRK
110 120 130 140 150
RRVYDITNVL DGIDLVEKKS KNHIRWIGSD LSNFGAVPQQ KKLQEELSDL
160 170 180 190 200
SAMEDALDEL IKDCAQQLFE LTDDKENERL AYVTYQDIHS IQAFHEQIVI
210 220 230 240 250
AVKAPAETRL DVPAPREDSI TVHIRSTNGP IDVYLCEVEQ GQTSNKRSEG
260 270 280
VGTSSSESTH PEGPEEEENP QQSEELLEVS N
Length:281
Mass (Da):31,844
Last modified:November 1, 1998 - v1
Checksum:i539E049C15AD3508
GO
Isoform 2 (identifier: O75461-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-75: Missing.

Show »
Length:206
Mass (Da):22,982
Checksum:i6C79669AFD6F42EC
GO
Isoform 3 (identifier: O75461-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MSQQRPARKLPSLLLDPTEETVRRRCRDPINVEGLL → MNPS

Show »
Length:249
Mass (Da):28,103
Checksum:i49DE2FD637490D32
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti7 – 8AR → HE in AAC14694 (PubMed:9501179).Curated2
Sequence conflicti66V → A in AAT02637 (PubMed:15081404).Curated1
Sequence conflicti220I → V in AAC14694 (PubMed:9501179).Curated1
Sequence conflicti229G → E in AAC14694 (PubMed:9501179).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0087711 – 75Missing in isoform 2. 1 PublicationAdd BLAST75
Alternative sequenceiVSP_0547541 – 36MSQQR…VEGLL → MNPS in isoform 3. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF059292 mRNA. Translation: AAC31426.1.
AY083996 mRNA. Translation: AAM10783.1.
AY083997 Genomic DNA. Translation: AAM10784.1.
AY083997 Genomic DNA. Translation: AAM10785.1.
AY551347 mRNA. Translation: AAT02637.1.
AJ493061 Genomic DNA. Translation: CAD37950.1.
AK290413 mRNA. Translation: BAF83102.1.
AC099344 Genomic DNA. Translation: AAY14826.1.
CH471053 Genomic DNA. Translation: EAX00931.1.
BC008348 mRNA. Translation: AAH08348.1.
BC107740 mRNA. Translation: AAI07741.1.
AF041381 mRNA. Translation: AAC14694.1.
CCDSiCCDS1680.2. [O75461-1]
CCDS62858.1. [O75461-2]
CCDS62859.1. [O75461-3]
RefSeqiNP_001265204.1. NM_001278275.1. [O75461-3]
NP_001265205.1. NM_001278276.1. [O75461-2]
NP_001265206.1. NM_001278277.1. [O75461-2]
NP_001265207.1. NM_001278278.1. [O75461-2]
NP_937987.2. NM_198256.3. [O75461-1]
UniGeneiHs.603093.

Genome annotation databases

EnsembliENST00000307236; ENSP00000302159; ENSG00000169016. [O75461-3]
ENST00000381525; ENSP00000370936; ENSG00000169016. [O75461-1]
ENST00000542100; ENSP00000446315; ENSG00000169016. [O75461-2]
ENST00000546212; ENSP00000438864; ENSG00000169016. [O75461-2]
GeneIDi1876.
KEGGihsa:1876.
UCSCiuc002rbf.4. human. [O75461-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF059292 mRNA. Translation: AAC31426.1.
AY083996 mRNA. Translation: AAM10783.1.
AY083997 Genomic DNA. Translation: AAM10784.1.
AY083997 Genomic DNA. Translation: AAM10785.1.
AY551347 mRNA. Translation: AAT02637.1.
AJ493061 Genomic DNA. Translation: CAD37950.1.
AK290413 mRNA. Translation: BAF83102.1.
AC099344 Genomic DNA. Translation: AAY14826.1.
CH471053 Genomic DNA. Translation: EAX00931.1.
BC008348 mRNA. Translation: AAH08348.1.
BC107740 mRNA. Translation: AAI07741.1.
AF041381 mRNA. Translation: AAC14694.1.
CCDSiCCDS1680.2. [O75461-1]
CCDS62858.1. [O75461-2]
CCDS62859.1. [O75461-3]
RefSeqiNP_001265204.1. NM_001278275.1. [O75461-3]
NP_001265205.1. NM_001278276.1. [O75461-2]
NP_001265206.1. NM_001278277.1. [O75461-2]
NP_001265207.1. NM_001278278.1. [O75461-2]
NP_937987.2. NM_198256.3. [O75461-1]
UniGeneiHs.603093.

3D structure databases

ProteinModelPortaliO75461.
SMRiO75461.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108208. 47 interactors.
DIPiDIP-41699N.
IntActiO75461. 47 interactors.
MINTiMINT-158232.
STRINGi9606.ENSP00000370936.

PTM databases

iPTMnetiO75461.
PhosphoSitePlusiO75461.

Proteomic databases

EPDiO75461.
MaxQBiO75461.
PaxDbiO75461.
PeptideAtlasiO75461.
PRIDEiO75461.

Protocols and materials databases

DNASUi1876.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000307236; ENSP00000302159; ENSG00000169016. [O75461-3]
ENST00000381525; ENSP00000370936; ENSG00000169016. [O75461-1]
ENST00000542100; ENSP00000446315; ENSG00000169016. [O75461-2]
ENST00000546212; ENSP00000438864; ENSG00000169016. [O75461-2]
GeneIDi1876.
KEGGihsa:1876.
UCSCiuc002rbf.4. human. [O75461-1]

Organism-specific databases

CTDi1876.
DisGeNETi1876.
GeneCardsiE2F6.
H-InvDBHIX0060106.
HGNCiHGNC:3120. E2F6.
MIMi602944. gene.
neXtProtiNX_O75461.
OpenTargetsiENSG00000169016.
PharmGKBiPA27578.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2577. Eukaryota.
ENOG410XNYI. LUCA.
GeneTreeiENSGT00550000074403.
HOGENOMiHOG000112309.
HOVERGENiHBG002227.
InParanoidiO75461.
KOiK09390.
OMAiSESTHAE.
OrthoDBiEOG091G087U.
PhylomeDBiO75461.
TreeFamiTF105566.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000169016-MONOMER.
SignaLinkiO75461.

Miscellaneous databases

ChiTaRSiE2F6. human.
GenomeRNAii1876.
PROiO75461.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000169016.
CleanExiHS_E2F6.
ExpressionAtlasiO75461. baseline and differential.
GenevisibleiO75461. HS.

Family and domain databases

CDDicd14660. E2F_DD. 1 hit.
Gene3Di1.10.10.10. 1 hit.
InterProiIPR015633. E2F.
IPR032198. E2F_CC-MB.
IPR003316. E2F_WHTH_DNA-bd_dom.
IPR015635. Transcription_factor_E2F6.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view]
PANTHERiPTHR12081. PTHR12081. 1 hit.
PTHR12081:SF19. PTHR12081:SF19. 1 hit.
PfamiPF16421. E2F_CC-MB. 1 hit.
PF02319. E2F_TDP. 1 hit.
[Graphical view]
SMARTiSM01372. E2F_TDP. 1 hit.
[Graphical view]
SUPFAMiSSF46785. SSF46785. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiE2F6_HUMAN
AccessioniPrimary (citable) accession number: O75461
Secondary accession number(s): A8K2Z8
, G5E936, O60544, Q53QY9, Q6Q9Z6, Q7Z2H6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: November 1, 1998
Last modified: November 30, 2016
This is version 154 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.