Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O75461

- E2F6_HUMAN

UniProt

O75461 - E2F6_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Transcription factor E2F6

Gene

E2F6

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Inhibitor of E2F-dependent transcription. Binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3'. Has a preference for the 5'-TTTCCCGC-3' E2F recognition site. E2F6 lacks the transcriptional activation and pocket protein binding domains. Appears to regulate a subset of E2F-dependent genes whose products are required for entry into the cell cycle but not for normal cell cycle progression. May silence expression via the recruitment of a chromatin remodeling complex containing histone H3-K9 methyltransferase activity. Overexpression delays the exit of cells from the S-phase.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi50 – 12980Sequence AnalysisAdd
BLAST

GO - Molecular functioni

  1. DNA binding Source: ProtInc
  2. sequence-specific DNA binding transcription factor activity Source: Ensembl
  3. transcription corepressor activity Source: ProtInc

GO - Biological processi

  1. negative regulation of transcription from RNA polymerase II promoter Source: ProtInc
  2. regulation of transcription involved in G1/S transition of mitotic cell cycle Source: Ensembl
  3. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Repressor

Keywords - Biological processi

Cell cycle, Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Enzyme and pathway databases

SignaLinkiO75461.

Names & Taxonomyi

Protein namesi
Recommended name:
Transcription factor E2F6
Short name:
E2F-6
Gene namesi
Name:E2F6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:3120. E2F6.

Subcellular locationi

GO - Cellular componenti

  1. MLL1 complex Source: UniProtKB
  2. nucleus Source: MGI
  3. transcription factor complex Source: InterPro
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi68 – 681L → E: Reduction in repressor activity, little effect on S-phase entry.

Organism-specific databases

PharmGKBiPA27578.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 281281Transcription factor E2F6PRO_0000219472Add
BLAST

Proteomic databases

MaxQBiO75461.
PaxDbiO75461.
PRIDEiO75461.

PTM databases

PhosphoSiteiO75461.

Expressioni

Tissue specificityi

Expressed in all tissues examined. Highest levels in placenta, skeletal muscle, heart, ovary, kidney, small intestine and spleen.

Gene expression databases

BgeeiO75461.
CleanExiHS_E2F6.
ExpressionAtlasiO75461. baseline.
GenevestigatoriO75461.

Interactioni

Subunit structurei

Component of the DRTF1/E2F transcription factor complex. Forms heterodimers with DP family members. Part of the E2F6.com-1 complex in G0 phase composed of E2F6, MGA, MAX, TFDP1, CBX3, BAT8, EUHMTASE1, RING1, RNF2, MBLR, L3MBTL2 and YAF2. Component of some MLL1/MLL complex, at least composed of the core components KMT2A/MLL1, ASH2L, HCFC1/HCF1, WDR5 and RBBP5, as well as the facultative components BAP18, CHD8, E2F6, HSP70, INO80C, KANSL1, LAS1L, MAX, MCRS1, MGA, KAT8/MOF, PELP1, PHF20, PRP31, RING2, RUVB1/TIP49A, RUVB2/TIP49B, SENP3, TAF1, TAF4, TAF6, TAF7, TAF9 and TEX10.2 Publications

Protein-protein interaction databases

BioGridi108208. 37 interactions.
DIPiDIP-41699N.
IntActiO75461. 4 interactions.
MINTiMINT-158232.
STRINGi9606.ENSP00000370936.

Structurei

3D structure databases

ProteinModelPortaliO75461.
SMRiO75461. Positions 63-126, 143-239.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni130 – 22293DimerizationSequence AnalysisAdd
BLAST
Regioni143 – 16422Leucine-zipperAdd
BLAST
Regioni173 – 281109Transcription repressionAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi95 – 12935DEF boxAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi265 – 2684Poly-Glu

Sequence similaritiesi

Belongs to the E2F/DP family.Curated

Phylogenomic databases

eggNOGiNOG251536.
GeneTreeiENSGT00550000074403.
HOGENOMiHOG000112309.
HOVERGENiHBG002227.
InParanoidiO75461.
KOiK09390.
OMAiMNASVMT.
PhylomeDBiO75461.
TreeFamiTF105566.

Family and domain databases

Gene3Di1.10.10.10. 1 hit.
InterProiIPR015633. E2F.
IPR003316. E2F_TDP.
IPR015635. Transcription_factor_E2F6.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view]
PANTHERiPTHR12081. PTHR12081. 1 hit.
PTHR12081:SF19. PTHR12081:SF19. 1 hit.
PfamiPF02319. E2F_TDP. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O75461-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSQQRPARKL PSLLLDPTEE TVRRRCRDPI NVEGLLPSKI RINLEDNVQY
60 70 80 90 100
VSMRKALKVK RPRFDVSLVY LTRKFMDLVR SAPGGILDLN KVATKLGVRK
110 120 130 140 150
RRVYDITNVL DGIDLVEKKS KNHIRWIGSD LSNFGAVPQQ KKLQEELSDL
160 170 180 190 200
SAMEDALDEL IKDCAQQLFE LTDDKENERL AYVTYQDIHS IQAFHEQIVI
210 220 230 240 250
AVKAPAETRL DVPAPREDSI TVHIRSTNGP IDVYLCEVEQ GQTSNKRSEG
260 270 280
VGTSSSESTH PEGPEEEENP QQSEELLEVS N
Length:281
Mass (Da):31,844
Last modified:November 1, 1998 - v1
Checksum:i539E049C15AD3508
GO
Isoform 2 (identifier: O75461-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-75: Missing.

Show »
Length:206
Mass (Da):22,982
Checksum:i6C79669AFD6F42EC
GO
Isoform 3 (identifier: O75461-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MSQQRPARKLPSLLLDPTEETVRRRCRDPINVEGLL → MNPS

Show »
Length:249
Mass (Da):28,103
Checksum:i49DE2FD637490D32
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti7 – 82AR → HE in AAC14694. (PubMed:9501179)Curated
Sequence conflicti66 – 661V → A in AAT02637. (PubMed:15081404)Curated
Sequence conflicti220 – 2201I → V in AAC14694. (PubMed:9501179)Curated
Sequence conflicti229 – 2291G → E in AAC14694. (PubMed:9501179)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 7575Missing in isoform 2. 1 PublicationVSP_008771Add
BLAST
Alternative sequencei1 – 3636MSQQR…VEGLL → MNPS in isoform 3. 1 PublicationVSP_054754Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF059292 mRNA. Translation: AAC31426.1.
AY083996 mRNA. Translation: AAM10783.1.
AY083997 Genomic DNA. Translation: AAM10784.1.
AY083997 Genomic DNA. Translation: AAM10785.1.
AY551347 mRNA. Translation: AAT02637.1.
AJ493061 Genomic DNA. Translation: CAD37950.1.
AK290413 mRNA. Translation: BAF83102.1.
AC099344 Genomic DNA. Translation: AAY14826.1.
CH471053 Genomic DNA. Translation: EAX00931.1.
BC008348 mRNA. Translation: AAH08348.1.
BC107740 mRNA. Translation: AAI07741.1.
AF041381 mRNA. Translation: AAC14694.1.
CCDSiCCDS1680.2. [O75461-1]
CCDS62858.1. [O75461-2]
CCDS62859.1. [O75461-3]
RefSeqiNP_001265204.1. NM_001278275.1. [O75461-3]
NP_001265205.1. NM_001278276.1. [O75461-2]
NP_001265206.1. NM_001278277.1. [O75461-2]
NP_001265207.1. NM_001278278.1. [O75461-2]
NP_937987.2. NM_198256.3. [O75461-1]
XP_005246211.1. XM_005246154.2. [O75461-2]
XP_005246212.1. XM_005246155.2. [O75461-2]
UniGeneiHs.603093.

Genome annotation databases

EnsembliENST00000307236; ENSP00000302159; ENSG00000169016. [O75461-3]
ENST00000381525; ENSP00000370936; ENSG00000169016. [O75461-1]
ENST00000542100; ENSP00000446315; ENSG00000169016. [O75461-2]
ENST00000546212; ENSP00000438864; ENSG00000169016. [O75461-2]
GeneIDi1876.
KEGGihsa:1876.
UCSCiuc002rbe.4. human. [O75461-1]
uc002rbf.4. human.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF059292 mRNA. Translation: AAC31426.1 .
AY083996 mRNA. Translation: AAM10783.1 .
AY083997 Genomic DNA. Translation: AAM10784.1 .
AY083997 Genomic DNA. Translation: AAM10785.1 .
AY551347 mRNA. Translation: AAT02637.1 .
AJ493061 Genomic DNA. Translation: CAD37950.1 .
AK290413 mRNA. Translation: BAF83102.1 .
AC099344 Genomic DNA. Translation: AAY14826.1 .
CH471053 Genomic DNA. Translation: EAX00931.1 .
BC008348 mRNA. Translation: AAH08348.1 .
BC107740 mRNA. Translation: AAI07741.1 .
AF041381 mRNA. Translation: AAC14694.1 .
CCDSi CCDS1680.2. [O75461-1 ]
CCDS62858.1. [O75461-2 ]
CCDS62859.1. [O75461-3 ]
RefSeqi NP_001265204.1. NM_001278275.1. [O75461-3 ]
NP_001265205.1. NM_001278276.1. [O75461-2 ]
NP_001265206.1. NM_001278277.1. [O75461-2 ]
NP_001265207.1. NM_001278278.1. [O75461-2 ]
NP_937987.2. NM_198256.3. [O75461-1 ]
XP_005246211.1. XM_005246154.2. [O75461-2 ]
XP_005246212.1. XM_005246155.2. [O75461-2 ]
UniGenei Hs.603093.

3D structure databases

ProteinModelPortali O75461.
SMRi O75461. Positions 63-126, 143-239.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 108208. 37 interactions.
DIPi DIP-41699N.
IntActi O75461. 4 interactions.
MINTi MINT-158232.
STRINGi 9606.ENSP00000370936.

PTM databases

PhosphoSitei O75461.

Proteomic databases

MaxQBi O75461.
PaxDbi O75461.
PRIDEi O75461.

Protocols and materials databases

DNASUi 1876.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000307236 ; ENSP00000302159 ; ENSG00000169016 . [O75461-3 ]
ENST00000381525 ; ENSP00000370936 ; ENSG00000169016 . [O75461-1 ]
ENST00000542100 ; ENSP00000446315 ; ENSG00000169016 . [O75461-2 ]
ENST00000546212 ; ENSP00000438864 ; ENSG00000169016 . [O75461-2 ]
GeneIDi 1876.
KEGGi hsa:1876.
UCSCi uc002rbe.4. human. [O75461-1 ]
uc002rbf.4. human.

Organism-specific databases

CTDi 1876.
GeneCardsi GC02M011584.
H-InvDB HIX0060106.
HGNCi HGNC:3120. E2F6.
MIMi 602944. gene.
neXtProti NX_O75461.
PharmGKBi PA27578.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG251536.
GeneTreei ENSGT00550000074403.
HOGENOMi HOG000112309.
HOVERGENi HBG002227.
InParanoidi O75461.
KOi K09390.
OMAi MNASVMT.
PhylomeDBi O75461.
TreeFami TF105566.

Enzyme and pathway databases

SignaLinki O75461.

Miscellaneous databases

GenomeRNAii 1876.
NextBioi 35518099.
PROi O75461.
SOURCEi Search...

Gene expression databases

Bgeei O75461.
CleanExi HS_E2F6.
ExpressionAtlasi O75461. baseline.
Genevestigatori O75461.

Family and domain databases

Gene3Di 1.10.10.10. 1 hit.
InterProi IPR015633. E2F.
IPR003316. E2F_TDP.
IPR015635. Transcription_factor_E2F6.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view ]
PANTHERi PTHR12081. PTHR12081. 1 hit.
PTHR12081:SF19. PTHR12081:SF19. 1 hit.
Pfami PF02319. E2F_TDP. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Unusual proliferation arrest and transcriptional control properties of a newly discovered E2F family member, E2F-6."
    Gaubatz S., Wood J.G., Livingston D.M.
    Proc. Natl. Acad. Sci. U.S.A. 95:9190-9195(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "E2F-6: a novel member of the E2F family is an inhibitor of E2F-dependent transcription."
    Cartwright P., Mueller H., Wagener C., Holm K., Helin K.
    Oncogene 17:611-623(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 1).
  3. "Sequence for human E2F-6 alternative transcript."
    Salih M., Tuana B.S.
    Submitted (MAR-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1 AND 2).
    Tissue: Heart.
  4. "Human E2F6 is alternatively spliced to generate multiple protein isoforms."
    Kherrouche Z., De Launoit Y., Monte D.
    Biochem. Biophys. Res. Commun. 317:749-760(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
  5. "Cloning, genomic organisation and chromosomal mapping of the human E2F6/EMA gene."
    Schwertfeger N., Taudien S., Truss M., Morkel M., Pohlers M., Gruska I., Haaf T., Rosenthal A., Hagemeier C.
    Submitted (JUL-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Umbilical cord blood.
  7. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Lung.
  10. "E2F-6, a member of the E2F family that can behave as a transcriptional repressor."
    Trimarchi J.M., Fairchild B., Verona R., Moberg K., Andon N., Lees J.A.
    Proc. Natl. Acad. Sci. U.S.A. 95:2850-2855(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 7-281 (ISOFORM 1).
    Tissue: Fetal brain.
  11. "A complex with chromatin modifiers that occupies E2F- and Myc-responsive genes in G0 cells."
    Ogawa H., Ishiguro K., Gaubatz S., Livingston D.M., Nakatani Y.
    Science 296:1132-1136(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION IN COMPLEX WITH TFDP1; MAX; MGA; EUHMTASE1; BAT8; CBX3; RING1; RNF2; MBLR; L3MBTL2 AND YAF2.
  12. "Physical association and coordinate function of the H3 K4 methyltransferase MLL1 and the H4 K16 acetyltransferase MOF."
    Dou Y., Milne T.A., Tackett A.J., Smith E.R., Fukuda A., Wysocka J., Allis C.D., Chait B.T., Hess J.L., Roeder R.G.
    Cell 121:873-885(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION IN THE MLL1/MLL COMPLEX.

Entry informationi

Entry nameiE2F6_HUMAN
AccessioniPrimary (citable) accession number: O75461
Secondary accession number(s): A8K2Z8
, G5E936, O60544, Q53QY9, Q6Q9Z6, Q7Z2H6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: November 1, 1998
Last modified: October 29, 2014
This is version 131 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3