Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O75444

- MAF_HUMAN

UniProt

O75444 - MAF_HUMAN

Protein

Transcription factor Maf

Gene

MAF

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 126 (01 Oct 2014)
      Sequence version 2 (10 Feb 2009)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Acts as a transcriptional activator or repressor. Involved in embryonic lens fiber cell development. Recruits the transcriptional coactivators CREBBP and/or EP300 to crystallin promoters leading to up-regulation of crystallin gene during lens fiber cell differentiation. Activates the expression of IL4 in T helper 2 (Th2) cells. Increases T-cell susceptibility to apoptosis by interacting with MYB and decreasing BCL2 expression. Together with PAX6, transactivates strongly the glucagon gene promoter through the G1 element. Activates transcription of the CD13 proximal promoter in endothelial cells. Represses transcription of the CD13 promoter in early stages of myelopoiesis by affecting the ETS1 and MYB cooperative interaction. Involved in the initial chondrocyte terminal differentiation and the disappearance of hypertrophic chondrocytes during endochondral bone development. Binds to the sequence 5'-[GT]G[GC]N[GT]NCTCAGNN-3' in the L7 promoter. Binds to the T-MARE (Maf response element) sites of lens-specific alpha- and beta-crystallin gene promoters. Binds element G1 on the glucagon promoter. Binds an AT-rich region adjacent to the TGC motif (atypical Maf response element) in the CD13 proximal promoter in endothelial cells By similarity. When overexpressed, represses anti-oxidant response element (ARE)-mediated transcription. Involved either as an oncogene or as a tumor suppressor, depending on the cell context. Binds to the ARE sites of detoxifying enzyme gene promoters.By similarity5 Publications

    GO - Molecular functioni

    1. sequence-specific DNA binding Source: Ensembl
    2. sequence-specific DNA binding transcription factor activity Source: Ensembl

    GO - Biological processi

    1. cell development Source: Ensembl
    2. cytokine production Source: Ensembl
    3. inner ear development Source: Ensembl
    4. lens fiber cell differentiation Source: Ensembl
    5. negative regulation of transcription from RNA polymerase II promoter Source: Ensembl
    6. positive regulation of transcription from RNA polymerase II promoter Source: Ensembl
    7. regulation of chondrocyte differentiation Source: Ensembl
    8. transcription from RNA polymerase II promoter Source: ProtInc

    Keywords - Molecular functioni

    Activator, Repressor

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding

    Enzyme and pathway databases

    SignaLinkiO75444.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Transcription factor Maf
    Alternative name(s):
    Proto-oncogene c-Maf
    V-maf musculoaponeurotic fibrosarcoma oncogene homolog
    Gene namesi
    Name:MAF
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 16

    Organism-specific databases

    HGNCiHGNC:6776. MAF.

    Subcellular locationi

    Nucleus PROSITE-ProRule annotation

    GO - Cellular componenti

    1. chromatin Source: ProtInc
    2. cytoplasm Source: Ensembl
    3. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Involvement in diseasei

    A chromosomal aberration involving MAF is found in some forms of multiple myeloma (MM). Translocation t(14;16)(q32.3;q23) with an IgH locus.
    Cataract 21, multiple types (CTRCT21) [MIM:610202]: An opacification of the crystalline lens of the eye that frequently results in visual impairment or blindness. Opacities vary in morphology, are often confined to a portion of the lens, and may be static or progressive. In general, the more posteriorly located and dense an opacity, the greater the impact on visual function. CTRCT21 includes cerulean and pulverulent cataracts. Cerulean cataracts are characterized by peripheral bluish and white opacifications organized in concentric layers with occasional central lesions arranged radially. The opacities are observed in the superficial layers of the fetal nucleus as well as the adult nucleus of the lens. Involvement is usually bilateral. Visual acuity is only mildly reduced in childhood. In adulthood, the opacifications may progress, making lens extraction necessary. Histologically the lesions are described as fusiform cavities between lens fibers which contain a deeply staining granular material. Although the lesions may take on various colors, a dull blue is the most common appearance and is responsible for the designation cerulean cataract. Pulverulent cataracts are characterized by a dust-like, 'pulverised' appearance of the opacities which can be found in any part of the lens. In some cases cataract is associated with microcornea without any other systemic anomaly or dysmorphism. Microcornea is defined by a corneal diameter inferior to 10 mm in both meridians in an otherwise normal eye.2 Publications
    Note: The disease is caused by mutations affecting the gene represented in this entry.
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti288 – 2881R → P in CTRCT21. 1 Publication
    VAR_029369
    Natural varianti297 – 2971K → R in CTRCT21. 1 Publication
    VAR_029370

    Keywords - Diseasei

    Cataract, Disease mutation, Proto-oncogene, Tumor suppressor

    Organism-specific databases

    MIMi610202. phenotype.
    Orphaneti1377. Cataract-microcornea syndrome.
    98989. Cerulean cataract.
    98984. Pulverulent cataract.
    PharmGKBiPA30534.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 373373Transcription factor MafPRO_0000076491Add
    BLAST

    Post-translational modificationi

    Ubiquitinated, leading to its degradation by the proteasome. Ubiquitination is triggered by glucocorticoids.1 Publication
    Phosphorylated by GSK3 and MAPK13 on serine and threonine residues Probable. The phosphorylation status can serve to either stimulate or inhibit transcription.2 PublicationsCurated

    Keywords - PTMi

    Ubl conjugation

    Proteomic databases

    PaxDbiO75444.
    PRIDEiO75444.

    PTM databases

    PhosphoSiteiO75444.

    Expressioni

    Tissue specificityi

    Expressed in endothelial cells.1 Publication

    Inductioni

    Up-regulated with tert-butyl hydroquinone (t-BHQ).1 Publication

    Gene expression databases

    ArrayExpressiO75444.
    BgeeiO75444.
    CleanExiHS_MAF.
    GenevestigatoriO75444.

    Organism-specific databases

    HPAiCAB010296.
    HPA028289.

    Interactioni

    Subunit structurei

    Homodimer or heterodimer with other bHLH-Zip transcription factors. Binds DNA as a homodimer or as a heterodimer. Heterotetramer of two MAF and two USF2. Interacts with PAX6; the interaction is direct. Interacts with MYB; interaction takes place weakly in normal T-cells and increases in T-cells following stimulation through the TCR engagement. Interacts with MYB; the ternary complex formed with MYB and the CD13 promoter is regulated in response to differentiating signals. Interacts with USF2; the interaction inhibits its DNA-binding activity on the L7 promoter. Interacts with CREBBP, EP300 and ETS1 By similarity.By similarity

    Protein-protein interaction databases

    BioGridi110269. 22 interactions.
    IntActiO75444. 2 interactions.
    STRINGi9606.ENSP00000327048.

    Structurei

    3D structure databases

    ProteinModelPortaliO75444.
    SMRiO75444. Positions 260-351.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini288 – 35164bZIPPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni126 – 373248Represses ARE-mediated transcriptionAdd
    BLAST
    Regioni288 – 31326Basic motifPROSITE-ProRule annotationAdd
    BLAST
    Regioni316 – 33722Leucine-zipperPROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi126 – 254129Gly-richAdd
    BLAST
    Compositional biasi132 – 252121Ala-richAdd
    BLAST
    Compositional biasi180 – 19415His-richAdd
    BLAST

    Sequence similaritiesi

    Belongs to the bZIP family. Maf subfamily.Curated
    Contains 1 bZIP (basic-leucine zipper) domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG241084.
    HOGENOMiHOG000261683.
    HOVERGENiHBG000313.
    InParanoidiO75444.
    KOiK09035.
    OMAiISNGFRE.
    PhylomeDBiO75444.
    TreeFamiTF325689.

    Family and domain databases

    Gene3Di1.10.880.10. 1 hit.
    InterProiIPR004827. bZIP.
    IPR004826. bZIP_Maf.
    IPR013592. Maf_TF_N.
    IPR028573. MafF.
    IPR008917. TF_DNA-bd.
    IPR024874. Transciption_factor_Maf.
    [Graphical view]
    PANTHERiPTHR10129. PTHR10129. 1 hit.
    PTHR10129:SF9. PTHR10129:SF9. 1 hit.
    PfamiPF03131. bZIP_Maf. 1 hit.
    PF08383. Maf_N. 1 hit.
    [Graphical view]
    SMARTiSM00338. BRLZ. 1 hit.
    [Graphical view]
    SUPFAMiSSF47454. SSF47454. 1 hit.
    PROSITEiPS50217. BZIP. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 2 (identifier: O75444-2) [UniParc]FASTAAdd to Basket

    Also known as: Short

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MASELAMSNS DLPTSPLAME YVNDFDLMKF EVKKEPVETD RIISQCGRLI    50
    AGGSLSSTPM STPCSSVPPS PSFSAPSPGS GSEQKAHLED YYWMTGYPQQ 100
    LNPEALGFSP EDAVEALISN SHQLQGGFDG YARGAQQLAA AAGAGAGASL 150
    GGSGEEMGPA AAVVSAVIAA AAAQSGAGPH YHHHHHHAAG HHHHPTAGAP 200
    GAAGSAAASA GGAGGAGGGG PASAGGGGGG GGGGGGGGAA GAGGALHPHH 250
    AAGGLHFDDR FSDEQLVTMS VRELNRQLRG VSKEEVIRLK QKRRTLKNRG 300
    YAQSCRFKRV QQRHVLESEK NQLLQQVDHL KQEISRLVRE RDAYKEKYEK 350
    LVSSGFRENG SSSDNPSSPE FFM 373
    Length:373
    Mass (Da):38,492
    Last modified:February 10, 2009 - v2
    Checksum:i566C2BC3E4A62762
    GO
    Isoform 1 (identifier: O75444-1) [UniParc]FASTAAdd to Basket

    Also known as: Long

    The sequence of this isoform differs from the canonical sequence as follows:
         373-373: M → ITEPTRKLEPSVGYATFWKPQHRVLTSVFTK

    Show »
    Length:403
    Mass (Da):41,961
    Checksum:i263D2FF2AF8DFB5B
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti288 – 2881R → P in CTRCT21. 1 Publication
    VAR_029369
    Natural varianti297 – 2971K → R in CTRCT21. 1 Publication
    VAR_029370

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei373 – 3731M → ITEPTRKLEPSVGYATFWKP QHRVLTSVFTK in isoform 1. 1 PublicationVSP_000583

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF055376 mRNA. Translation: AAC27037.1.
    AF055377 mRNA. Translation: AAC27038.1.
    AF055378 Genomic DNA. Translation: AAC27039.1.
    AC009159 Genomic DNA. No translation available.
    BC081542 mRNA. Translation: AAH81542.1.
    CCDSiCCDS10928.1. [O75444-1]
    CCDS42198.1. [O75444-2]
    RefSeqiNP_001026974.1. NM_001031804.2. [O75444-2]
    NP_005351.2. NM_005360.4. [O75444-1]
    UniGeneiHs.134859.

    Genome annotation databases

    EnsembliENST00000326043; ENSP00000327048; ENSG00000178573. [O75444-1]
    ENST00000393350; ENSP00000377019; ENSG00000178573. [O75444-2]
    GeneIDi4094.
    KEGGihsa:4094.
    UCSCiuc002ffm.3. human. [O75444-1]
    uc002ffn.3. human. [O75444-2]

    Keywords - Coding sequence diversityi

    Alternative splicing, Chromosomal rearrangement

    Cross-referencesi

    Web resourcesi

    Atlas of Genetics and Cytogenetics in Oncology and Haematology

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF055376 mRNA. Translation: AAC27037.1 .
    AF055377 mRNA. Translation: AAC27038.1 .
    AF055378 Genomic DNA. Translation: AAC27039.1 .
    AC009159 Genomic DNA. No translation available.
    BC081542 mRNA. Translation: AAH81542.1 .
    CCDSi CCDS10928.1. [O75444-1 ]
    CCDS42198.1. [O75444-2 ]
    RefSeqi NP_001026974.1. NM_001031804.2. [O75444-2 ]
    NP_005351.2. NM_005360.4. [O75444-1 ]
    UniGenei Hs.134859.

    3D structure databases

    ProteinModelPortali O75444.
    SMRi O75444. Positions 260-351.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 110269. 22 interactions.
    IntActi O75444. 2 interactions.
    STRINGi 9606.ENSP00000327048.

    PTM databases

    PhosphoSitei O75444.

    Proteomic databases

    PaxDbi O75444.
    PRIDEi O75444.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000326043 ; ENSP00000327048 ; ENSG00000178573 . [O75444-1 ]
    ENST00000393350 ; ENSP00000377019 ; ENSG00000178573 . [O75444-2 ]
    GeneIDi 4094.
    KEGGi hsa:4094.
    UCSCi uc002ffm.3. human. [O75444-1 ]
    uc002ffn.3. human. [O75444-2 ]

    Organism-specific databases

    CTDi 4094.
    GeneCardsi GC16M079627.
    H-InvDB HIX0173268.
    HGNCi HGNC:6776. MAF.
    HPAi CAB010296.
    HPA028289.
    MIMi 177075. gene.
    610202. phenotype.
    neXtProti NX_O75444.
    Orphaneti 1377. Cataract-microcornea syndrome.
    98989. Cerulean cataract.
    98984. Pulverulent cataract.
    PharmGKBi PA30534.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG241084.
    HOGENOMi HOG000261683.
    HOVERGENi HBG000313.
    InParanoidi O75444.
    KOi K09035.
    OMAi ISNGFRE.
    PhylomeDBi O75444.
    TreeFami TF325689.

    Enzyme and pathway databases

    SignaLinki O75444.

    Miscellaneous databases

    GeneWikii MAF_(gene).
    GenomeRNAii 4094.
    NextBioi 16054.
    PROi O75444.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O75444.
    Bgeei O75444.
    CleanExi HS_MAF.
    Genevestigatori O75444.

    Family and domain databases

    Gene3Di 1.10.880.10. 1 hit.
    InterProi IPR004827. bZIP.
    IPR004826. bZIP_Maf.
    IPR013592. Maf_TF_N.
    IPR028573. MafF.
    IPR008917. TF_DNA-bd.
    IPR024874. Transciption_factor_Maf.
    [Graphical view ]
    PANTHERi PTHR10129. PTHR10129. 1 hit.
    PTHR10129:SF9. PTHR10129:SF9. 1 hit.
    Pfami PF03131. bZIP_Maf. 1 hit.
    PF08383. Maf_N. 1 hit.
    [Graphical view ]
    SMARTi SM00338. BRLZ. 1 hit.
    [Graphical view ]
    SUPFAMi SSF47454. SSF47454. 1 hit.
    PROSITEi PS50217. BZIP. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Frequent dysregulation of the c-maf proto-oncogene at 16q23 by translocation to an Ig locus in multiple myeloma."
      Chesi M., Bergsagel P.L., Shonukan O.O., Martelli M.L., Brents L.A., Chen T., Schrock E., Ried T., Kuehl W.M.
      Blood 91:4457-4463(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1 AND 2), ALTERNATIVE SPLICING.
    2. "The sequence and analysis of duplication-rich human chromosome 16."
      Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
      , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
      Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Placenta.
    4. "c-Maf negatively regulates ARE-mediated detoxifying enzyme genes expression and anti-oxidant induction."
      Dhakshinamoorthy S., Jaiswal A.K.
      Oncogene 21:5301-5312(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBUNIT, INDUCTION, DNA-BINDING.
    5. "Overexpression of c-maf is a frequent oncogenic event in multiple myeloma that promotes proliferation and pathological interactions with bone marrow stroma."
      Hurt E.M., Wiestner A., Rosenwald A., Shaffer A.L., Campo E., Grogan T., Bergsagel P.L., Kuehl W.M., Staudt L.M.
      Cancer Cell 5:191-199(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    6. "Integration of high-resolution array comparative genomic hybridization analysis of chromosome 16q with expression array data refines common regions of loss at 16q23-qter and identifies underlying candidate tumor suppressor genes in prostate cancer."
      Watson J.E., Doggett N.A., Albertson D.G., Andaya A., Chinnaiyan A., van Dekken H., Ginzinger D., Haqq C., James K., Kamkar S., Kowbel D., Pinkel D., Schmitt L., Simko J.P., Volik S., Weinberg V.K., Paris P.L., Collins C.
      Oncogene 23:3487-3494(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    7. Cited for: PHOSPHORYLATION.
    8. "A chemical biology screen identifies glucocorticoids that regulate c-maf expression by increasing its proteasomal degradation through up-regulation of ubiquitin."
      Mao X., Stewart A.K., Hurren R., Datti A., Zhu X., Zhu Y., Shi C., Lee K., Tiedemann R., Eberhard Y., Trudel S., Liang S., Corey S.J., Gillis L.C., Barber D.L., Wrana J.L., Ezzat S., Schimmer A.D.
      Blood 110:4047-4054(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: UBIQUITINATION.
    9. Cited for: FUNCTION.
    10. "CD13/APN transcription is regulated by the proto-oncogene c-Maf via an atypical response element."
      Mahoney K.M., Petrovic N., Schacke W., Shapiro L.H.
      Gene 403:178-187(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.
    11. Cited for: PHOSPHORYLATION.
    12. Cited for: REVIEW, FUNCTION.
    13. "Domain disruption and mutation of the bZIP transcription factor, MAF, associated with cataract, ocular anterior segment dysgenesis and coloboma."
      Jamieson R.V., Perveen R., Kerr B., Carette M., Yardley J., Heon E., Wirth M.G., van Heyningen V., Donnai D., Munier F., Black G.C.
      Hum. Mol. Genet. 11:33-42(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT CTRCT21 PRO-288.
    14. "A novel mutation in the DNA-binding domain of MAF at 16q23.1 associated with autosomal dominant 'cerulean cataract' in an Indian family."
      Vanita V., Singh D., Robinson P.N., Sperling K., Singh J.R.
      Am. J. Med. Genet. A 140:558-566(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT CTRCT21 ARG-297.

    Entry informationi

    Entry nameiMAF_HUMAN
    AccessioniPrimary (citable) accession number: O75444
    Secondary accession number(s): Q66I47, Q9UP93
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 11, 2002
    Last sequence update: February 10, 2009
    Last modified: October 1, 2014
    This is version 126 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 16
      Human chromosome 16: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3