Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O75444

- MAF_HUMAN

UniProt

O75444 - MAF_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Transcription factor Maf

Gene

MAF

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Acts as a transcriptional activator or repressor. Involved in embryonic lens fiber cell development. Recruits the transcriptional coactivators CREBBP and/or EP300 to crystallin promoters leading to up-regulation of crystallin gene during lens fiber cell differentiation. Activates the expression of IL4 in T helper 2 (Th2) cells. Increases T-cell susceptibility to apoptosis by interacting with MYB and decreasing BCL2 expression. Together with PAX6, transactivates strongly the glucagon gene promoter through the G1 element. Activates transcription of the CD13 proximal promoter in endothelial cells. Represses transcription of the CD13 promoter in early stages of myelopoiesis by affecting the ETS1 and MYB cooperative interaction. Involved in the initial chondrocyte terminal differentiation and the disappearance of hypertrophic chondrocytes during endochondral bone development. Binds to the sequence 5'-[GT]G[GC]N[GT]NCTCAGNN-3' in the L7 promoter. Binds to the T-MARE (Maf response element) sites of lens-specific alpha- and beta-crystallin gene promoters. Binds element G1 on the glucagon promoter. Binds an AT-rich region adjacent to the TGC motif (atypical Maf response element) in the CD13 proximal promoter in endothelial cells (By similarity). When overexpressed, represses anti-oxidant response element (ARE)-mediated transcription. Involved either as an oncogene or as a tumor suppressor, depending on the cell context. Binds to the ARE sites of detoxifying enzyme gene promoters.By similarity5 Publications

GO - Molecular functioni

  1. sequence-specific DNA binding Source: Ensembl
  2. sequence-specific DNA binding transcription factor activity Source: Ensembl

GO - Biological processi

  1. cell development Source: Ensembl
  2. cytokine production Source: Ensembl
  3. inner ear development Source: Ensembl
  4. lens fiber cell differentiation Source: Ensembl
  5. negative regulation of transcription from RNA polymerase II promoter Source: Ensembl
  6. positive regulation of transcription from RNA polymerase II promoter Source: Ensembl
  7. regulation of chondrocyte differentiation Source: Ensembl
  8. transcription from RNA polymerase II promoter Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Activator, Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Enzyme and pathway databases

SignaLinkiO75444.

Names & Taxonomyi

Protein namesi
Recommended name:
Transcription factor Maf
Alternative name(s):
Proto-oncogene c-Maf
V-maf musculoaponeurotic fibrosarcoma oncogene homolog
Gene namesi
Name:MAF
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 16

Organism-specific databases

HGNCiHGNC:6776. MAF.

Subcellular locationi

Nucleus PROSITE-ProRule annotation

GO - Cellular componenti

  1. chromatin Source: ProtInc
  2. cytoplasm Source: Ensembl
  3. nucleus Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Involvement in diseasei

A chromosomal aberration involving MAF is found in some forms of multiple myeloma (MM). Translocation t(14;16)(q32.3;q23) with an IgH locus.
Cataract 21, multiple types (CTRCT21) [MIM:610202]: An opacification of the crystalline lens of the eye that frequently results in visual impairment or blindness. Opacities vary in morphology, are often confined to a portion of the lens, and may be static or progressive. In general, the more posteriorly located and dense an opacity, the greater the impact on visual function. CTRCT21 includes cerulean and pulverulent cataracts. Cerulean cataracts are characterized by peripheral bluish and white opacifications organized in concentric layers with occasional central lesions arranged radially. The opacities are observed in the superficial layers of the fetal nucleus as well as the adult nucleus of the lens. Involvement is usually bilateral. Visual acuity is only mildly reduced in childhood. In adulthood, the opacifications may progress, making lens extraction necessary. Histologically the lesions are described as fusiform cavities between lens fibers which contain a deeply staining granular material. Although the lesions may take on various colors, a dull blue is the most common appearance and is responsible for the designation cerulean cataract. Pulverulent cataracts are characterized by a dust-like, 'pulverised' appearance of the opacities which can be found in any part of the lens. In some cases cataract is associated with microcornea without any other systemic anomaly or dysmorphism. Microcornea is defined by a corneal diameter inferior to 10 mm in both meridians in an otherwise normal eye.2 Publications
Note: The disease is caused by mutations affecting the gene represented in this entry.
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti288 – 2881R → P in CTRCT21. 1 Publication
VAR_029369
Natural varianti297 – 2971K → R in CTRCT21. 1 Publication
VAR_029370

Keywords - Diseasei

Cataract, Disease mutation, Proto-oncogene, Tumor suppressor

Organism-specific databases

MIMi610202. phenotype.
Orphaneti1377. Cataract-microcornea syndrome.
98989. Cerulean cataract.
98984. Pulverulent cataract.
PharmGKBiPA30534.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 373373Transcription factor MafPRO_0000076491Add
BLAST

Post-translational modificationi

Ubiquitinated, leading to its degradation by the proteasome. Ubiquitination is triggered by glucocorticoids.1 Publication
Phosphorylated by GSK3 and MAPK13 on serine and threonine residues (Probable). The phosphorylation status can serve to either stimulate or inhibit transcription.2 PublicationsCurated

Keywords - PTMi

Ubl conjugation

Proteomic databases

PaxDbiO75444.
PRIDEiO75444.

PTM databases

PhosphoSiteiO75444.

Expressioni

Tissue specificityi

Expressed in endothelial cells.1 Publication

Inductioni

Up-regulated with tert-butyl hydroquinone (t-BHQ).1 Publication

Gene expression databases

BgeeiO75444.
CleanExiHS_MAF.
ExpressionAtlasiO75444. baseline and differential.
GenevestigatoriO75444.

Organism-specific databases

HPAiCAB010296.
HPA028289.

Interactioni

Subunit structurei

Homodimer or heterodimer with other bHLH-Zip transcription factors. Binds DNA as a homodimer or as a heterodimer. Heterotetramer of two MAF and two USF2. Interacts with PAX6; the interaction is direct. Interacts with MYB; interaction takes place weakly in normal T-cells and increases in T-cells following stimulation through the TCR engagement. Interacts with MYB; the ternary complex formed with MYB and the CD13 promoter is regulated in response to differentiating signals. Interacts with USF2; the interaction inhibits its DNA-binding activity on the L7 promoter. Interacts with CREBBP, EP300 and ETS1 (By similarity).By similarity

Protein-protein interaction databases

BioGridi110269. 22 interactions.
IntActiO75444. 2 interactions.
STRINGi9606.ENSP00000327048.

Structurei

3D structure databases

ProteinModelPortaliO75444.
SMRiO75444. Positions 260-351.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini288 – 35164bZIPPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni126 – 373248Represses ARE-mediated transcriptionAdd
BLAST
Regioni288 – 31326Basic motifPROSITE-ProRule annotationAdd
BLAST
Regioni316 – 33722Leucine-zipperPROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi126 – 254129Gly-richAdd
BLAST
Compositional biasi132 – 252121Ala-richAdd
BLAST
Compositional biasi180 – 19415His-richAdd
BLAST

Sequence similaritiesi

Belongs to the bZIP family. Maf subfamily.Curated
Contains 1 bZIP (basic-leucine zipper) domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG241084.
GeneTreeiENSGT00550000074549.
HOGENOMiHOG000261683.
HOVERGENiHBG000313.
InParanoidiO75444.
KOiK09035.
OMAiISNGFRE.
PhylomeDBiO75444.
TreeFamiTF325689.

Family and domain databases

Gene3Di1.10.880.10. 1 hit.
InterProiIPR004827. bZIP.
IPR004826. bZIP_Maf.
IPR013592. Maf_TF_N.
IPR028573. MafF.
IPR008917. TF_DNA-bd.
IPR024874. Transciption_factor_Maf.
[Graphical view]
PANTHERiPTHR10129. PTHR10129. 1 hit.
PTHR10129:SF9. PTHR10129:SF9. 1 hit.
PfamiPF03131. bZIP_Maf. 1 hit.
PF08383. Maf_N. 1 hit.
[Graphical view]
SMARTiSM00338. BRLZ. 1 hit.
[Graphical view]
SUPFAMiSSF47454. SSF47454. 1 hit.
PROSITEiPS50217. BZIP. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 2 (identifier: O75444-2) [UniParc]FASTAAdd to Basket

Also known as: Short

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASELAMSNS DLPTSPLAME YVNDFDLMKF EVKKEPVETD RIISQCGRLI
60 70 80 90 100
AGGSLSSTPM STPCSSVPPS PSFSAPSPGS GSEQKAHLED YYWMTGYPQQ
110 120 130 140 150
LNPEALGFSP EDAVEALISN SHQLQGGFDG YARGAQQLAA AAGAGAGASL
160 170 180 190 200
GGSGEEMGPA AAVVSAVIAA AAAQSGAGPH YHHHHHHAAG HHHHPTAGAP
210 220 230 240 250
GAAGSAAASA GGAGGAGGGG PASAGGGGGG GGGGGGGGAA GAGGALHPHH
260 270 280 290 300
AAGGLHFDDR FSDEQLVTMS VRELNRQLRG VSKEEVIRLK QKRRTLKNRG
310 320 330 340 350
YAQSCRFKRV QQRHVLESEK NQLLQQVDHL KQEISRLVRE RDAYKEKYEK
360 370
LVSSGFRENG SSSDNPSSPE FFM
Length:373
Mass (Da):38,492
Last modified:February 10, 2009 - v2
Checksum:i566C2BC3E4A62762
GO
Isoform 1 (identifier: O75444-1) [UniParc]FASTAAdd to Basket

Also known as: Long

The sequence of this isoform differs from the canonical sequence as follows:
     373-373: M → ITEPTRKLEPSVGYATFWKPQHRVLTSVFTK

Show »
Length:403
Mass (Da):41,961
Checksum:i263D2FF2AF8DFB5B
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti288 – 2881R → P in CTRCT21. 1 Publication
VAR_029369
Natural varianti297 – 2971K → R in CTRCT21. 1 Publication
VAR_029370

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei373 – 3731M → ITEPTRKLEPSVGYATFWKP QHRVLTSVFTK in isoform 1. 1 PublicationVSP_000583

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF055376 mRNA. Translation: AAC27037.1.
AF055377 mRNA. Translation: AAC27038.1.
AF055378 Genomic DNA. Translation: AAC27039.1.
AC009159 Genomic DNA. No translation available.
BC081542 mRNA. Translation: AAH81542.1.
CCDSiCCDS10928.1. [O75444-1]
CCDS42198.1. [O75444-2]
RefSeqiNP_001026974.1. NM_001031804.2. [O75444-2]
NP_005351.2. NM_005360.4. [O75444-1]
UniGeneiHs.134859.

Genome annotation databases

EnsembliENST00000326043; ENSP00000327048; ENSG00000178573. [O75444-1]
ENST00000393350; ENSP00000377019; ENSG00000178573. [O75444-2]
GeneIDi4094.
KEGGihsa:4094.
UCSCiuc002ffm.3. human. [O75444-1]
uc002ffn.3. human. [O75444-2]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF055376 mRNA. Translation: AAC27037.1 .
AF055377 mRNA. Translation: AAC27038.1 .
AF055378 Genomic DNA. Translation: AAC27039.1 .
AC009159 Genomic DNA. No translation available.
BC081542 mRNA. Translation: AAH81542.1 .
CCDSi CCDS10928.1. [O75444-1 ]
CCDS42198.1. [O75444-2 ]
RefSeqi NP_001026974.1. NM_001031804.2. [O75444-2 ]
NP_005351.2. NM_005360.4. [O75444-1 ]
UniGenei Hs.134859.

3D structure databases

ProteinModelPortali O75444.
SMRi O75444. Positions 260-351.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 110269. 22 interactions.
IntActi O75444. 2 interactions.
STRINGi 9606.ENSP00000327048.

PTM databases

PhosphoSitei O75444.

Proteomic databases

PaxDbi O75444.
PRIDEi O75444.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000326043 ; ENSP00000327048 ; ENSG00000178573 . [O75444-1 ]
ENST00000393350 ; ENSP00000377019 ; ENSG00000178573 . [O75444-2 ]
GeneIDi 4094.
KEGGi hsa:4094.
UCSCi uc002ffm.3. human. [O75444-1 ]
uc002ffn.3. human. [O75444-2 ]

Organism-specific databases

CTDi 4094.
GeneCardsi GC16M079627.
H-InvDB HIX0173268.
HGNCi HGNC:6776. MAF.
HPAi CAB010296.
HPA028289.
MIMi 177075. gene.
610202. phenotype.
neXtProti NX_O75444.
Orphaneti 1377. Cataract-microcornea syndrome.
98989. Cerulean cataract.
98984. Pulverulent cataract.
PharmGKBi PA30534.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG241084.
GeneTreei ENSGT00550000074549.
HOGENOMi HOG000261683.
HOVERGENi HBG000313.
InParanoidi O75444.
KOi K09035.
OMAi ISNGFRE.
PhylomeDBi O75444.
TreeFami TF325689.

Enzyme and pathway databases

SignaLinki O75444.

Miscellaneous databases

GeneWikii MAF_(gene).
GenomeRNAii 4094.
NextBioi 16054.
PROi O75444.
SOURCEi Search...

Gene expression databases

Bgeei O75444.
CleanExi HS_MAF.
ExpressionAtlasi O75444. baseline and differential.
Genevestigatori O75444.

Family and domain databases

Gene3Di 1.10.880.10. 1 hit.
InterProi IPR004827. bZIP.
IPR004826. bZIP_Maf.
IPR013592. Maf_TF_N.
IPR028573. MafF.
IPR008917. TF_DNA-bd.
IPR024874. Transciption_factor_Maf.
[Graphical view ]
PANTHERi PTHR10129. PTHR10129. 1 hit.
PTHR10129:SF9. PTHR10129:SF9. 1 hit.
Pfami PF03131. bZIP_Maf. 1 hit.
PF08383. Maf_N. 1 hit.
[Graphical view ]
SMARTi SM00338. BRLZ. 1 hit.
[Graphical view ]
SUPFAMi SSF47454. SSF47454. 1 hit.
PROSITEi PS50217. BZIP. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Frequent dysregulation of the c-maf proto-oncogene at 16q23 by translocation to an Ig locus in multiple myeloma."
    Chesi M., Bergsagel P.L., Shonukan O.O., Martelli M.L., Brents L.A., Chen T., Schrock E., Ried T., Kuehl W.M.
    Blood 91:4457-4463(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1 AND 2), ALTERNATIVE SPLICING.
  2. "The sequence and analysis of duplication-rich human chromosome 16."
    Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
    , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
    Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Placenta.
  4. "c-Maf negatively regulates ARE-mediated detoxifying enzyme genes expression and anti-oxidant induction."
    Dhakshinamoorthy S., Jaiswal A.K.
    Oncogene 21:5301-5312(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBUNIT, INDUCTION, DNA-BINDING.
  5. "Overexpression of c-maf is a frequent oncogenic event in multiple myeloma that promotes proliferation and pathological interactions with bone marrow stroma."
    Hurt E.M., Wiestner A., Rosenwald A., Shaffer A.L., Campo E., Grogan T., Bergsagel P.L., Kuehl W.M., Staudt L.M.
    Cancer Cell 5:191-199(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  6. "Integration of high-resolution array comparative genomic hybridization analysis of chromosome 16q with expression array data refines common regions of loss at 16q23-qter and identifies underlying candidate tumor suppressor genes in prostate cancer."
    Watson J.E., Doggett N.A., Albertson D.G., Andaya A., Chinnaiyan A., van Dekken H., Ginzinger D., Haqq C., James K., Kamkar S., Kowbel D., Pinkel D., Schmitt L., Simko J.P., Volik S., Weinberg V.K., Paris P.L., Collins C.
    Oncogene 23:3487-3494(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  7. Cited for: PHOSPHORYLATION.
  8. "A chemical biology screen identifies glucocorticoids that regulate c-maf expression by increasing its proteasomal degradation through up-regulation of ubiquitin."
    Mao X., Stewart A.K., Hurren R., Datti A., Zhu X., Zhu Y., Shi C., Lee K., Tiedemann R., Eberhard Y., Trudel S., Liang S., Corey S.J., Gillis L.C., Barber D.L., Wrana J.L., Ezzat S., Schimmer A.D.
    Blood 110:4047-4054(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: UBIQUITINATION.
  9. Cited for: FUNCTION.
  10. "CD13/APN transcription is regulated by the proto-oncogene c-Maf via an atypical response element."
    Mahoney K.M., Petrovic N., Schacke W., Shapiro L.H.
    Gene 403:178-187(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  11. Cited for: PHOSPHORYLATION.
  12. Cited for: REVIEW, FUNCTION.
  13. "Domain disruption and mutation of the bZIP transcription factor, MAF, associated with cataract, ocular anterior segment dysgenesis and coloboma."
    Jamieson R.V., Perveen R., Kerr B., Carette M., Yardley J., Heon E., Wirth M.G., van Heyningen V., Donnai D., Munier F., Black G.C.
    Hum. Mol. Genet. 11:33-42(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT CTRCT21 PRO-288.
  14. "A novel mutation in the DNA-binding domain of MAF at 16q23.1 associated with autosomal dominant 'cerulean cataract' in an Indian family."
    Vanita V., Singh D., Robinson P.N., Sperling K., Singh J.R.
    Am. J. Med. Genet. A 140:558-566(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT CTRCT21 ARG-297.

Entry informationi

Entry nameiMAF_HUMAN
AccessioniPrimary (citable) accession number: O75444
Secondary accession number(s): Q66I47, Q9UP93
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 11, 2002
Last sequence update: February 10, 2009
Last modified: October 29, 2014
This is version 127 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3