Reviewed,
UniProtKB/Swiss-Prot O75444 (MAF_HUMAN)
Last modified
November 25, 2008.
Version 61.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Transcription factor Maf Alternative name(s): Proto-oncogene c-maf | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 403 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Subcellular location | NucleusBy similarity. |
| Involvement in disease | A chromosomal aberration involving MAF is found in some forms of multiple myeloma (MM). Translocation t(14;16)(q32.3;q23) with an IgH locus. Defects in MAF are the cause of juvenile-onset pulverulent cataract [MIM:610202]. Cataract is a partial or complete ocular opacity that affects the crystalline lens or its capsule, leading to impaired vision or blindness. Defects in MAF are the cause of congenital cerulean cataract 4 (CCA4) [MIM:610202]. CCA4 is a form of autosomal dominant congenital cataract (ADCC). Cerulean cataracts have peripheral bluish and white opacifications in concentric layers with occasional central lesions arranged radially. Although the opacities may be observed during fetal development and childhood, usually visual acuity is only mildly reduced until adulthood, when lens extraction is generally necessary. |
| Sequence similarities | Belongs to the bZIP family. Maf subfamily. Contains 1 bZIP domain. |
Ontologies
Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing Chromosomal rearrangement |
| Disease | Cataract Disease mutation Proto-oncogene |
| Ligand | DNA-binding |
Gene Ontology (GO) | |
| Cellular component | chromatin Ref.1 Traceable author statement. Source: ProtInc nucleusInferred from electronic annotation. Source: InterPro |
| Molecular function | RNA polymerase II transcription factor activity Ref.1 Traceable author statement. Source: ProtInc protein dimerization activityInferred from electronic annotation. Source: InterPro sequence-specific DNA bindingInferred from electronic annotation. Source: InterPro transcription factor activityInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Long (identifier: O75444-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Short (identifier: O75444-2) The sequence of this isoform differs from the canonical sequence as follows: 373-403: ITEPTRKLEPSVGYATFWKPQHRVLTSVFTK → M |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 403 | 403 | Transcription factor Maf | PRO_0000076491 | |||||
Regions | |||||||||
| Domain | 316 – 337 | 22 | Leucine-zipper | ||||||
| DNA binding | 288 – 314 | 27 | Basic motif | ||||||
| Compositional bias | 139 – 146 | 8 | Poly-Ala | ||||||
| Compositional bias | 169 – 173 | 5 | Poly-Ala | ||||||
| Compositional bias | 180 – 187 | 8 | Poly-His | ||||||
| Compositional bias | 191 – 194 | 4 | Poly-His | ||||||
| Compositional bias | 211 – 220 | 10 | Poly-Gly | ||||||
| Compositional bias | 225 – 238 | 14 | Poly-Gly | ||||||
Natural variations | |||||||||
| Alternative sequence | 373 – 403 | 31 | ITEPT…SVFTK → M in isoform Short. | VSP_000583 | |||||
| Natural variant | 288 | 1 | R → P in juvenile-onset pulverulent cataract. | VAR_029369 | |||||
| Natural variant | 297 | 1 | K → R in CCA4. | VAR_029370 | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Frequent dysregulation of the c-maf proto-oncogene at 16q23 by translocation to an Ig locus in multiple myeloma." Chesi M., Bergsagel P.L., Shonukan O.O., Martelli M.L., Brents L.A., Chen T., Schrock E., Ried T., Kuehl W.M. Blood 91:4457-4463(1998) [PubMed: 9616139] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA], ALTERNATIVE SPLICING. |
| [2] | "Domain disruption and mutation of the bZIP transcription factor, MAF, associated with cataract, ocular anterior segment dysgenesis and coloboma." Jamieson R.V., Perveen R., Kerr B., Carette M., Yardley J., Heon E., Wirth M.G., van Heyningen V., Donnai D., Munier F., Black G.C. Hum. Mol. Genet. 11:33-42(2002) [PubMed: 11772997] [Abstract] Cited for: VARIANT JUVENILE-ONSET PULVERULENT CATARACT PRO-288. |
| [3] | "A novel mutation in the DNA-binding domain of MAF at 16q23.1 associated with autosomal dominant 'cerulean cataract' in an Indian family." Vanita V., Singh D., Robinson P.N., Sperling K., Singh J.R. Am. J. Med. Genet. A 140:558-566(2006) [PubMed: 16470690] [Abstract] Cited for: VARIANT CCA4 ARG-297. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AF055377 mRNA. Translation: AAC27038.1. AF055378 Genomic DNA. Translation: AAC27039.1. AF055376 mRNA. Translation: AAC27037.1. | |
| RefSeq | NP_005351.2. |
| UniGene | Hs.134859 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1K1V based on UniProtKB O54790. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | O75444. |
Genome annotation databases | |
| Ensembl | ENSG00000178573. Homo sapiens. [Contig view] |
| GeneID | 4094. |
Organism-specific databases | |
| H-InvDB | HIX0038539. |
| HGNC | HGNC:6776. MAF. |
| HPA | CAB010296. |
| MIM | 177075. gene. 610202. phenotype. |
| Orphanet | 98989. Cataract, cerulean. 91492. Cataract, congenital, non-syndromic. 98984. Cataract, pulverulent. |
| PharmGKB | PA30534. |
| GenAtlas | Search... |
| GeneCards | Search... |
Phylogenomic databases | |
| HOGENOM | O75444. |
| HOVERGEN | O75444. |
Gene expression databases | |
| ArrayExpress | O75444. |
| CleanEx | HS_MAF. |
| GermOnline | ENSG00000178573. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR013592. Maf_TF_N. IPR004827. TF_bZIP. IPR004826. TF_Maf. [Graphical view] |
| Pfam | PF03131. bZIP_Maf. 1 hit. PF08383. Maf_N. 1 hit. [Graphical view] |
| SMART | SM00338. BRLZ. 1 hit. [Graphical view] |
| PROSITE | PS50217. BZIP. 1 hit. PS00036. BZIP_BASIC. False negative. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| LinkHub | O75444. |
| NextBio | 16054. |
| SOURCE | Search... |
Entry information
| Entry name | MAF_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O75444 Secondary accession number(s): Q9UP93 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


