Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1

Gene

NDUFB1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.1 Publication

GO - Molecular functioni

  • NADH dehydrogenase (ubiquinone) activity Source: ProtInc

GO - Biological processi

  • mitochondrial electron transport, NADH to ubiquinone Source: Reactome
  • mitochondrial respiratory chain complex I assembly Source: UniProtKB

Keywordsi

Biological processElectron transport, Respiratory chain, Transport

Enzyme and pathway databases

ReactomeiR-HSA-611105. Respiratory electron transport.
R-HSA-6799198. Complex I biogenesis.

Names & Taxonomyi

Protein namesi
Recommended name:
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1
Alternative name(s):
Complex I-MNLL
Short name:
CI-MNLL
NADH-ubiquinone oxidoreductase MNLL subunit
Gene namesi
Name:NDUFB1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 14

Organism-specific databases

EuPathDBiHostDB:ENSG00000183648.9.
HGNCiHGNC:7695. NDUFB1.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei11 – 27HelicalSequence analysisAdd BLAST17

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000183648.
PharmGKBiPA31501.

Chemistry databases

ChEMBLiCHEMBL2363065.
DrugBankiDB00157. NADH.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00001188272 – 58NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1Add BLAST57

Proteomic databases

EPDiO75438.
MaxQBiO75438.
PaxDbiO75438.
PeptideAtlasiO75438.
PRIDEiO75438.
TopDownProteomicsiO75438-1. [O75438-1]
O75438-2. [O75438-2]

PTM databases

iPTMnetiO75438.
PhosphoSitePlusiO75438.

Expressioni

Gene expression databases

BgeeiENSG00000183648.
CleanExiHS_NDUFB1.
ExpressionAtlasiO75438. baseline and differential.
GenevisibleiO75438. HS.

Organism-specific databases

HPAiHPA063737.

Interactioni

Subunit structurei

Complex I is composed of 45 different subunits.2 Publications

Protein-protein interaction databases

BioGridi110787. 20 interactors.
CORUMiO75438.
IntActiO75438. 9 interactors.
MINTiMINT-1447520.
STRINGi9606.ENSP00000330787.

Structurei

3D structure databases

ProteinModelPortaliO75438.
SMRiO75438.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the complex I NDUFB1 subunit family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410J2ZX. Eukaryota.
ENOG410XXU1. LUCA.
GeneTreeiENSGT00390000005052.
HOVERGENiHBG006501.
InParanoidiO75438.
KOiK03957.
OMAiCRRGEWQ.
OrthoDBiEOG091G185E.
PhylomeDBiO75438.
TreeFamiTF324446.

Family and domain databases

InterProiView protein in InterPro
IPR012575. NADH_UbQ_OxRdtase_MNLL_su.
PANTHERiPTHR15222. PTHR15222. 1 hit.
PfamiView protein in Pfam
PF08040. NADH_oxidored. 1 hit.
ProDomiView protein in ProDom or Entries sharing at least one domain
PD052001. NADH_UbQ_OxRdtase_MNLL_su. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O75438-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVNLLQIVRD HWVHVLVPMG FVIGCYLDRK SDERLTAFRN KSMLFKRELQ

PSEEVTWK
Length:58
Mass (Da):6,961
Last modified:November 1, 1998 - v1
Checksum:i2281D89AAE61EA52
GO
Isoform 2 (identifier: O75438-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MICWRHPSAPCGRGEWQVPRSQLPLARVEFPVALGLGVAVGAEAAAIM

Show »
Length:105
Mass (Da):11,912
Checksum:iDFC676B23B66E41F
GO

Sequence cautioni

The sequence AAD42054 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0378591M → MICWRHPSAPCGRGEWQVPR SQLPLARVEFPVALGLGVAV GAEAAAIM in isoform 2. 2 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF054181 mRNA. Translation: AAC39914.1.
AK316557 Transcribed RNA. Translation: BAG48175.1.
AL121773 Genomic DNA. No translation available.
CH471061 Genomic DNA. Translation: EAW81479.1.
BC009691 mRNA. Translation: AAH09691.2.
BC126232 mRNA. Translation: AAI26233.1.
BC126234 mRNA. Translation: AAI26235.1.
AF050638 mRNA. Translation: AAD42054.1. Different initiation.
CCDSiCCDS9901.1. [O75438-2]
RefSeqiNP_004536.2. NM_004545.3. [O75438-2]
UniGeneiHs.183435.

Genome annotation databases

EnsembliENST00000329559; ENSP00000330787; ENSG00000183648. [O75438-2]
ENST00000553514; ENSP00000451090; ENSG00000183648. [O75438-1]
ENST00000555441; ENSP00000450776; ENSG00000183648. [O75438-1]
ENST00000605997; ENSP00000475170; ENSG00000183648. [O75438-1]
ENST00000617122; ENSP00000483888; ENSG00000183648. [O75438-2]
GeneIDi4707.
KEGGihsa:4707.
UCSCiuc001yaf.4. human. [O75438-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiNDUB1_HUMAN
AccessioniPrimary (citable) accession number: O75438
Secondary accession number(s): A0AV68
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: November 1, 1998
Last modified: September 27, 2017
This is version 141 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families