Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1

Gene

NDUFB1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

GO - Molecular functioni

  • NADH dehydrogenase (ubiquinone) activity Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Electron transport, Respiratory chain, Transport

Enzyme and pathway databases

ReactomeiR-HSA-611105. Respiratory electron transport.
R-HSA-6799198. Complex I biogenesis.

Names & Taxonomyi

Protein namesi
Recommended name:
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1
Alternative name(s):
Complex I-MNLL
Short name:
CI-MNLL
NADH-ubiquinone oxidoreductase MNLL subunit
Cleaved into the following chain:
Gene namesi
Name:NDUFB1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 14

Organism-specific databases

HGNCiHGNC:7695. NDUFB1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei11 – 2717HelicalSequence analysisAdd
BLAST

GO - Cellular componenti

  • extracellular exosome Source: UniProtKB
  • integral component of membrane Source: UniProtKB-KW
  • mitochondrial inner membrane Source: Reactome
  • mitochondrial respiratory chain complex I Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31501.

Chemistry

ChEMBLiCHEMBL2363065.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 5858NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1PRO_0000434358Add
BLAST
Initiator methionineiRemoved; alternateCombined sources
Chaini2 – 5857NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1, N-terminally processedPRO_0000118827Add
BLAST

Proteomic databases

EPDiO75438.
MaxQBiO75438.
PaxDbiO75438.
PeptideAtlasiO75438.
PRIDEiO75438.
TopDownProteomicsiO75438-1. [O75438-1]
O75438-2. [O75438-2]

PTM databases

iPTMnetiO75438.
PhosphoSiteiO75438.

Expressioni

Gene expression databases

BgeeiENSG00000183648.
CleanExiHS_NDUFB1.
ExpressionAtlasiO75438. baseline and differential.
GenevisibleiO75438. HS.

Organism-specific databases

HPAiHPA047940.
HPA063737.

Interactioni

Subunit structurei

Complex I is composed of 45 different subunits.1 Publication

Protein-protein interaction databases

BioGridi110787. 14 interactions.
IntActiO75438. 8 interactions.
MINTiMINT-1447520.
STRINGi9606.ENSP00000330787.

Structurei

3D structure databases

ProteinModelPortaliO75438.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the complex I NDUFB1 subunit family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410J2ZX. Eukaryota.
ENOG410XXU1. LUCA.
GeneTreeiENSGT00390000005052.
HOVERGENiHBG006501.
InParanoidiO75438.
KOiK03957.
OMAiCRRGEWQ.
OrthoDBiEOG091G185E.
PhylomeDBiO75438.
TreeFamiTF324446.

Family and domain databases

InterProiIPR012575. NADH_UbQ_OxRdtase_MNLL_su.
[Graphical view]
PANTHERiPTHR15222. PTHR15222. 1 hit.
PfamiPF08040. NADH_oxidored. 1 hit.
[Graphical view]
ProDomiPD052001. NADH_UbQ_OxRdtase_MNLL_su. 1 hit.
[Graphical view] [Entries sharing at least one domain]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O75438-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVNLLQIVRD HWVHVLVPMG FVIGCYLDRK SDERLTAFRN KSMLFKRELQ

PSEEVTWK
Length:58
Mass (Da):6,961
Last modified:November 1, 1998 - v1
Checksum:i2281D89AAE61EA52
GO
Isoform 2 (identifier: O75438-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MICWRHPSAPCGRGEWQVPRSQLPLARVEFPVALGLGVAVGAEAAAIM

Show »
Length:105
Mass (Da):11,912
Checksum:iDFC676B23B66E41F
GO

Sequence cautioni

The sequence AAD42054 differs from that shown. Reason: Erroneous initiation. Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MICWRHPSAPCGRGEWQVPR SQLPLARVEFPVALGLGVAV GAEAAAIM in isoform 2. 2 PublicationsVSP_037859

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF054181 mRNA. Translation: AAC39914.1.
AK316557 Transcribed RNA. Translation: BAG48175.1.
AL121773 Genomic DNA. No translation available.
CH471061 Genomic DNA. Translation: EAW81479.1.
BC009691 mRNA. Translation: AAH09691.2.
BC126232 mRNA. Translation: AAI26233.1.
BC126234 mRNA. Translation: AAI26235.1.
AF050638 mRNA. Translation: AAD42054.1. Different initiation.
CCDSiCCDS9901.1. [O75438-2]
RefSeqiNP_004536.2. NM_004545.3. [O75438-2]
UniGeneiHs.183435.

Genome annotation databases

EnsembliENST00000329559; ENSP00000330787; ENSG00000183648. [O75438-2]
ENST00000553514; ENSP00000451090; ENSG00000183648. [O75438-1]
ENST00000555441; ENSP00000450776; ENSG00000183648. [O75438-1]
ENST00000605997; ENSP00000475170; ENSG00000183648. [O75438-1]
ENST00000617122; ENSP00000483888; ENSG00000183648. [O75438-2]
GeneIDi4707.
KEGGihsa:4707.
UCSCiuc001yaf.4. human. [O75438-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF054181 mRNA. Translation: AAC39914.1.
AK316557 Transcribed RNA. Translation: BAG48175.1.
AL121773 Genomic DNA. No translation available.
CH471061 Genomic DNA. Translation: EAW81479.1.
BC009691 mRNA. Translation: AAH09691.2.
BC126232 mRNA. Translation: AAI26233.1.
BC126234 mRNA. Translation: AAI26235.1.
AF050638 mRNA. Translation: AAD42054.1. Different initiation.
CCDSiCCDS9901.1. [O75438-2]
RefSeqiNP_004536.2. NM_004545.3. [O75438-2]
UniGeneiHs.183435.

3D structure databases

ProteinModelPortaliO75438.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110787. 14 interactions.
IntActiO75438. 8 interactions.
MINTiMINT-1447520.
STRINGi9606.ENSP00000330787.

Chemistry

ChEMBLiCHEMBL2363065.

PTM databases

iPTMnetiO75438.
PhosphoSiteiO75438.

Proteomic databases

EPDiO75438.
MaxQBiO75438.
PaxDbiO75438.
PeptideAtlasiO75438.
PRIDEiO75438.
TopDownProteomicsiO75438-1. [O75438-1]
O75438-2. [O75438-2]

Protocols and materials databases

DNASUi4707.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000329559; ENSP00000330787; ENSG00000183648. [O75438-2]
ENST00000553514; ENSP00000451090; ENSG00000183648. [O75438-1]
ENST00000555441; ENSP00000450776; ENSG00000183648. [O75438-1]
ENST00000605997; ENSP00000475170; ENSG00000183648. [O75438-1]
ENST00000617122; ENSP00000483888; ENSG00000183648. [O75438-2]
GeneIDi4707.
KEGGihsa:4707.
UCSCiuc001yaf.4. human. [O75438-1]

Organism-specific databases

CTDi4707.
GeneCardsiNDUFB1.
HGNCiHGNC:7695. NDUFB1.
HPAiHPA047940.
HPA063737.
MIMi603837. gene.
neXtProtiNX_O75438.
PharmGKBiPA31501.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J2ZX. Eukaryota.
ENOG410XXU1. LUCA.
GeneTreeiENSGT00390000005052.
HOVERGENiHBG006501.
InParanoidiO75438.
KOiK03957.
OMAiCRRGEWQ.
OrthoDBiEOG091G185E.
PhylomeDBiO75438.
TreeFamiTF324446.

Enzyme and pathway databases

ReactomeiR-HSA-611105. Respiratory electron transport.
R-HSA-6799198. Complex I biogenesis.

Miscellaneous databases

ChiTaRSiNDUFB1. human.
GeneWikiiNDUFB1.
GenomeRNAii4707.
PROiO75438.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000183648.
CleanExiHS_NDUFB1.
ExpressionAtlasiO75438. baseline and differential.
GenevisibleiO75438. HS.

Family and domain databases

InterProiIPR012575. NADH_UbQ_OxRdtase_MNLL_su.
[Graphical view]
PANTHERiPTHR15222. PTHR15222. 1 hit.
PfamiPF08040. NADH_oxidored. 1 hit.
[Graphical view]
ProDomiPD052001. NADH_UbQ_OxRdtase_MNLL_su. 1 hit.
[Graphical view] [Entries sharing at least one domain]
ProtoNetiSearch...

Entry informationi

Entry nameiNDUB1_HUMAN
AccessioniPrimary (citable) accession number: O75438
Secondary accession number(s): A0AV68
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: November 1, 1998
Last modified: September 7, 2016
This is version 133 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.