Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

F-box only protein 24

Gene

FBXO24

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.By similarity

GO - Molecular functioni

  • ubiquitin-protein transferase activity Source: UniProtKB

GO - Biological processi

  • protein ubiquitination Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Ubl conjugation pathway

Enzyme and pathway databases

BioCyciZFISH:ENSG00000106336-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
F-box only protein 24
Gene namesi
Name:FBXO24
Synonyms:FBX24
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:13595. FBXO24.

Subcellular locationi

GO - Cellular componenti

  • ubiquitin ligase complex Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000106336.
PharmGKBiPA28037.

Polymorphism and mutation databases

BioMutaiFBXO24.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001199091 – 580F-box only protein 24Add BLAST580

Proteomic databases

PaxDbiO75426.
PeptideAtlasiO75426.
PRIDEiO75426.

PTM databases

iPTMnetiO75426.
PhosphoSitePlusiO75426.

Expressioni

Gene expression databases

BgeeiENSG00000106336.
CleanExiHS_FBXO24.
ExpressionAtlasiO75426. baseline and differential.
GenevisibleiO75426. HS.

Organism-specific databases

HPAiHPA050951.

Interactioni

Subunit structurei

Directly interacts with SKP1 and CUL1.By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
HSP90AB1P082382EBI-6425658,EBI-352572
NUDCD2Q8WVJ22EBI-6425658,EBI-1052153

Protein-protein interaction databases

BioGridi117647. 5 interactors.
IntActiO75426. 16 interactors.
STRINGi9606.ENSP00000416558.

Structurei

3D structure databases

ProteinModelPortaliO75426.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini36 – 82F-boxPROSITE-ProRule annotationAdd BLAST47
Repeati376 – 425RCC1Add BLAST50

Sequence similaritiesi

Contains 1 F-box domain.PROSITE-ProRule annotation
Contains 1 RCC1 repeat.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiENOG410IQCV. Eukaryota.
ENOG41100N3. LUCA.
GeneTreeiENSGT00390000017455.
HOGENOMiHOG000253007.
HOVERGENiHBG051571.
InParanoidiO75426.
KOiK10304.
OMAiEPTQVHY.
OrthoDBiEOG091G043B.
PhylomeDBiO75426.
TreeFamiTF328722.

Family and domain databases

Gene3Di2.130.10.30. 1 hit.
InterProiIPR001810. F-box_dom.
IPR009091. RCC1/BLIP-II.
IPR000408. Reg_chr_condens.
[Graphical view]
PfamiPF12937. F-box-like. 1 hit.
PF00415. RCC1. 1 hit.
[Graphical view]
SMARTiSM00256. FBOX. 1 hit.
[Graphical view]
SUPFAMiSSF50985. SSF50985. 1 hit.
SSF81383. SSF81383. 1 hit.
PROSITEiPS50181. FBOX. 1 hit.
PS50012. RCC1_3. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O75426-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGEKAVPLLR RRRVKRSCPS CGSELGVEEK RGKGNPISIQ LFPPELVEHI
60 70 80 90 100
ISFLPVRDLV ALGQTCRYFH EVCDGEGVWR RICRRLSPRL QDQGSGVRPW
110 120 130 140 150
KRAAILNYTK GLYFQAFGGR RRCLSKSVAP LLAHGYRRFL PTKDHVFILD
160 170 180 190 200
YVGTLFFLKN ALVSTLGQMQ WKRACRYVVL CRGAKDFASD PRCDTVYRKY
210 220 230 240 250
LYVLATREPQ EVVGTTSSRA CDCVEVYLQS SGQRVFKMTF HHSMTFKQIV
260 270 280 290 300
LVGQETQRAL LLLTEEGKIY SLVVNETQLD QPRSYTVQLA LRKVSHYLPH
310 320 330 340 350
LRVACMTSNQ SSTLYVTDQG GVYFEVHTPG VYRDLFGTLQ AFDPLDQQMP
360 370 380 390 400
LALSLPAKIL FCALGYNHLG LVDEFGRIFM QGNNRYGQLG TGDKMDRGEP
410 420 430 440 450
TQVCYLQRPI TLWCGLNHSL VLSQSSEFSK ELLGCGCGAG GRLPGWPKGS
460 470 480 490 500
ASFVKLQVKV PLCACALCAT RECLYILSSH DIEQHAPYRH LPASRVVGTP
510 520 530 540 550
EPSLGARAPQ DPGGMAQACE EYLSQIHSCQ TLQDRTEKMK EIVGWMPLMA
560 570 580
AQKDFFWEAL DMLQRAEGGG GGVGPPAPET
Length:580
Mass (Da):64,889
Last modified:August 16, 2004 - v2
Checksum:i3863C6846AB6B940
GO
Isoform 2 (identifier: O75426-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     94-108: GSGVRPWKRAAILNY → D
     319-332: QGGVYFEVHTPGVY → PILCSWLQPPWPGG
     333-580: Missing.

Show »
Length:318
Mass (Da):36,353
Checksum:i025D9AF7342646F2
GO
Isoform 3 (identifier: O75426-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: MGEKAVPLLRRR → MVWESQQERGGQGPRRQEGRSREGAIRMVRGSQRRKLQKFTRLCGREEGL

Note: No experimental confirmation available.
Show »
Length:618
Mass (Da):69,336
Checksum:i5F6E800F4AF66B0E
GO
Isoform 4 (identifier: O75426-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: MGEKAVPLLRRRR → M

Note: No experimental confirmation available.
Show »
Length:568
Mass (Da):63,456
Checksum:iD6E1D0FBBB60538A
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_049042302R → H.Corresponds to variant rs7801492dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0434581 – 13MGEKA…LRRRR → M in isoform 4. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_0434591 – 12MGEKA…LLRRR → MVWESQQERGGQGPRRQEGR SREGAIRMVRGSQRRKLQKF TRLCGREEGL in isoform 3. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_01135194 – 108GSGVR…AILNY → D in isoform 2. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_011352319 – 332QGGVY…TPGVY → PILCSWLQPPWPGG in isoform 2. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_011353333 – 580Missing in isoform 2. 1 PublicationAdd BLAST248

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF174604 mRNA. Translation: AAF04525.1.
AF053356 Genomic DNA. Translation: AAC78801.1.
AL136811 mRNA. Translation: CAB66745.1.
AK301864 mRNA. Translation: BAG63303.1.
AK302252 mRNA. Translation: BAG63604.1.
AC069281 Genomic DNA. Translation: AAP21862.1.
AC069281 Genomic DNA. Translation: AAP21863.1.
CH236956 Genomic DNA. Translation: EAL23827.1.
CH471091 Genomic DNA. Translation: EAW76517.1.
BC067293 mRNA. Translation: AAH67293.1.
CCDSiCCDS55138.1. [O75426-4]
CCDS5698.1. [O75426-1]
CCDS5699.2. [O75426-3]
RefSeqiNP_001156971.1. NM_001163499.1. [O75426-4]
NP_036304.2. NM_012172.4. [O75426-3]
NP_277041.1. NM_033506.2. [O75426-1]
UniGeneiHs.283764.

Genome annotation databases

EnsembliENST00000241071; ENSP00000241071; ENSG00000106336. [O75426-1]
ENST00000427939; ENSP00000416558; ENSG00000106336. [O75426-3]
ENST00000465843; ENSP00000419602; ENSG00000106336. [O75426-2]
ENST00000468962; ENSP00000420239; ENSG00000106336. [O75426-4]
GeneIDi26261.
KEGGihsa:26261.
UCSCiuc003uvl.2. human. [O75426-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF174604 mRNA. Translation: AAF04525.1.
AF053356 Genomic DNA. Translation: AAC78801.1.
AL136811 mRNA. Translation: CAB66745.1.
AK301864 mRNA. Translation: BAG63303.1.
AK302252 mRNA. Translation: BAG63604.1.
AC069281 Genomic DNA. Translation: AAP21862.1.
AC069281 Genomic DNA. Translation: AAP21863.1.
CH236956 Genomic DNA. Translation: EAL23827.1.
CH471091 Genomic DNA. Translation: EAW76517.1.
BC067293 mRNA. Translation: AAH67293.1.
CCDSiCCDS55138.1. [O75426-4]
CCDS5698.1. [O75426-1]
CCDS5699.2. [O75426-3]
RefSeqiNP_001156971.1. NM_001163499.1. [O75426-4]
NP_036304.2. NM_012172.4. [O75426-3]
NP_277041.1. NM_033506.2. [O75426-1]
UniGeneiHs.283764.

3D structure databases

ProteinModelPortaliO75426.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117647. 5 interactors.
IntActiO75426. 16 interactors.
STRINGi9606.ENSP00000416558.

PTM databases

iPTMnetiO75426.
PhosphoSitePlusiO75426.

Polymorphism and mutation databases

BioMutaiFBXO24.

Proteomic databases

PaxDbiO75426.
PeptideAtlasiO75426.
PRIDEiO75426.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000241071; ENSP00000241071; ENSG00000106336. [O75426-1]
ENST00000427939; ENSP00000416558; ENSG00000106336. [O75426-3]
ENST00000465843; ENSP00000419602; ENSG00000106336. [O75426-2]
ENST00000468962; ENSP00000420239; ENSG00000106336. [O75426-4]
GeneIDi26261.
KEGGihsa:26261.
UCSCiuc003uvl.2. human. [O75426-1]

Organism-specific databases

CTDi26261.
GeneCardsiFBXO24.
HGNCiHGNC:13595. FBXO24.
HPAiHPA050951.
MIMi609097. gene.
neXtProtiNX_O75426.
OpenTargetsiENSG00000106336.
PharmGKBiPA28037.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IQCV. Eukaryota.
ENOG41100N3. LUCA.
GeneTreeiENSGT00390000017455.
HOGENOMiHOG000253007.
HOVERGENiHBG051571.
InParanoidiO75426.
KOiK10304.
OMAiEPTQVHY.
OrthoDBiEOG091G043B.
PhylomeDBiO75426.
TreeFamiTF328722.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000106336-MONOMER.

Miscellaneous databases

ChiTaRSiFBXO24. human.
GenomeRNAii26261.
PROiO75426.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000106336.
CleanExiHS_FBXO24.
ExpressionAtlasiO75426. baseline and differential.
GenevisibleiO75426. HS.

Family and domain databases

Gene3Di2.130.10.30. 1 hit.
InterProiIPR001810. F-box_dom.
IPR009091. RCC1/BLIP-II.
IPR000408. Reg_chr_condens.
[Graphical view]
PfamiPF12937. F-box-like. 1 hit.
PF00415. RCC1. 1 hit.
[Graphical view]
SMARTiSM00256. FBOX. 1 hit.
[Graphical view]
SUPFAMiSSF50985. SSF50985. 1 hit.
SSF81383. SSF81383. 1 hit.
PROSITEiPS50181. FBOX. 1 hit.
PS50012. RCC1_3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiFBX24_HUMAN
AccessioniPrimary (citable) accession number: O75426
Secondary accession number(s): A4D2D4
, B4DX91, B4DY42, Q9H0G1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: August 16, 2004
Last modified: November 2, 2016
This is version 137 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.