Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O75419

- CDC45_HUMAN

UniProt

O75419 - CDC45_HUMAN

Protein

Cell division control protein 45 homolog

Gene

CDC45

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 129 (01 Oct 2014)
      Sequence version 1 (01 Nov 1998)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Required for initiation of chromosomal DNA replication.

    GO - Molecular functioni

    1. protein binding Source: UniProtKB

    GO - Biological processi

    1. DNA replication Source: Reactome
    2. DNA replication checkpoint Source: ProtInc
    3. DNA replication initiation Source: ProtInc
    4. DNA strand elongation involved in DNA replication Source: Reactome
    5. G1/S transition of mitotic cell cycle Source: Reactome
    6. mitotic cell cycle Source: Reactome
    7. regulation of transcription involved in G1/S transition of mitotic cell cycle Source: Reactome

    Keywords - Biological processi

    Cell cycle, DNA replication

    Enzyme and pathway databases

    ReactomeiREACT_1095. Activation of the pre-replicative complex.
    REACT_471. E2F mediated regulation of DNA replication.
    REACT_6769. Activation of ATR in response to replication stress.
    REACT_6776. Unwinding of DNA.
    REACT_683. G1/S-Specific Transcription.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Cell division control protein 45 homolog
    Alternative name(s):
    PORC-PI-1
    Gene namesi
    Name:CDC45
    Synonyms:CDC45L, CDC45L2
    ORF Names:UNQ374/PRO710
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 22

    Organism-specific databases

    HGNCiHGNC:1739. CDC45.

    Subcellular locationi

    GO - Cellular componenti

    1. centrosome Source: HPA
    2. cytoplasm Source: UniProtKB-SubCell
    3. nucleoplasm Source: Reactome
    4. nucleus Source: HPA

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA371.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 566566Cell division control protein 45 homologPRO_0000192815Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei130 – 1301Phosphotyrosine1 Publication
    Modified residuei144 – 1441Phosphoserine1 Publication
    Modified residuei148 – 1481Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiO75419.
    PaxDbiO75419.
    PeptideAtlasiO75419.
    PRIDEiO75419.

    PTM databases

    PhosphoSiteiO75419.

    Expressioni

    Tissue specificityi

    Widely expressed, highest levels are found in adult testis and thymus and in fetal liver.

    Developmental stagei

    Transcript peaks at G1-S transition, but total protein remains constant throughout the cell cycle. Expressed in multiple tissues during embryogenesis, including neural crest-derived structures.

    Gene expression databases

    ArrayExpressiO75419.
    BgeeiO75419.
    CleanExiHS_CDC45L.
    GenevestigatoriO75419.

    Organism-specific databases

    HPAiCAB009459.
    HPA000614.

    Interactioni

    Subunit structurei

    Associated with ORC2.

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    CDKN1AP389362EBI-374969,EBI-375077
    CLSPNQ9HAW44EBI-374969,EBI-1369377
    RPA2P159274EBI-374969,EBI-621404
    TOPBP1Q925476EBI-374969,EBI-308302

    Protein-protein interaction databases

    BioGridi113915. 27 interactions.
    DIPiDIP-31725N.
    IntActiO75419. 15 interactions.
    MINTiMINT-1201326.

    Structurei

    3D structure databases

    ProteinModelPortaliO75419.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the CDC45 family.Curated

    Phylogenomic databases

    eggNOGiNOG321683.
    HOGENOMiHOG000253949.
    HOVERGENiHBG050819.
    InParanoidiO75419.
    KOiK06628.
    OMAiMLLREWN.
    OrthoDBiEOG7PZRXS.
    PhylomeDBiO75419.
    TreeFamiTF101062.

    Family and domain databases

    InterProiIPR003874. CDC45.
    [Graphical view]
    PANTHERiPTHR10507. PTHR10507. 1 hit.
    PfamiPF02724. CDC45. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O75419-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MFVSDFRKEF YEVVQSQRVL LFVASDVDAL CACKILQALF QCDHVQYTLV    50
    PVSGWQELET AFLEHKEQFH YFILINCGAN VDLLDILQPD EDTIFFVCDT 100
    HRPVNVVNVY NDTQIKLLIK QDDDLEVPAY EDIFRDEEED EEHSGNDSDG 150
    SEPSEKRTRL EEEIVEQTMR RRQRREWEAR RRDILFDYEQ YEYHGTSSAM 200
    VMFELAWMLS KDLNDMLWWA IVGLTDQWVQ DKITQMKYVT DVGVLQRHVS 250
    RHNHRNEDEE NTLSVDCTRI SFEYDLRLVL YQHWSLHDSL CNTSYTAARF 300
    KLWSVHGQKR LQEFLADMGL PLKQVKQKFQ AMDISLKENL REMIEESANK 350
    FGMKDMRVQT FSIHFGFKHK FLASDVVFAT MSLMESPEKD GSGTDHFIQA 400
    LDSLSRSNLD KLYHGLELAK KQLRATQQTI ASCLCTNLVI SQGPFLYCSL 450
    MEGTPDVMLF SRPASLSLLS KHLLKSFVCS TKNRRCKLLP LVMAAPLSME 500
    HGTVTVVGIP PETDSSDRKN FFGRAFEKAA ESTSSRMLHN HFDLSVIELK 550
    AEDRSKFLDA LISLLS 566
    Length:566
    Mass (Da):65,569
    Last modified:November 1, 1998 - v1
    Checksum:iAE1BE2C8C8E5F867
    GO
    Isoform 2 (identifier: O75419-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         68-113: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:520
    Mass (Da):60,245
    Checksum:iBE5CE1F95079C2E6
    GO
    Isoform 3 (identifier: O75419-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         180-180: R → RSGSGSEPVAAALEKSSRLFAGPMSDRTAPRSP

    Note: No experimental confirmation available.

    Show »
    Length:598
    Mass (Da):68,768
    Checksum:i2625590397EB6E6B
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti100 – 1001T → S in AAQ89330. (PubMed:12975309)Curated
    Sequence conflicti115 – 1151I → V in CAA11530. (PubMed:9724329)Curated
    Sequence conflicti346 – 3461E → Q in AAC67521. (PubMed:9755170)Curated
    Sequence conflicti509 – 5091I → F in BAG56854. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti81 – 811V → I.1 Publication
    Corresponds to variant rs13447203 [ dbSNP | Ensembl ].
    VAR_019286
    Natural varianti356 – 3561M → R.
    Corresponds to variant rs17209274 [ dbSNP | Ensembl ].
    VAR_053026
    Natural varianti376 – 3761V → M.1 Publication
    Corresponds to variant rs13447263 [ dbSNP | Ensembl ].
    VAR_019287

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei68 – 11346Missing in isoform 2. 1 PublicationVSP_043129Add
    BLAST
    Alternative sequencei180 – 1801R → RSGSGSEPVAAALEKSSRLF AGPMSDRTAPRSP in isoform 3. 1 PublicationVSP_045411

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF062495 mRNA. Translation: AAC67521.1.
    AF053074 mRNA. Translation: AAC27289.1.
    AJ223728 mRNA. Translation: CAA11530.1.
    AF081535 mRNA. Translation: AAD08998.1.
    AY358971 mRNA. Translation: AAQ89330.1.
    AK293123 mRNA. Translation: BAG56675.1.
    AK293338 mRNA. Translation: BAG56854.1.
    BT006792 mRNA. Translation: AAP35438.1.
    AY572790 Genomic DNA. Translation: AAS66985.1.
    CT841513 mRNA. Translation: CAJ86443.1.
    AC000082 Genomic DNA. No translation available.
    AC000087 Genomic DNA. No translation available.
    AC000088 Genomic DNA. No translation available.
    CH471176 Genomic DNA. Translation: EAX03036.1.
    BC006232 mRNA. Translation: AAH06232.1.
    BC010022 mRNA. Translation: AAH10022.1.
    CCDSiCCDS13762.1. [O75419-1]
    CCDS54499.1. [O75419-3]
    CCDS54500.1. [O75419-2]
    RefSeqiNP_001171481.1. NM_001178010.2. [O75419-3]
    NP_001171482.1. NM_001178011.2. [O75419-2]
    NP_003495.1. NM_003504.4. [O75419-1]
    XP_005261342.1. XM_005261285.2. [O75419-3]
    UniGeneiHs.474217.
    Hs.742418.

    Genome annotation databases

    EnsembliENST00000263201; ENSP00000263201; ENSG00000093009. [O75419-1]
    ENST00000404724; ENSP00000384978; ENSG00000093009. [O75419-2]
    ENST00000407835; ENSP00000385240; ENSG00000093009. [O75419-1]
    ENST00000437685; ENSP00000405726; ENSG00000093009. [O75419-3]
    GeneIDi8318.
    KEGGihsa:8318.
    UCSCiuc002zpr.3. human. [O75419-1]
    uc002zpt.3. human. [O75419-2]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    NIEHS-SNPs

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF062495 mRNA. Translation: AAC67521.1 .
    AF053074 mRNA. Translation: AAC27289.1 .
    AJ223728 mRNA. Translation: CAA11530.1 .
    AF081535 mRNA. Translation: AAD08998.1 .
    AY358971 mRNA. Translation: AAQ89330.1 .
    AK293123 mRNA. Translation: BAG56675.1 .
    AK293338 mRNA. Translation: BAG56854.1 .
    BT006792 mRNA. Translation: AAP35438.1 .
    AY572790 Genomic DNA. Translation: AAS66985.1 .
    CT841513 mRNA. Translation: CAJ86443.1 .
    AC000082 Genomic DNA. No translation available.
    AC000087 Genomic DNA. No translation available.
    AC000088 Genomic DNA. No translation available.
    CH471176 Genomic DNA. Translation: EAX03036.1 .
    BC006232 mRNA. Translation: AAH06232.1 .
    BC010022 mRNA. Translation: AAH10022.1 .
    CCDSi CCDS13762.1. [O75419-1 ]
    CCDS54499.1. [O75419-3 ]
    CCDS54500.1. [O75419-2 ]
    RefSeqi NP_001171481.1. NM_001178010.2. [O75419-3 ]
    NP_001171482.1. NM_001178011.2. [O75419-2 ]
    NP_003495.1. NM_003504.4. [O75419-1 ]
    XP_005261342.1. XM_005261285.2. [O75419-3 ]
    UniGenei Hs.474217.
    Hs.742418.

    3D structure databases

    ProteinModelPortali O75419.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 113915. 27 interactions.
    DIPi DIP-31725N.
    IntActi O75419. 15 interactions.
    MINTi MINT-1201326.

    Chemistry

    BindingDBi O75419.
    ChEMBLi CHEMBL3040.

    PTM databases

    PhosphoSitei O75419.

    Proteomic databases

    MaxQBi O75419.
    PaxDbi O75419.
    PeptideAtlasi O75419.
    PRIDEi O75419.

    Protocols and materials databases

    DNASUi 8318.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000263201 ; ENSP00000263201 ; ENSG00000093009 . [O75419-1 ]
    ENST00000404724 ; ENSP00000384978 ; ENSG00000093009 . [O75419-2 ]
    ENST00000407835 ; ENSP00000385240 ; ENSG00000093009 . [O75419-1 ]
    ENST00000437685 ; ENSP00000405726 ; ENSG00000093009 . [O75419-3 ]
    GeneIDi 8318.
    KEGGi hsa:8318.
    UCSCi uc002zpr.3. human. [O75419-1 ]
    uc002zpt.3. human. [O75419-2 ]

    Organism-specific databases

    CTDi 8318.
    GeneCardsi GC22P019466.
    HGNCi HGNC:1739. CDC45.
    HPAi CAB009459.
    HPA000614.
    MIMi 603465. gene.
    neXtProti NX_O75419.
    PharmGKBi PA371.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG321683.
    HOGENOMi HOG000253949.
    HOVERGENi HBG050819.
    InParanoidi O75419.
    KOi K06628.
    OMAi MLLREWN.
    OrthoDBi EOG7PZRXS.
    PhylomeDBi O75419.
    TreeFami TF101062.

    Enzyme and pathway databases

    Reactomei REACT_1095. Activation of the pre-replicative complex.
    REACT_471. E2F mediated regulation of DNA replication.
    REACT_6769. Activation of ATR in response to replication stress.
    REACT_6776. Unwinding of DNA.
    REACT_683. G1/S-Specific Transcription.

    Miscellaneous databases

    GeneWikii CDC45-related_protein.
    GenomeRNAii 8318.
    NextBioi 31151.
    PROi O75419.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O75419.
    Bgeei O75419.
    CleanExi HS_CDC45L.
    Genevestigatori O75419.

    Family and domain databases

    InterProi IPR003874. CDC45.
    [Graphical view ]
    PANTHERi PTHR10507. PTHR10507. 1 hit.
    Pfami PF02724. CDC45. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Xenopus Cdc45-dependent loading of DNA polymerase alpha onto chromatin under the control of S-phase Cdk."
      Mimura S., Takisawa H.
      EMBO J. 17:5699-5707(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    3. "Direct selection of conserved cDNAs from the DiGeorge critical region: isolation of a novel CDC45-like gene."
      McKie J.M., Wadey R.B., Sutherland H.F., Taylor C.L., Scambler P.J.
      Genome Res. 8:834-841(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    4. "Characterization of CDC45L: a gene in the 22q11.2 deletion region expressed during murine and human development."
      Shaikh T.H., Gottlieb S., Sellinger B., Chen F., Roe B.A., Oakey R.J., Emanuel B.S., Budarf M.L.
      Mamm. Genome 10:322-326(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Brain.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    7. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
      Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
      Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    8. NIEHS SNPs program
      Submitted (MAR-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS ILE-81 AND MET-376.
    9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    10. "The DNA sequence of human chromosome 22."
      Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M.
      , Buck D., Burgess J., Burrill W.D., Burton J., Carder C., Carter N.P., Chen Y., Clark G., Clegg S.M., Cobley V.E., Cole C.G., Collier R.E., Connor R., Conroy D., Corby N.R., Coville G.J., Cox A.V., Davis J., Dawson E., Dhami P.D., Dockree C., Dodsworth S.J., Durbin R.M., Ellington A.G., Evans K.L., Fey J.M., Fleming K., French L., Garner A.A., Gilbert J.G.R., Goward M.E., Grafham D.V., Griffiths M.N.D., Hall C., Hall R.E., Hall-Tamlyn G., Heathcott R.W., Ho S., Holmes S., Hunt S.E., Jones M.C., Kershaw J., Kimberley A.M., King A., Laird G.K., Langford C.F., Leversha M.A., Lloyd C., Lloyd D.M., Martyn I.D., Mashreghi-Mohammadi M., Matthews L.H., Mccann O.T., Mcclay J., Mclaren S., McMurray A.A., Milne S.A., Mortimore B.J., Odell C.N., Pavitt R., Pearce A.V., Pearson D., Phillimore B.J.C.T., Phillips S.H., Plumb R.W., Ramsay H., Ramsey Y., Rogers L., Ross M.T., Scott C.E., Sehra H.K., Skuce C.D., Smalley S., Smith M.L., Soderlund C., Spragon L., Steward C.A., Sulston J.E., Swann R.M., Vaudin M., Wall M., Wallis J.M., Whiteley M.N., Willey D.L., Williams L., Williams S.A., Williamson H., Wilmer T.E., Wilming L., Wright C.L., Hubbard T., Bentley D.R., Beck S., Rogers J., Shimizu N., Minoshima S., Kawasaki K., Sasaki T., Asakawa S., Kudoh J., Shintani A., Shibuya K., Yoshizaki Y., Aoki N., Mitsuyama S., Roe B.A., Chen F., Chu L., Crabtree J., Deschamps S., Do A., Do T., Dorman A., Fang F., Fu Y., Hu P., Hua A., Kenton S., Lai H., Lao H.I., Lewis J., Lewis S., Lin S.-P., Loh P., Malaj E., Nguyen T., Pan H., Phan S., Qi S., Qian Y., Ray L., Ren Q., Shaull S., Sloan D., Song L., Wang Q., Wang Y., Wang Z., White J., Willingham D., Wu H., Yao Z., Zhan M., Zhang G., Chissoe S., Murray J., Miller N., Minx P., Fulton R., Johnson D., Bemis G., Bentley D., Bradshaw H., Bourne S., Cordes M., Du Z., Fulton L., Goela D., Graves T., Hawkins J., Hinds K., Kemp K., Latreille P., Layman D., Ozersky P., Rohlfing T., Scheet P., Walker C., Wamsley A., Wohldmann P., Pepin K., Nelson J., Korf I., Bedell J.A., Hillier L.W., Mardis E., Waterston R., Wilson R., Emanuel B.S., Shaikh T., Kurahashi H., Saitta S., Budarf M.L., McDermid H.E., Johnson A., Wong A.C.C., Morrow B.E., Edelmann L., Kim U.J., Shizuya H., Simon M.I., Dumanski J.P., Peyrard M., Kedra D., Seroussi E., Fransson I., Tapia I., Bruder C.E., O'Brien K.P., Wilkinson P., Bodenteich A., Hartman K., Hu X., Khan A.S., Lane L., Tilahun Y., Wright H.
      Nature 402:489-495(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    11. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    12. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Lung and Muscle.
    13. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-130; SER-144 AND SER-148, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    14. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    15. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiCDC45_HUMAN
    AccessioniPrimary (citable) accession number: O75419
    Secondary accession number(s): B4DDB4
    , B4DDU3, E9PDH7, O60856, Q20WK8, Q6UW54, Q9UP68
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 30, 2000
    Last sequence update: November 1, 1998
    Last modified: October 1, 2014
    This is version 129 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 22
      Human chromosome 22: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3