O75419 (CDC45_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 115.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Cell division control protein 45 homolog Alternative name(s): PORC-PI-1 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 566 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Required for initiation of chromosomal DNA replication. |
| Subunit structure | Associated with ORC2. |
| Subcellular location | |
| Tissue specificity | Widely expressed, highest levels are found in adult testis and thymus and in fetal liver. |
| Developmental stage | Transcript peaks at G1-S transition, but total protein remains constant throughout the cell cycle. Expressed in multiple tissues during embryogenesis, including neural crest-derived structures. |
| Sequence similarities | Belongs to the CDC45 family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell cycle DNA replication |
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | DNA replication checkpoint Traceable author statement Ref.2. Source: ProtInc DNA replication initiationTraceable author statement Ref.2. Source: ProtInc DNA strand elongation involved in DNA replicationTraceable author statement. Source: Reactome S phase of mitotic cell cycleTraceable author statement. Source: Reactome regulation of transcription involved in G1/S phase of mitotic cell cycleTraceable author statement. Source: Reactome |
| Cellular_component | centrosome Inferred from direct assay. Source: HPA cytoplasmInferred from electronic annotation. Source: UniProtKB-SubCell nucleoplasmTraceable author statement. Source: Reactome |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| TOPBP1 | Q92547 | 6 | EBI-374969,EBI-308302 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O75419-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O75419-2) The sequence of this isoform differs from the canonical sequence as follows: 68-113: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: O75419-3) The sequence of this isoform differs from the canonical sequence as follows: 180-180: R → RSGSGSEPVAAALEKSSRLFAGPMSDRTAPRSP | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 566 | 566 | Cell division control protein 45 homolog | PRO_0000192815 | |||||
Amino acid modifications | |||||||||
| Modified residue | 130 | 1 | Phosphotyrosine Ref.13 | ||||||
| Modified residue | 144 | 1 | Phosphoserine Ref.13 | ||||||
| Modified residue | 148 | 1 | Phosphoserine Ref.13 | ||||||
Natural variations | |||||||||
| Alternative sequence | 68 – 113 | 46 | Missing in isoform 2. | VSP_043129 | |||||
| Alternative sequence | 180 | 1 | R → RSGSGSEPVAAALEKSSRLF AGPMSDRTAPRSP in isoform 3. | VSP_045411 | |||||
| Natural variant | 81 | 1 | V → I. Ref.8 Corresponds to variant rs13447203 [ dbSNP | Ensembl ]. | VAR_019286 | |||||
| Natural variant | 356 | 1 | M → R. Corresponds to variant rs17209274 [ dbSNP | Ensembl ]. | VAR_053026 | |||||
| Natural variant | 376 | 1 | V → M. Ref.8 Corresponds to variant rs13447263 [ dbSNP | Ensembl ]. | VAR_019287 | |||||
Experimental info | |||||||||
| Sequence conflict | 100 | 1 | T → S in AAQ89330. Ref.5 | ||||||
| Sequence conflict | 115 | 1 | I → V in CAA11530. Ref.3 | ||||||
| Sequence conflict | 346 | 1 | E → Q in AAC67521. Ref.1 | ||||||
| Sequence conflict | 509 | 1 | I → F in BAG56854. Ref.6 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Xenopus Cdc45-dependent loading of DNA polymerase alpha onto chromatin under the control of S-phase Cdk." Mimura S., Takisawa H. EMBO J. 17:5699-5707(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "The human homolog of Saccharomyces cerevisiae CDC45." Saha P., Thome K.C., Yamaguchi R., Hou Z.-H., Weremowicz S., Dutta A. J. Biol. Chem. 273:18205-18209(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "Direct selection of conserved cDNAs from the DiGeorge critical region: isolation of a novel CDC45-like gene." McKie J.M., Wadey R.B., Sutherland H.F., Taylor C.L., Scambler P.J. Genome Res. 8:834-841(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [4] | "Characterization of CDC45L: a gene in the 22q11.2 deletion region expressed during murine and human development." Shaikh T.H., Gottlieb S., Sellinger B., Chen F., Roe B.A., Oakey R.J., Emanuel B.S., Budarf M.L. Mamm. Genome 10:322-326(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Brain. |
| [5] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [6] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3). |
| [7] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [8] | NIEHS SNPs program Submitted (MAR-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS ILE-81 AND MET-376. |
| [9] | "A genome annotation-driven approach to cloning the human ORFeome." Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A., Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J., Beare D.M., Dunham I. Genome Biol. 5:R84.1-R84.11(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [10] | "The DNA sequence of human chromosome 22." Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M. Wright H.Nature 402:489-495(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [11] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [12] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lung and Muscle. |
| [13] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-130; SER-144 AND SER-148, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [14] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF062495 mRNA. Translation: AAC67521.1. AF053074 mRNA. Translation: AAC27289.1. AJ223728 mRNA. Translation: CAA11530.1. AF081535 mRNA. Translation: AAD08998.1. AY358971 mRNA. Translation: AAQ89330.1. AK293123 mRNA. Translation: BAG56675.1. AK293338 mRNA. Translation: BAG56854.1. BT006792 mRNA. Translation: AAP35438.1. AY572790 Genomic DNA. Translation: AAS66985.1. CT841513 mRNA. Translation: CAJ86443.1. AC000082 Genomic DNA. No translation available. AC000087 Genomic DNA. No translation available. AC000088 Genomic DNA. No translation available. CH471176 Genomic DNA. Translation: EAX03036.1. BC006232 mRNA. Translation: AAH06232.1. BC010022 mRNA. Translation: AAH10022.1. |
| IPI | IPI00025695. IPI00878645. IPI00909930. |
| RefSeq | NP_001171481.1. NM_001178010.1. NP_001171482.1. NM_001178011.1. NP_003495.1. NM_003504.3. |
| UniGene | Hs.474217. |
3D structure databases | |
| ProteinModelPortal | O75419. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-31725N. |
| IntAct | O75419. 10 interactions. |
| MINT | MINT-1201326. |
PTM databases | |
| PhosphoSite | O75419. |
Proteomic databases | |
| PaxDb | O75419. |
| PeptideAtlas | O75419. |
| PRIDE | O75419. |
Protocols and materials databases | |
| DNASU | 8318. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000263201; ENSP00000263201; ENSG00000093009. ENST00000404724; ENSP00000384978; ENSG00000093009. ENST00000407835; ENSP00000385240; ENSG00000093009. ENST00000437685; ENSP00000405726; ENSG00000093009. |
| GeneID | 8318. |
| KEGG | hsa:8318. |
| UCSC | uc002zpr.3. human. uc002zpt.3. human. uc011aha.2. human. |
Organism-specific databases | |
| CTD | 8318. |
| GeneCards | GC22P019466. |
| HGNC | HGNC:1739. CDC45. |
| HPA | CAB009459. HPA000614. |
| MIM | 603465. gene. |
| neXtProt | NX_O75419. |
| PharmGKB | PA371. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG321683. |
| HOGENOM | HOG000253949. |
| HOVERGEN | HBG050819. |
| InParanoid | O75419. |
| KO | K06628. |
| OrthoDB | EOG45756G. |
| PhylomeDB | O75419. |
Enzyme and pathway databases | |
| Reactome | REACT_115566. Cell Cycle. REACT_21300. Mitotic M-M/G1 phases. REACT_383. DNA Replication. |
Gene expression databases | |
| ArrayExpress | O75419. |
| Bgee | O75419. |
| CleanEx | HS_CDC45L. |
| Genevestigator | O75419. |
| GermOnline | ENSG00000093009. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR003874. CDC45. [Graphical view] |
| PANTHER | PTHR10507. PTHR10507. 1 hit. |
| Pfam | PF02724. CDC45. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | O75419. |
| ChEMBL | CHEMBL3040. |
| GenomeRNAi | 8318. |
| NextBio | 31151. |
| SOURCE | Search... |
Entry information
| Entry name | CDC45_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O75419 Secondary accession number(s): B4DDB4 Q9UP68 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 22 Human chromosome 22: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
