Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O75419

- CDC45_HUMAN

UniProt

O75419 - CDC45_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Cell division control protein 45 homolog

Gene

CDC45

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Required for initiation of chromosomal DNA replication.

GO - Biological processi

  1. DNA replication Source: Reactome
  2. DNA replication checkpoint Source: ProtInc
  3. DNA replication initiation Source: ProtInc
  4. DNA strand elongation involved in DNA replication Source: Reactome
  5. G1/S transition of mitotic cell cycle Source: Reactome
  6. mitotic cell cycle Source: Reactome
  7. regulation of transcription involved in G1/S transition of mitotic cell cycle Source: Reactome
Complete GO annotation...

Keywords - Biological processi

Cell cycle, DNA replication

Enzyme and pathway databases

ReactomeiREACT_1095. Activation of the pre-replicative complex.
REACT_471. E2F mediated regulation of DNA replication.
REACT_6769. Activation of ATR in response to replication stress.
REACT_6776. Unwinding of DNA.
REACT_683. G1/S-Specific Transcription.

Names & Taxonomyi

Protein namesi
Recommended name:
Cell division control protein 45 homolog
Alternative name(s):
PORC-PI-1
Gene namesi
Name:CDC45
Synonyms:CDC45L, CDC45L2
ORF Names:UNQ374/PRO710
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 22

Organism-specific databases

HGNCiHGNC:1739. CDC45.

Subcellular locationi

GO - Cellular componenti

  1. centrosome Source: HPA
  2. cytoplasm Source: UniProtKB-KW
  3. nucleoplasm Source: Reactome
  4. nucleus Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA371.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 566566Cell division control protein 45 homologPRO_0000192815Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei130 – 1301Phosphotyrosine1 Publication
Modified residuei144 – 1441Phosphoserine1 Publication
Modified residuei148 – 1481Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiO75419.
PaxDbiO75419.
PeptideAtlasiO75419.
PRIDEiO75419.

PTM databases

PhosphoSiteiO75419.

Expressioni

Tissue specificityi

Widely expressed, highest levels are found in adult testis and thymus and in fetal liver.

Developmental stagei

Transcript peaks at G1-S transition, but total protein remains constant throughout the cell cycle. Expressed in multiple tissues during embryogenesis, including neural crest-derived structures.

Gene expression databases

BgeeiO75419.
CleanExiHS_CDC45L.
ExpressionAtlasiO75419. baseline and differential.
GenevestigatoriO75419.

Organism-specific databases

HPAiCAB009459.
HPA000614.

Interactioni

Subunit structurei

Associated with ORC2.

Binary interactionsi

WithEntry#Exp.IntActNotes
CDKN1AP389362EBI-374969,EBI-375077
CLSPNQ9HAW44EBI-374969,EBI-1369377
RPA2P159274EBI-374969,EBI-621404
TOPBP1Q925476EBI-374969,EBI-308302

Protein-protein interaction databases

BioGridi113915. 27 interactions.
DIPiDIP-31725N.
IntActiO75419. 15 interactions.
MINTiMINT-1201326.

Structurei

3D structure databases

ProteinModelPortaliO75419.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the CDC45 family.Curated

Phylogenomic databases

eggNOGiNOG321683.
GeneTreeiENSGT00390000009662.
HOGENOMiHOG000253949.
HOVERGENiHBG050819.
InParanoidiO75419.
KOiK06628.
OMAiMLLREWN.
OrthoDBiEOG7PZRXS.
PhylomeDBiO75419.
TreeFamiTF101062.

Family and domain databases

InterProiIPR003874. CDC45.
[Graphical view]
PANTHERiPTHR10507. PTHR10507. 1 hit.
PfamiPF02724. CDC45. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O75419-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFVSDFRKEF YEVVQSQRVL LFVASDVDAL CACKILQALF QCDHVQYTLV
60 70 80 90 100
PVSGWQELET AFLEHKEQFH YFILINCGAN VDLLDILQPD EDTIFFVCDT
110 120 130 140 150
HRPVNVVNVY NDTQIKLLIK QDDDLEVPAY EDIFRDEEED EEHSGNDSDG
160 170 180 190 200
SEPSEKRTRL EEEIVEQTMR RRQRREWEAR RRDILFDYEQ YEYHGTSSAM
210 220 230 240 250
VMFELAWMLS KDLNDMLWWA IVGLTDQWVQ DKITQMKYVT DVGVLQRHVS
260 270 280 290 300
RHNHRNEDEE NTLSVDCTRI SFEYDLRLVL YQHWSLHDSL CNTSYTAARF
310 320 330 340 350
KLWSVHGQKR LQEFLADMGL PLKQVKQKFQ AMDISLKENL REMIEESANK
360 370 380 390 400
FGMKDMRVQT FSIHFGFKHK FLASDVVFAT MSLMESPEKD GSGTDHFIQA
410 420 430 440 450
LDSLSRSNLD KLYHGLELAK KQLRATQQTI ASCLCTNLVI SQGPFLYCSL
460 470 480 490 500
MEGTPDVMLF SRPASLSLLS KHLLKSFVCS TKNRRCKLLP LVMAAPLSME
510 520 530 540 550
HGTVTVVGIP PETDSSDRKN FFGRAFEKAA ESTSSRMLHN HFDLSVIELK
560
AEDRSKFLDA LISLLS
Length:566
Mass (Da):65,569
Last modified:November 1, 1998 - v1
Checksum:iAE1BE2C8C8E5F867
GO
Isoform 2 (identifier: O75419-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     68-113: Missing.

Note: No experimental confirmation available.

Show »
Length:520
Mass (Da):60,245
Checksum:iBE5CE1F95079C2E6
GO
Isoform 3 (identifier: O75419-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     180-180: R → RSGSGSEPVAAALEKSSRLFAGPMSDRTAPRSP

Note: No experimental confirmation available.

Show »
Length:598
Mass (Da):68,768
Checksum:i2625590397EB6E6B
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti100 – 1001T → S in AAQ89330. (PubMed:12975309)Curated
Sequence conflicti115 – 1151I → V in CAA11530. (PubMed:9724329)Curated
Sequence conflicti346 – 3461E → Q in AAC67521. (PubMed:9755170)Curated
Sequence conflicti509 – 5091I → F in BAG56854. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti81 – 811V → I.1 Publication
Corresponds to variant rs13447203 [ dbSNP | Ensembl ].
VAR_019286
Natural varianti356 – 3561M → R.
Corresponds to variant rs17209274 [ dbSNP | Ensembl ].
VAR_053026
Natural varianti376 – 3761V → M.1 Publication
Corresponds to variant rs13447263 [ dbSNP | Ensembl ].
VAR_019287

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei68 – 11346Missing in isoform 2. 1 PublicationVSP_043129Add
BLAST
Alternative sequencei180 – 1801R → RSGSGSEPVAAALEKSSRLF AGPMSDRTAPRSP in isoform 3. 1 PublicationVSP_045411

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF062495 mRNA. Translation: AAC67521.1.
AF053074 mRNA. Translation: AAC27289.1.
AJ223728 mRNA. Translation: CAA11530.1.
AF081535 mRNA. Translation: AAD08998.1.
AY358971 mRNA. Translation: AAQ89330.1.
AK293123 mRNA. Translation: BAG56675.1.
AK293338 mRNA. Translation: BAG56854.1.
BT006792 mRNA. Translation: AAP35438.1.
AY572790 Genomic DNA. Translation: AAS66985.1.
CT841513 mRNA. Translation: CAJ86443.1.
AC000082 Genomic DNA. No translation available.
AC000087 Genomic DNA. No translation available.
AC000088 Genomic DNA. No translation available.
CH471176 Genomic DNA. Translation: EAX03036.1.
BC006232 mRNA. Translation: AAH06232.1.
BC010022 mRNA. Translation: AAH10022.1.
CCDSiCCDS13762.1. [O75419-1]
CCDS54499.1. [O75419-3]
CCDS54500.1. [O75419-2]
RefSeqiNP_001171481.1. NM_001178010.2. [O75419-3]
NP_001171482.1. NM_001178011.2. [O75419-2]
NP_003495.1. NM_003504.4. [O75419-1]
XP_005261342.1. XM_005261285.2. [O75419-3]
UniGeneiHs.474217.
Hs.742418.

Genome annotation databases

EnsembliENST00000263201; ENSP00000263201; ENSG00000093009. [O75419-1]
ENST00000404724; ENSP00000384978; ENSG00000093009. [O75419-2]
ENST00000407835; ENSP00000385240; ENSG00000093009. [O75419-1]
ENST00000437685; ENSP00000405726; ENSG00000093009. [O75419-3]
GeneIDi8318.
KEGGihsa:8318.
UCSCiuc002zpr.3. human. [O75419-1]
uc002zpt.3. human. [O75419-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF062495 mRNA. Translation: AAC67521.1 .
AF053074 mRNA. Translation: AAC27289.1 .
AJ223728 mRNA. Translation: CAA11530.1 .
AF081535 mRNA. Translation: AAD08998.1 .
AY358971 mRNA. Translation: AAQ89330.1 .
AK293123 mRNA. Translation: BAG56675.1 .
AK293338 mRNA. Translation: BAG56854.1 .
BT006792 mRNA. Translation: AAP35438.1 .
AY572790 Genomic DNA. Translation: AAS66985.1 .
CT841513 mRNA. Translation: CAJ86443.1 .
AC000082 Genomic DNA. No translation available.
AC000087 Genomic DNA. No translation available.
AC000088 Genomic DNA. No translation available.
CH471176 Genomic DNA. Translation: EAX03036.1 .
BC006232 mRNA. Translation: AAH06232.1 .
BC010022 mRNA. Translation: AAH10022.1 .
CCDSi CCDS13762.1. [O75419-1 ]
CCDS54499.1. [O75419-3 ]
CCDS54500.1. [O75419-2 ]
RefSeqi NP_001171481.1. NM_001178010.2. [O75419-3 ]
NP_001171482.1. NM_001178011.2. [O75419-2 ]
NP_003495.1. NM_003504.4. [O75419-1 ]
XP_005261342.1. XM_005261285.2. [O75419-3 ]
UniGenei Hs.474217.
Hs.742418.

3D structure databases

ProteinModelPortali O75419.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 113915. 27 interactions.
DIPi DIP-31725N.
IntActi O75419. 15 interactions.
MINTi MINT-1201326.

Chemistry

BindingDBi O75419.
ChEMBLi CHEMBL3040.

PTM databases

PhosphoSitei O75419.

Proteomic databases

MaxQBi O75419.
PaxDbi O75419.
PeptideAtlasi O75419.
PRIDEi O75419.

Protocols and materials databases

DNASUi 8318.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000263201 ; ENSP00000263201 ; ENSG00000093009 . [O75419-1 ]
ENST00000404724 ; ENSP00000384978 ; ENSG00000093009 . [O75419-2 ]
ENST00000407835 ; ENSP00000385240 ; ENSG00000093009 . [O75419-1 ]
ENST00000437685 ; ENSP00000405726 ; ENSG00000093009 . [O75419-3 ]
GeneIDi 8318.
KEGGi hsa:8318.
UCSCi uc002zpr.3. human. [O75419-1 ]
uc002zpt.3. human. [O75419-2 ]

Organism-specific databases

CTDi 8318.
GeneCardsi GC22P019466.
HGNCi HGNC:1739. CDC45.
HPAi CAB009459.
HPA000614.
MIMi 603465. gene.
neXtProti NX_O75419.
PharmGKBi PA371.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG321683.
GeneTreei ENSGT00390000009662.
HOGENOMi HOG000253949.
HOVERGENi HBG050819.
InParanoidi O75419.
KOi K06628.
OMAi MLLREWN.
OrthoDBi EOG7PZRXS.
PhylomeDBi O75419.
TreeFami TF101062.

Enzyme and pathway databases

Reactomei REACT_1095. Activation of the pre-replicative complex.
REACT_471. E2F mediated regulation of DNA replication.
REACT_6769. Activation of ATR in response to replication stress.
REACT_6776. Unwinding of DNA.
REACT_683. G1/S-Specific Transcription.

Miscellaneous databases

GeneWikii CDC45-related_protein.
GenomeRNAii 8318.
NextBioi 31151.
PROi O75419.
SOURCEi Search...

Gene expression databases

Bgeei O75419.
CleanExi HS_CDC45L.
ExpressionAtlasi O75419. baseline and differential.
Genevestigatori O75419.

Family and domain databases

InterProi IPR003874. CDC45.
[Graphical view ]
PANTHERi PTHR10507. PTHR10507. 1 hit.
Pfami PF02724. CDC45. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Xenopus Cdc45-dependent loading of DNA polymerase alpha onto chromatin under the control of S-phase Cdk."
    Mimura S., Takisawa H.
    EMBO J. 17:5699-5707(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. "Direct selection of conserved cDNAs from the DiGeorge critical region: isolation of a novel CDC45-like gene."
    McKie J.M., Wadey R.B., Sutherland H.F., Taylor C.L., Scambler P.J.
    Genome Res. 8:834-841(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  4. "Characterization of CDC45L: a gene in the 22q11.2 deletion region expressed during murine and human development."
    Shaikh T.H., Gottlieb S., Sellinger B., Chen F., Roe B.A., Oakey R.J., Emanuel B.S., Budarf M.L.
    Mamm. Genome 10:322-326(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Brain.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
  7. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
    Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
    Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  8. NIEHS SNPs program
    Submitted (MAR-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS ILE-81 AND MET-376.
  9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  10. "The DNA sequence of human chromosome 22."
    Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M.
    , Buck D., Burgess J., Burrill W.D., Burton J., Carder C., Carter N.P., Chen Y., Clark G., Clegg S.M., Cobley V.E., Cole C.G., Collier R.E., Connor R., Conroy D., Corby N.R., Coville G.J., Cox A.V., Davis J., Dawson E., Dhami P.D., Dockree C., Dodsworth S.J., Durbin R.M., Ellington A.G., Evans K.L., Fey J.M., Fleming K., French L., Garner A.A., Gilbert J.G.R., Goward M.E., Grafham D.V., Griffiths M.N.D., Hall C., Hall R.E., Hall-Tamlyn G., Heathcott R.W., Ho S., Holmes S., Hunt S.E., Jones M.C., Kershaw J., Kimberley A.M., King A., Laird G.K., Langford C.F., Leversha M.A., Lloyd C., Lloyd D.M., Martyn I.D., Mashreghi-Mohammadi M., Matthews L.H., Mccann O.T., Mcclay J., Mclaren S., McMurray A.A., Milne S.A., Mortimore B.J., Odell C.N., Pavitt R., Pearce A.V., Pearson D., Phillimore B.J.C.T., Phillips S.H., Plumb R.W., Ramsay H., Ramsey Y., Rogers L., Ross M.T., Scott C.E., Sehra H.K., Skuce C.D., Smalley S., Smith M.L., Soderlund C., Spragon L., Steward C.A., Sulston J.E., Swann R.M., Vaudin M., Wall M., Wallis J.M., Whiteley M.N., Willey D.L., Williams L., Williams S.A., Williamson H., Wilmer T.E., Wilming L., Wright C.L., Hubbard T., Bentley D.R., Beck S., Rogers J., Shimizu N., Minoshima S., Kawasaki K., Sasaki T., Asakawa S., Kudoh J., Shintani A., Shibuya K., Yoshizaki Y., Aoki N., Mitsuyama S., Roe B.A., Chen F., Chu L., Crabtree J., Deschamps S., Do A., Do T., Dorman A., Fang F., Fu Y., Hu P., Hua A., Kenton S., Lai H., Lao H.I., Lewis J., Lewis S., Lin S.-P., Loh P., Malaj E., Nguyen T., Pan H., Phan S., Qi S., Qian Y., Ray L., Ren Q., Shaull S., Sloan D., Song L., Wang Q., Wang Y., Wang Z., White J., Willingham D., Wu H., Yao Z., Zhan M., Zhang G., Chissoe S., Murray J., Miller N., Minx P., Fulton R., Johnson D., Bemis G., Bentley D., Bradshaw H., Bourne S., Cordes M., Du Z., Fulton L., Goela D., Graves T., Hawkins J., Hinds K., Kemp K., Latreille P., Layman D., Ozersky P., Rohlfing T., Scheet P., Walker C., Wamsley A., Wohldmann P., Pepin K., Nelson J., Korf I., Bedell J.A., Hillier L.W., Mardis E., Waterston R., Wilson R., Emanuel B.S., Shaikh T., Kurahashi H., Saitta S., Budarf M.L., McDermid H.E., Johnson A., Wong A.C.C., Morrow B.E., Edelmann L., Kim U.J., Shizuya H., Simon M.I., Dumanski J.P., Peyrard M., Kedra D., Seroussi E., Fransson I., Tapia I., Bruder C.E., O'Brien K.P., Wilkinson P., Bodenteich A., Hartman K., Hu X., Khan A.S., Lane L., Tilahun Y., Wright H.
    Nature 402:489-495(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  11. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  12. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Lung and Muscle.
  13. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-130; SER-144 AND SER-148, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  14. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  15. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiCDC45_HUMAN
AccessioniPrimary (citable) accession number: O75419
Secondary accession number(s): B4DDB4
, B4DDU3, E9PDH7, O60856, Q20WK8, Q6UW54, Q9UP68
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: November 1, 1998
Last modified: October 29, 2014
This is version 130 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3