Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cell division control protein 45 homolog

Gene

CDC45

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Required for initiation of chromosomal DNA replication.

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Cell cycle, DNA replication

Enzyme and pathway databases

BioCyciZFISH:ENSG00000093009-MONOMER.
ReactomeiR-HSA-113510. E2F mediated regulation of DNA replication.
R-HSA-176187. Activation of ATR in response to replication stress.
R-HSA-176974. Unwinding of DNA.
R-HSA-68962. Activation of the pre-replicative complex.
R-HSA-69205. G1/S-Specific Transcription.

Names & Taxonomyi

Protein namesi
Recommended name:
Cell division control protein 45 homolog
Alternative name(s):
PORC-PI-1
Gene namesi
Name:CDC45
Synonyms:CDC45L, CDC45L2
ORF Names:UNQ374/PRO710
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 22

Organism-specific databases

HGNCiHGNC:1739. CDC45.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi8318.
OpenTargetsiENSG00000093009.
PharmGKBiPA371.

Chemistry databases

ChEMBLiCHEMBL3040.

Polymorphism and mutation databases

BioMutaiCDC45.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001928151 – 566Cell division control protein 45 homologAdd BLAST566

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei130PhosphotyrosineCombined sources1
Modified residuei144PhosphoserineCombined sources1
Modified residuei148PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO75419.
MaxQBiO75419.
PeptideAtlasiO75419.
PRIDEiO75419.

PTM databases

iPTMnetiO75419.
PhosphoSitePlusiO75419.

Expressioni

Tissue specificityi

Widely expressed, highest levels are found in adult testis and thymus and in fetal liver.

Developmental stagei

Transcript peaks at G1-S transition, but total protein remains constant throughout the cell cycle. Expressed in multiple tissues during embryogenesis, including neural crest-derived structures.

Gene expression databases

BgeeiENSG00000093009.
CleanExiHS_CDC45L.
ExpressionAtlasiO75419. baseline and differential.
GenevisibleiO75419. HS.

Organism-specific databases

HPAiCAB009459.
HPA000614.

Interactioni

Subunit structurei

Associated with ORC2. Interacts with HELB (PubMed:25933514).1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
CDKN1AP389362EBI-374969,EBI-375077
CEP55D3DR373EBI-374969,EBI-10173536
CLSPNQ9HAW44EBI-374969,EBI-1369377
RPA2P159274EBI-374969,EBI-621404
TOPBP1Q925476EBI-374969,EBI-308302

Protein-protein interaction databases

BioGridi113915. 33 interactors.
DIPiDIP-31725N.
IntActiO75419. 18 interactors.
MINTiMINT-1201326.

Chemistry databases

BindingDBiO75419.

Structurei

Secondary structure

1566
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi6 – 10Combined sources5
Helixi11 – 14Combined sources4
Beta strandi17 – 26Combined sources10
Helixi27 – 42Combined sources16
Beta strandi46 – 54Combined sources9
Helixi55 – 65Combined sources11
Turni66 – 68Combined sources3
Beta strandi70 – 78Combined sources9
Helixi83 – 87Combined sources5
Beta strandi94 – 98Combined sources5
Beta strandi101 – 103Combined sources3
Helixi106 – 110Combined sources5
Beta strandi113 – 117Combined sources5
Helixi130 – 133Combined sources4
Helixi165 – 189Combined sources25
Beta strandi192 – 194Combined sources3
Helixi198 – 208Combined sources11
Helixi214 – 229Combined sources16
Helixi235 – 255Combined sources21
Beta strandi269 – 277Combined sources9
Helixi281 – 283Combined sources3
Helixi286 – 292Combined sources7
Helixi294 – 299Combined sources6
Turni300 – 303Combined sources4
Helixi305 – 318Combined sources14
Helixi322 – 326Combined sources5
Helixi329 – 331Combined sources3
Helixi334 – 350Combined sources17
Beta strandi356 – 366Combined sources11
Beta strandi369 – 372Combined sources4
Helixi373 – 384Combined sources12
Beta strandi389 – 391Combined sources3
Helixi393 – 403Combined sources11
Helixi410 – 435Combined sources26
Beta strandi443 – 449Combined sources7
Helixi457 – 459Combined sources3
Helixi463 – 480Combined sources18
Helixi486 – 488Combined sources3
Beta strandi491 – 498Combined sources8
Turni499 – 502Combined sources4
Beta strandi503 – 509Combined sources7
Helixi522 – 531Combined sources10
Turni532 – 534Combined sources3
Beta strandi541 – 543Combined sources3
Beta strandi546 – 550Combined sources5
Helixi551 – 553Combined sources3
Helixi554 – 565Combined sources12

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5DGOX-ray2.10A1-566[»]
ProteinModelPortaliO75419.
SMRiO75419.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the CDC45 family.Curated

Phylogenomic databases

GeneTreeiENSGT00390000009662.
HOGENOMiHOG000253949.
HOVERGENiHBG050819.
InParanoidiO75419.
KOiK06628.
OMAiGAEFFHE.
OrthoDBiEOG091G05EU.
PhylomeDBiO75419.
TreeFamiTF101062.

Family and domain databases

InterProiIPR003874. CDC45.
[Graphical view]
PANTHERiPTHR10507. PTHR10507. 1 hit.
PfamiPF02724. CDC45. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O75419-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFVSDFRKEF YEVVQSQRVL LFVASDVDAL CACKILQALF QCDHVQYTLV
60 70 80 90 100
PVSGWQELET AFLEHKEQFH YFILINCGAN VDLLDILQPD EDTIFFVCDT
110 120 130 140 150
HRPVNVVNVY NDTQIKLLIK QDDDLEVPAY EDIFRDEEED EEHSGNDSDG
160 170 180 190 200
SEPSEKRTRL EEEIVEQTMR RRQRREWEAR RRDILFDYEQ YEYHGTSSAM
210 220 230 240 250
VMFELAWMLS KDLNDMLWWA IVGLTDQWVQ DKITQMKYVT DVGVLQRHVS
260 270 280 290 300
RHNHRNEDEE NTLSVDCTRI SFEYDLRLVL YQHWSLHDSL CNTSYTAARF
310 320 330 340 350
KLWSVHGQKR LQEFLADMGL PLKQVKQKFQ AMDISLKENL REMIEESANK
360 370 380 390 400
FGMKDMRVQT FSIHFGFKHK FLASDVVFAT MSLMESPEKD GSGTDHFIQA
410 420 430 440 450
LDSLSRSNLD KLYHGLELAK KQLRATQQTI ASCLCTNLVI SQGPFLYCSL
460 470 480 490 500
MEGTPDVMLF SRPASLSLLS KHLLKSFVCS TKNRRCKLLP LVMAAPLSME
510 520 530 540 550
HGTVTVVGIP PETDSSDRKN FFGRAFEKAA ESTSSRMLHN HFDLSVIELK
560
AEDRSKFLDA LISLLS
Length:566
Mass (Da):65,569
Last modified:November 1, 1998 - v1
Checksum:iAE1BE2C8C8E5F867
GO
Isoform 2 (identifier: O75419-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     68-113: Missing.

Note: No experimental confirmation available.
Show »
Length:520
Mass (Da):60,245
Checksum:iBE5CE1F95079C2E6
GO
Isoform 3 (identifier: O75419-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     180-180: R → RSGSGSEPVAAALEKSSRLFAGPMSDRTAPRSP

Note: No experimental confirmation available.
Show »
Length:598
Mass (Da):68,768
Checksum:i2625590397EB6E6B
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti100T → S in AAQ89330 (PubMed:12975309).Curated1
Sequence conflicti115I → V in CAA11530 (PubMed:9724329).Curated1
Sequence conflicti346E → Q in AAC67521 (PubMed:9755170).Curated1
Sequence conflicti509I → F in BAG56854 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01928681V → I.1 PublicationCorresponds to variant rs13447203dbSNPEnsembl.1
Natural variantiVAR_053026356M → R.Corresponds to variant rs17209274dbSNPEnsembl.1
Natural variantiVAR_019287376V → M.1 PublicationCorresponds to variant rs13447263dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04312968 – 113Missing in isoform 2. 1 PublicationAdd BLAST46
Alternative sequenceiVSP_045411180R → RSGSGSEPVAAALEKSSRLF AGPMSDRTAPRSP in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF062495 mRNA. Translation: AAC67521.1.
AF053074 mRNA. Translation: AAC27289.1.
AJ223728 mRNA. Translation: CAA11530.1.
AF081535 mRNA. Translation: AAD08998.1.
AY358971 mRNA. Translation: AAQ89330.1.
AK293123 mRNA. Translation: BAG56675.1.
AK293338 mRNA. Translation: BAG56854.1.
BT006792 mRNA. Translation: AAP35438.1.
AY572790 Genomic DNA. Translation: AAS66985.1.
CT841513 mRNA. Translation: CAJ86443.1.
AC000082 Genomic DNA. No translation available.
AC000087 Genomic DNA. No translation available.
AC000088 Genomic DNA. No translation available.
CH471176 Genomic DNA. Translation: EAX03036.1.
BC006232 mRNA. Translation: AAH06232.1.
BC010022 mRNA. Translation: AAH10022.1.
CCDSiCCDS13762.1. [O75419-1]
CCDS54499.1. [O75419-3]
CCDS54500.1. [O75419-2]
RefSeqiNP_001171481.1. NM_001178010.2. [O75419-3]
NP_001171482.1. NM_001178011.2. [O75419-2]
NP_003495.1. NM_003504.4. [O75419-1]
XP_005261342.1. XM_005261285.2. [O75419-3]
XP_011528717.1. XM_011530415.1. [O75419-1]
XP_011528720.1. XM_011530418.2. [O75419-2]
UniGeneiHs.474217.
Hs.742418.

Genome annotation databases

EnsembliENST00000263201; ENSP00000263201; ENSG00000093009. [O75419-1]
ENST00000404724; ENSP00000384978; ENSG00000093009. [O75419-2]
ENST00000407835; ENSP00000385240; ENSG00000093009. [O75419-1]
ENST00000437685; ENSP00000405726; ENSG00000093009. [O75419-3]
GeneIDi8318.
KEGGihsa:8318.
UCSCiuc002zpr.5. human. [O75419-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF062495 mRNA. Translation: AAC67521.1.
AF053074 mRNA. Translation: AAC27289.1.
AJ223728 mRNA. Translation: CAA11530.1.
AF081535 mRNA. Translation: AAD08998.1.
AY358971 mRNA. Translation: AAQ89330.1.
AK293123 mRNA. Translation: BAG56675.1.
AK293338 mRNA. Translation: BAG56854.1.
BT006792 mRNA. Translation: AAP35438.1.
AY572790 Genomic DNA. Translation: AAS66985.1.
CT841513 mRNA. Translation: CAJ86443.1.
AC000082 Genomic DNA. No translation available.
AC000087 Genomic DNA. No translation available.
AC000088 Genomic DNA. No translation available.
CH471176 Genomic DNA. Translation: EAX03036.1.
BC006232 mRNA. Translation: AAH06232.1.
BC010022 mRNA. Translation: AAH10022.1.
CCDSiCCDS13762.1. [O75419-1]
CCDS54499.1. [O75419-3]
CCDS54500.1. [O75419-2]
RefSeqiNP_001171481.1. NM_001178010.2. [O75419-3]
NP_001171482.1. NM_001178011.2. [O75419-2]
NP_003495.1. NM_003504.4. [O75419-1]
XP_005261342.1. XM_005261285.2. [O75419-3]
XP_011528717.1. XM_011530415.1. [O75419-1]
XP_011528720.1. XM_011530418.2. [O75419-2]
UniGeneiHs.474217.
Hs.742418.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5DGOX-ray2.10A1-566[»]
ProteinModelPortaliO75419.
SMRiO75419.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113915. 33 interactors.
DIPiDIP-31725N.
IntActiO75419. 18 interactors.
MINTiMINT-1201326.

Chemistry databases

BindingDBiO75419.
ChEMBLiCHEMBL3040.

PTM databases

iPTMnetiO75419.
PhosphoSitePlusiO75419.

Polymorphism and mutation databases

BioMutaiCDC45.

Proteomic databases

EPDiO75419.
MaxQBiO75419.
PeptideAtlasiO75419.
PRIDEiO75419.

Protocols and materials databases

DNASUi8318.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000263201; ENSP00000263201; ENSG00000093009. [O75419-1]
ENST00000404724; ENSP00000384978; ENSG00000093009. [O75419-2]
ENST00000407835; ENSP00000385240; ENSG00000093009. [O75419-1]
ENST00000437685; ENSP00000405726; ENSG00000093009. [O75419-3]
GeneIDi8318.
KEGGihsa:8318.
UCSCiuc002zpr.5. human. [O75419-1]

Organism-specific databases

CTDi8318.
DisGeNETi8318.
GeneCardsiCDC45.
HGNCiHGNC:1739. CDC45.
HPAiCAB009459.
HPA000614.
MIMi603465. gene.
neXtProtiNX_O75419.
OpenTargetsiENSG00000093009.
PharmGKBiPA371.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00390000009662.
HOGENOMiHOG000253949.
HOVERGENiHBG050819.
InParanoidiO75419.
KOiK06628.
OMAiGAEFFHE.
OrthoDBiEOG091G05EU.
PhylomeDBiO75419.
TreeFamiTF101062.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000093009-MONOMER.
ReactomeiR-HSA-113510. E2F mediated regulation of DNA replication.
R-HSA-176187. Activation of ATR in response to replication stress.
R-HSA-176974. Unwinding of DNA.
R-HSA-68962. Activation of the pre-replicative complex.
R-HSA-69205. G1/S-Specific Transcription.

Miscellaneous databases

GeneWikiiCDC45-related_protein.
GenomeRNAii8318.
PROiO75419.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000093009.
CleanExiHS_CDC45L.
ExpressionAtlasiO75419. baseline and differential.
GenevisibleiO75419. HS.

Family and domain databases

InterProiIPR003874. CDC45.
[Graphical view]
PANTHERiPTHR10507. PTHR10507. 1 hit.
PfamiPF02724. CDC45. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCDC45_HUMAN
AccessioniPrimary (citable) accession number: O75419
Secondary accession number(s): B4DDB4
, B4DDU3, E9PDH7, O60856, Q20WK8, Q6UW54, Q9UP68
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: November 1, 1998
Last modified: November 30, 2016
This is version 149 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.