Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O75419 (CDC45_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 127. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Cell division control protein 45 homolog
Alternative name(s):
PORC-PI-1
Gene names
Name:CDC45
Synonyms:CDC45L, CDC45L2
ORF Names:UNQ374/PRO710
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length566 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Required for initiation of chromosomal DNA replication.

Subunit structure

Associated with ORC2.

Subcellular location

Cytoplasm. Nucleus.

Tissue specificity

Widely expressed, highest levels are found in adult testis and thymus and in fetal liver.

Developmental stage

Transcript peaks at G1-S transition, but total protein remains constant throughout the cell cycle. Expressed in multiple tissues during embryogenesis, including neural crest-derived structures.

Sequence similarities

Belongs to the CDC45 family.

Binary interactions

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: O75419-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O75419-2)

The sequence of this isoform differs from the canonical sequence as follows:
     68-113: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: O75419-3)

The sequence of this isoform differs from the canonical sequence as follows:
     180-180: R → RSGSGSEPVAAALEKSSRLFAGPMSDRTAPRSP
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 566566Cell division control protein 45 homolog
PRO_0000192815

Amino acid modifications

Modified residue1301Phosphotyrosine Ref.13
Modified residue1441Phosphoserine Ref.13
Modified residue1481Phosphoserine Ref.13

Natural variations

Alternative sequence68 – 11346Missing in isoform 2.
VSP_043129
Alternative sequence1801R → RSGSGSEPVAAALEKSSRLF AGPMSDRTAPRSP in isoform 3.
VSP_045411
Natural variant811V → I. Ref.8
Corresponds to variant rs13447203 [ dbSNP | Ensembl ].
VAR_019286
Natural variant3561M → R.
Corresponds to variant rs17209274 [ dbSNP | Ensembl ].
VAR_053026
Natural variant3761V → M. Ref.8
Corresponds to variant rs13447263 [ dbSNP | Ensembl ].
VAR_019287

Experimental info

Sequence conflict1001T → S in AAQ89330. Ref.5
Sequence conflict1151I → V in CAA11530. Ref.3
Sequence conflict3461E → Q in AAC67521. Ref.1
Sequence conflict5091I → F in BAG56854. Ref.6

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified November 1, 1998. Version 1.
Checksum: AE1BE2C8C8E5F867

FASTA56665,569
        10         20         30         40         50         60 
MFVSDFRKEF YEVVQSQRVL LFVASDVDAL CACKILQALF QCDHVQYTLV PVSGWQELET 

        70         80         90        100        110        120 
AFLEHKEQFH YFILINCGAN VDLLDILQPD EDTIFFVCDT HRPVNVVNVY NDTQIKLLIK 

       130        140        150        160        170        180 
QDDDLEVPAY EDIFRDEEED EEHSGNDSDG SEPSEKRTRL EEEIVEQTMR RRQRREWEAR 

       190        200        210        220        230        240 
RRDILFDYEQ YEYHGTSSAM VMFELAWMLS KDLNDMLWWA IVGLTDQWVQ DKITQMKYVT 

       250        260        270        280        290        300 
DVGVLQRHVS RHNHRNEDEE NTLSVDCTRI SFEYDLRLVL YQHWSLHDSL CNTSYTAARF 

       310        320        330        340        350        360 
KLWSVHGQKR LQEFLADMGL PLKQVKQKFQ AMDISLKENL REMIEESANK FGMKDMRVQT 

       370        380        390        400        410        420 
FSIHFGFKHK FLASDVVFAT MSLMESPEKD GSGTDHFIQA LDSLSRSNLD KLYHGLELAK 

       430        440        450        460        470        480 
KQLRATQQTI ASCLCTNLVI SQGPFLYCSL MEGTPDVMLF SRPASLSLLS KHLLKSFVCS 

       490        500        510        520        530        540 
TKNRRCKLLP LVMAAPLSME HGTVTVVGIP PETDSSDRKN FFGRAFEKAA ESTSSRMLHN 

       550        560 
HFDLSVIELK AEDRSKFLDA LISLLS 

« Hide

Isoform 2 [UniParc].

Checksum: BE5CE1F95079C2E6
Show »

FASTA52060,245
Isoform 3 [UniParc].

Checksum: 2625590397EB6E6B
Show »

FASTA59868,768

References

« Hide 'large scale' references
[1]"Xenopus Cdc45-dependent loading of DNA polymerase alpha onto chromatin under the control of S-phase Cdk."
Mimura S., Takisawa H.
EMBO J. 17:5699-5707(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[2]"The human homolog of Saccharomyces cerevisiae CDC45."
Saha P., Thome K.C., Yamaguchi R., Hou Z.-H., Weremowicz S., Dutta A.
J. Biol. Chem. 273:18205-18209(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[3]"Direct selection of conserved cDNAs from the DiGeorge critical region: isolation of a novel CDC45-like gene."
McKie J.M., Wadey R.B., Sutherland H.F., Taylor C.L., Scambler P.J.
Genome Res. 8:834-841(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[4]"Characterization of CDC45L: a gene in the 22q11.2 deletion region expressed during murine and human development."
Shaikh T.H., Gottlieb S., Sellinger B., Chen F., Roe B.A., Oakey R.J., Emanuel B.S., Budarf M.L.
Mamm. Genome 10:322-326(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Brain.
[5]"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. expand/collapse author list , Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.
Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[6]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
[7]"Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[8]NIEHS SNPs program
Submitted (MAR-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS ILE-81 AND MET-376.
[9]"A genome annotation-driven approach to cloning the human ORFeome."
Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A., Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J., Beare D.M., Dunham I.
Genome Biol. 5:R84.1-R84.11(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[10]"The DNA sequence of human chromosome 22."
Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M. expand/collapse author list , Buck D., Burgess J., Burrill W.D., Burton J., Carder C., Carter N.P., Chen Y., Clark G., Clegg S.M., Cobley V.E., Cole C.G., Collier R.E., Connor R., Conroy D., Corby N.R., Coville G.J., Cox A.V., Davis J., Dawson E., Dhami P.D., Dockree C., Dodsworth S.J., Durbin R.M., Ellington A.G., Evans K.L., Fey J.M., Fleming K., French L., Garner A.A., Gilbert J.G.R., Goward M.E., Grafham D.V., Griffiths M.N.D., Hall C., Hall R.E., Hall-Tamlyn G., Heathcott R.W., Ho S., Holmes S., Hunt S.E., Jones M.C., Kershaw J., Kimberley A.M., King A., Laird G.K., Langford C.F., Leversha M.A., Lloyd C., Lloyd D.M., Martyn I.D., Mashreghi-Mohammadi M., Matthews L.H., Mccann O.T., Mcclay J., Mclaren S., McMurray A.A., Milne S.A., Mortimore B.J., Odell C.N., Pavitt R., Pearce A.V., Pearson D., Phillimore B.J.C.T., Phillips S.H., Plumb R.W., Ramsay H., Ramsey Y., Rogers L., Ross M.T., Scott C.E., Sehra H.K., Skuce C.D., Smalley S., Smith M.L., Soderlund C., Spragon L., Steward C.A., Sulston J.E., Swann R.M., Vaudin M., Wall M., Wallis J.M., Whiteley M.N., Willey D.L., Williams L., Williams S.A., Williamson H., Wilmer T.E., Wilming L., Wright C.L., Hubbard T., Bentley D.R., Beck S., Rogers J., Shimizu N., Minoshima S., Kawasaki K., Sasaki T., Asakawa S., Kudoh J., Shintani A., Shibuya K., Yoshizaki Y., Aoki N., Mitsuyama S., Roe B.A., Chen F., Chu L., Crabtree J., Deschamps S., Do A., Do T., Dorman A., Fang F., Fu Y., Hu P., Hua A., Kenton S., Lai H., Lao H.I., Lewis J., Lewis S., Lin S.-P., Loh P., Malaj E., Nguyen T., Pan H., Phan S., Qi S., Qian Y., Ray L., Ren Q., Shaull S., Sloan D., Song L., Wang Q., Wang Y., Wang Z., White J., Willingham D., Wu H., Yao Z., Zhan M., Zhang G., Chissoe S., Murray J., Miller N., Minx P., Fulton R., Johnson D., Bemis G., Bentley D., Bradshaw H., Bourne S., Cordes M., Du Z., Fulton L., Goela D., Graves T., Hawkins J., Hinds K., Kemp K., Latreille P., Layman D., Ozersky P., Rohlfing T., Scheet P., Walker C., Wamsley A., Wohldmann P., Pepin K., Nelson J., Korf I., Bedell J.A., Hillier L.W., Mardis E., Waterston R., Wilson R., Emanuel B.S., Shaikh T., Kurahashi H., Saitta S., Budarf M.L., McDermid H.E., Johnson A., Wong A.C.C., Morrow B.E., Edelmann L., Kim U.J., Shizuya H., Simon M.I., Dumanski J.P., Peyrard M., Kedra D., Seroussi E., Fransson I., Tapia I., Bruder C.E., O'Brien K.P., Wilkinson P., Bodenteich A., Hartman K., Hu X., Khan A.S., Lane L., Tilahun Y., Wright H.
Nature 402:489-495(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[11]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[12]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Lung and Muscle.
[13]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-130; SER-144 AND SER-148, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[14]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[15]"N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB."
Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.
Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Web resources

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF062495 mRNA. Translation: AAC67521.1.
AF053074 mRNA. Translation: AAC27289.1.
AJ223728 mRNA. Translation: CAA11530.1.
AF081535 mRNA. Translation: AAD08998.1.
AY358971 mRNA. Translation: AAQ89330.1.
AK293123 mRNA. Translation: BAG56675.1.
AK293338 mRNA. Translation: BAG56854.1.
BT006792 mRNA. Translation: AAP35438.1.
AY572790 Genomic DNA. Translation: AAS66985.1.
CT841513 mRNA. Translation: CAJ86443.1.
AC000082 Genomic DNA. No translation available.
AC000087 Genomic DNA. No translation available.
AC000088 Genomic DNA. No translation available.
CH471176 Genomic DNA. Translation: EAX03036.1.
BC006232 mRNA. Translation: AAH06232.1.
BC010022 mRNA. Translation: AAH10022.1.
CCDSCCDS13762.1. [O75419-1]
CCDS54499.1. [O75419-3]
CCDS54500.1. [O75419-2]
RefSeqNP_001171481.1. NM_001178010.2. [O75419-3]
NP_001171482.1. NM_001178011.2. [O75419-2]
NP_003495.1. NM_003504.4. [O75419-1]
XP_005261342.1. XM_005261285.2. [O75419-3]
UniGeneHs.474217.
Hs.742418.

3D structure databases

ProteinModelPortalO75419.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid113915. 27 interactions.
DIPDIP-31725N.
IntActO75419. 15 interactions.
MINTMINT-1201326.

Chemistry

BindingDBO75419.
ChEMBLCHEMBL3040.

PTM databases

PhosphoSiteO75419.

Proteomic databases

MaxQBO75419.
PaxDbO75419.
PeptideAtlasO75419.
PRIDEO75419.

Protocols and materials databases

DNASU8318.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000263201; ENSP00000263201; ENSG00000093009. [O75419-1]
ENST00000404724; ENSP00000384978; ENSG00000093009. [O75419-2]
ENST00000407835; ENSP00000385240; ENSG00000093009. [O75419-1]
ENST00000437685; ENSP00000405726; ENSG00000093009. [O75419-3]
GeneID8318.
KEGGhsa:8318.
UCSCuc002zpr.3. human. [O75419-1]
uc002zpt.3. human. [O75419-2]

Organism-specific databases

CTD8318.
GeneCardsGC22P019466.
HGNCHGNC:1739. CDC45.
HPACAB009459.
HPA000614.
MIM603465. gene.
neXtProtNX_O75419.
PharmGKBPA371.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG321683.
HOGENOMHOG000253949.
HOVERGENHBG050819.
InParanoidO75419.
KOK06628.
OMAMLLREWN.
OrthoDBEOG7PZRXS.
PhylomeDBO75419.
TreeFamTF101062.

Enzyme and pathway databases

ReactomeREACT_115566. Cell Cycle.
REACT_21300. Mitotic M-M/G1 phases.
REACT_383. DNA Replication.

Gene expression databases

ArrayExpressO75419.
BgeeO75419.
CleanExHS_CDC45L.
GenevestigatorO75419.

Family and domain databases

InterProIPR003874. CDC45.
[Graphical view]
PANTHERPTHR10507. PTHR10507. 1 hit.
PfamPF02724. CDC45. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiCDC45-related_protein.
GenomeRNAi8318.
NextBio31151.
PROO75419.
SOURCESearch...

Entry information

Entry nameCDC45_HUMAN
AccessionPrimary (citable) accession number: O75419
Secondary accession number(s): B4DDB4 expand/collapse secondary AC list , B4DDU3, E9PDH7, O60856, Q20WK8, Q6UW54, Q9UP68
Entry history
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: November 1, 1998
Last modified: July 9, 2014
This is version 127 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 22

Human chromosome 22: entries, gene names and cross-references to MIM