Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O75386

- TULP3_HUMAN

UniProt

O75386 - TULP3_HUMAN

Protein

Tubby-related protein 3

Gene

TULP3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 108 (01 Oct 2014)
      Sequence version 2 (06 Feb 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Negative regulator of the Shh signaling transduction pathway: recruited to primary cilia via association with the IFT complex A (IFT-A) and is required for recruitment of G protein-coupled receptor GPR161 to cilia, a promoter of PKA-dependent basal repression machinery in Shh signaling. Binds to phosphorylated inositide (phosphoinositide) lipids. Both IFT-A- and phosphoinositide-binding properties are required to regulate ciliary G protein-coupled receptor trafficking. Not involved in ciliogenesis.2 Publications

    GO - Molecular functioni

    1. enzyme binding Source: UniProt
    2. phosphatidylinositol-4,5-bisphosphate binding Source: UniProtKB
    3. phosphatidylinositol binding Source: UniProtKB
    4. protein binding Source: IntAct
    5. protein complex binding Source: MGI

    GO - Biological processi

    1. G-protein coupled receptor signaling pathway Source: UniProtKB
    2. multicellular organismal development Source: UniProtKB-KW
    3. negative regulation of smoothened signaling pathway Source: UniProtKB
    4. regulation of G-protein coupled receptor protein signaling pathway Source: UniProtKB
    5. regulation of transcription, DNA-templated Source: UniProtKB

    Keywords - Molecular functioni

    Developmental protein

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Tubby-related protein 3
    Alternative name(s):
    Tubby-like protein 3
    Gene namesi
    Name:TULP3
    Synonyms:TUBL3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 12

    Organism-specific databases

    HGNCiHGNC:12425. TULP3.

    Subcellular locationi

    Nucleus. Cell membrane. Cell projectioncilium. Cytoplasm By similarity. Secreted By similarity
    Note: Does not have a cleavable signal peptide and is secreted by a non-conventional pathway By similarity. Translocates from the plasma membrane to the nucleus upon activation of guanine nucleotide-binding protein G(q) subunit alpha.By similarity

    GO - Cellular componenti

    1. ciliary base Source: MGI
    2. cilium Source: MGI
    3. cytoplasm Source: UniProtKB-SubCell
    4. extracellular region Source: UniProtKB-SubCell
    5. nucleolus Source: HPA
    6. nucleus Source: UniProtKB
    7. plasma membrane Source: UniProtKB
    8. primary cilium Source: UniProtKB

    Keywords - Cellular componenti

    Cell membrane, Cell projection, Cilium, Cytoplasm, Membrane, Nucleus, Secreted

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi24 – 3411RQAKLDYQRLL → AQAAADYAALA in mut12; abolishes association with the IFT complex A (IFT-A) without affecting phosphoinositide binding. Impaired localization to cilia. 1 PublicationAdd
    BLAST
    Mutagenesisi268 – 2703KLR → ALA in TULP3KR; abolishes phosphoinositide binding and impairs localization to cilia. Still associates with the IFT complex A (IFT-A). 1 Publication

    Organism-specific databases

    PharmGKBiPA37087.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 442442Tubby-related protein 3PRO_0000186470Add
    BLAST

    Proteomic databases

    MaxQBiO75386.
    PaxDbiO75386.
    PRIDEiO75386.

    PTM databases

    PhosphoSiteiO75386.

    Expressioni

    Tissue specificityi

    Expressed at high levels in testis, ovaries, thyroid, and spinal chord.1 Publication

    Gene expression databases

    ArrayExpressiO75386.
    BgeeiO75386.
    CleanExiHS_TULP3.
    GenevestigatoriO75386.

    Organism-specific databases

    HPAiHPA015285.
    HPA018496.

    Interactioni

    Subunit structurei

    Associates with the IFT complex A (IFT-A).

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    vprP125202EBI-5357290,EBI-6164519From a different organism.

    Protein-protein interaction databases

    BioGridi113140. 3 interactions.
    IntActiO75386. 56 interactions.
    STRINGi9606.ENSP00000228245.

    Structurei

    3D structure databases

    ProteinModelPortaliO75386.
    SMRiO75386. Positions 184-442.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni23 – 6846Required for association with the IFT complex A (IFT-A)Add
    BLAST

    Sequence similaritiesi

    Belongs to the TUB family.Curated

    Phylogenomic databases

    eggNOGiNOG286778.
    HOGENOMiHOG000016044.
    HOVERGENiHBG018010.
    InParanoidiO75386.
    OrthoDBiEOG7P8PC5.
    PhylomeDBiO75386.

    Family and domain databases

    Gene3Di3.20.90.10. 1 hit.
    InterProiIPR000007. Tubby_C.
    IPR025659. Tubby_C-like.
    IPR018066. Tubby_C_CS.
    IPR005398. Tubby_N.
    [Graphical view]
    PfamiPF01167. Tub. 1 hit.
    [Graphical view]
    PRINTSiPR01573. SUPERTUBBY.
    PR01574. TUBBYPROTEIN.
    SUPFAMiSSF54518. SSF54518. 1 hit.
    PROSITEiPS01200. TUB_1. 1 hit.
    PS01201. TUB_2. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O75386-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEASRCRLSP SGDSVFHEEM MKMRQAKLDY QRLLLEKRQR KKRLEPFMVQ    50
    PNPEARLRRA KPRASDEQTP LVNCHTPHSN VILHGIDGPA AVLKPDEVHA 100
    PSVSSSVVEE DAENTVDTAS KPGLQERLQK HDISESVNFD EETDGISQSA 150
    CLERPNSASS QNSTDTGTSG SATAAQPADN LLGDIDDLED FVYSPAPQGV 200
    TVRCRIIRDK RGMDRGLFPT YYMYLEKEEN QKIFLLAARK RKKSKTANYL 250
    ISIDPVDLSR EGESYVGKLR SNLMGTKFTV YDRGICPMKG RGLVGAAHTR 300
    QELAAISYET NVLGFKGPRK MSVIIPGMTL NHKQIPYQPQ NNHDSLLSRW 350
    QNRTMENLVE LHNKAPVWNS DTQSYVLNFR GRVTQASVKN FQIVHKNDPD 400
    YIVMQFGRVA DDVFTLDYNY PLCAVQAFGI GLSSFDSKLA CE 442
    Length:442
    Mass (Da):49,642
    Last modified:February 6, 2007 - v2
    Checksum:i13DBC83305BFAC1D
    GO
    Isoform 2 (identifier: O75386-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         437-442: SKLACE → KCIQTLRMQELCELHRQHHSAASLVHRTVCQRWVGHPWRLLPQTSLLWTDLSPPPVVPAPHQISM

    Note: No experimental confirmation available. Gene prediction based on EST data.

    Show »
    Length:501
    Mass (Da):56,545
    Checksum:i15F3B7C6A80F3ABA
    GO
    Isoform 3 (identifier: O75386-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-19: Missing.
         165-189: DTGTSGSATAAQPADNLLGDIDDLE → FSSFCQKTEDTGYRHFRFCYCRPTS
         190-442: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:170
    Mass (Da):19,273
    Checksum:i833707F24020C56E
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti168 – 18114TSGSA…PADNL → IPVLLLPPNQLITF in AAC95431. (PubMed:9828123)CuratedAdd
    BLAST
    Sequence conflicti187 – 1871D → Y in AAH32587. (PubMed:15489334)Curated
    Sequence conflicti193 – 1942YS → LV in AAC95431. (PubMed:9828123)Curated
    Sequence conflicti219 – 2268PTYYMYLE → SHLLYVLG in AAC95431. (PubMed:9828123)Curated
    Sequence conflicti393 – 3931I → L in AAC95431. (PubMed:9828123)Curated
    Sequence conflicti429 – 4313GIG → AIS in AAC95431. (PubMed:9828123)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 1919Missing in isoform 3. 1 PublicationVSP_055761Add
    BLAST
    Alternative sequencei165 – 18925DTGTS…IDDLE → FSSFCQKTEDTGYRHFRFCY CRPTS in isoform 3. 1 PublicationVSP_055762Add
    BLAST
    Alternative sequencei190 – 442253Missing in isoform 3. 1 PublicationVSP_055763Add
    BLAST
    Alternative sequencei437 – 4426SKLACE → KCIQTLRMQELCELHRQHHS AASLVHRTVCQRWVGHPWRL LPQTSLLWTDLSPPPVVPAP HQISM in isoform 2. CuratedVSP_054752

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF045583 mRNA. Translation: AAC95431.1.
    AK024246 mRNA. Translation: BAG51279.1.
    AK299990 mRNA. Translation: BAH13188.1.
    AC005911 Genomic DNA. No translation available.
    CH471116 Genomic DNA. Translation: EAW88876.1.
    CH471116 Genomic DNA. Translation: EAW88877.1.
    CH471116 Genomic DNA. Translation: EAW88878.1.
    BC032587 mRNA. Translation: AAH32587.1.
    CCDSiCCDS53737.1. [O75386-2]
    CCDS8519.1. [O75386-1]
    RefSeqiNP_001153880.1. NM_001160408.1. [O75386-2]
    NP_003315.2. NM_003324.4. [O75386-1]
    UniGeneiHs.655333.

    Genome annotation databases

    EnsembliENST00000397132; ENSP00000380321; ENSG00000078246. [O75386-2]
    ENST00000448120; ENSP00000410051; ENSG00000078246. [O75386-1]
    ENST00000540184; ENSP00000444110; ENSG00000078246. [O75386-3]
    GeneIDi7289.
    KEGGihsa:7289.
    UCSCiuc010seh.1. human. [O75386-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF045583 mRNA. Translation: AAC95431.1 .
    AK024246 mRNA. Translation: BAG51279.1 .
    AK299990 mRNA. Translation: BAH13188.1 .
    AC005911 Genomic DNA. No translation available.
    CH471116 Genomic DNA. Translation: EAW88876.1 .
    CH471116 Genomic DNA. Translation: EAW88877.1 .
    CH471116 Genomic DNA. Translation: EAW88878.1 .
    BC032587 mRNA. Translation: AAH32587.1 .
    CCDSi CCDS53737.1. [O75386-2 ]
    CCDS8519.1. [O75386-1 ]
    RefSeqi NP_001153880.1. NM_001160408.1. [O75386-2 ]
    NP_003315.2. NM_003324.4. [O75386-1 ]
    UniGenei Hs.655333.

    3D structure databases

    ProteinModelPortali O75386.
    SMRi O75386. Positions 184-442.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 113140. 3 interactions.
    IntActi O75386. 56 interactions.
    STRINGi 9606.ENSP00000228245.

    PTM databases

    PhosphoSitei O75386.

    Proteomic databases

    MaxQBi O75386.
    PaxDbi O75386.
    PRIDEi O75386.

    Protocols and materials databases

    DNASUi 7289.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000397132 ; ENSP00000380321 ; ENSG00000078246 . [O75386-2 ]
    ENST00000448120 ; ENSP00000410051 ; ENSG00000078246 . [O75386-1 ]
    ENST00000540184 ; ENSP00000444110 ; ENSG00000078246 . [O75386-3 ]
    GeneIDi 7289.
    KEGGi hsa:7289.
    UCSCi uc010seh.1. human. [O75386-1 ]

    Organism-specific databases

    CTDi 7289.
    GeneCardsi GC12P002989.
    HGNCi HGNC:12425. TULP3.
    HPAi HPA015285.
    HPA018496.
    MIMi 604730. gene.
    neXtProti NX_O75386.
    PharmGKBi PA37087.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG286778.
    HOGENOMi HOG000016044.
    HOVERGENi HBG018010.
    InParanoidi O75386.
    OrthoDBi EOG7P8PC5.
    PhylomeDBi O75386.

    Miscellaneous databases

    GenomeRNAii 7289.
    NextBioi 28499.
    PROi O75386.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O75386.
    Bgeei O75386.
    CleanExi HS_TULP3.
    Genevestigatori O75386.

    Family and domain databases

    Gene3Di 3.20.90.10. 1 hit.
    InterProi IPR000007. Tubby_C.
    IPR025659. Tubby_C-like.
    IPR018066. Tubby_C_CS.
    IPR005398. Tubby_N.
    [Graphical view ]
    Pfami PF01167. Tub. 1 hit.
    [Graphical view ]
    PRINTSi PR01573. SUPERTUBBY.
    PR01574. TUBBYPROTEIN.
    SUPFAMi SSF54518. SSF54518. 1 hit.
    PROSITEi PS01200. TUB_1. 1 hit.
    PS01201. TUB_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular characterization of a novel tubby gene family member, TULP3, in mouse and humans."
      Nishina P.M., North M.A., Ikeda A., Yan Y., Naggert J.K.
      Genomics 54:215-220(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    3. "The finished DNA sequence of human chromosome 12."
      Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
      , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
      Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Eye.
    6. Cited for: FUNCTION IN G-PROTEIN SIGNALING, SUBCELLULAR LOCATION.
    7. "TULP3 bridges the IFT-A complex and membrane phosphoinositides to promote trafficking of G protein-coupled receptors into primary cilia."
      Mukhopadhyay S., Wen X., Chih B., Nelson C.D., Lane W.S., Scales S.J., Jackson P.K.
      Genes Dev. 24:2180-2193(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION, ASSOCIATION WITH THE IFT-A COMPLEX, MUTAGENESIS OF 24-ARG--LEU-34 AND 268-LYS--ARG-270.

    Entry informationi

    Entry nameiTULP3_HUMAN
    AccessioniPrimary (citable) accession number: O75386
    Secondary accession number(s): B3KNB7
    , B7Z6A2, D3DUQ4, F8WBZ9, Q8N5B0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 30, 2000
    Last sequence update: February 6, 2007
    Last modified: October 1, 2014
    This is version 108 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3