Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O75386

- TULP3_HUMAN

UniProt

O75386 - TULP3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Tubby-related protein 3

Gene

TULP3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Negative regulator of the Shh signaling transduction pathway: recruited to primary cilia via association with the IFT complex A (IFT-A) and is required for recruitment of G protein-coupled receptor GPR161 to cilia, a promoter of PKA-dependent basal repression machinery in Shh signaling. Binds to phosphorylated inositide (phosphoinositide) lipids. Both IFT-A- and phosphoinositide-binding properties are required to regulate ciliary G protein-coupled receptor trafficking. Not involved in ciliogenesis.2 Publications

GO - Molecular functioni

  1. enzyme binding Source: UniProt
  2. phosphatidylinositol-4,5-bisphosphate binding Source: UniProtKB
  3. phosphatidylinositol binding Source: UniProtKB
  4. protein complex binding Source: MGI

GO - Biological processi

  1. anterior/posterior pattern specification Source: Ensembl
  2. bone development Source: Ensembl
  3. brain development Source: Ensembl
  4. bronchus morphogenesis Source: Ensembl
  5. central nervous system neuron differentiation Source: Ensembl
  6. embryonic camera-type eye development Source: Ensembl
  7. embryonic digit morphogenesis Source: Ensembl
  8. embryonic neurocranium morphogenesis Source: Ensembl
  9. ganglion development Source: Ensembl
  10. G-protein coupled receptor signaling pathway Source: UniProtKB
  11. negative regulation of smoothened signaling pathway Source: UniProtKB
  12. negative regulation of smoothened signaling pathway involved in dorsal/ventral neural tube patterning Source: Ensembl
  13. negative regulation of smoothened signaling pathway involved in ventral spinal cord patterning Source: Ensembl
  14. neural tube closure Source: Ensembl
  15. regulation of G-protein coupled receptor protein signaling pathway Source: UniProtKB
  16. regulation of transcription, DNA-templated Source: UniProtKB
  17. smoothened signaling pathway involved in dorsal/ventral neural tube patterning Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Names & Taxonomyi

Protein namesi
Recommended name:
Tubby-related protein 3
Alternative name(s):
Tubby-like protein 3
Gene namesi
Name:TULP3
Synonyms:TUBL3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:12425. TULP3.

Subcellular locationi

Nucleus. Cell membrane. Cell projectioncilium. Cytoplasm By similarity. Secreted By similarity
Note: Does not have a cleavable signal peptide and is secreted by a non-conventional pathway (By similarity). Translocates from the plasma membrane to the nucleus upon activation of guanine nucleotide-binding protein G(q) subunit alpha.By similarity

GO - Cellular componenti

  1. axoneme Source: Ensembl
  2. ciliary base Source: MGI
  3. cilium Source: MGI
  4. extracellular region Source: UniProtKB-KW
  5. nucleolus Source: HPA
  6. nucleus Source: UniProtKB
  7. plasma membrane Source: UniProtKB
  8. primary cilium Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cell projection, Cilium, Cytoplasm, Membrane, Nucleus, Secreted

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi24 – 3411RQAKLDYQRLL → AQAAADYAALA in mut12; abolishes association with the IFT complex A (IFT-A) without affecting phosphoinositide binding. Impaired localization to cilia. 1 PublicationAdd
BLAST
Mutagenesisi268 – 2703KLR → ALA in TULP3KR; abolishes phosphoinositide binding and impairs localization to cilia. Still associates with the IFT complex A (IFT-A). 1 Publication

Organism-specific databases

PharmGKBiPA37087.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 442442Tubby-related protein 3PRO_0000186470Add
BLAST

Proteomic databases

MaxQBiO75386.
PaxDbiO75386.
PRIDEiO75386.

PTM databases

PhosphoSiteiO75386.

Expressioni

Tissue specificityi

Expressed at high levels in testis, ovaries, thyroid, and spinal chord.1 Publication

Gene expression databases

BgeeiO75386.
CleanExiHS_TULP3.
ExpressionAtlasiO75386. baseline and differential.
GenevestigatoriO75386.

Organism-specific databases

HPAiHPA015285.
HPA018496.

Interactioni

Subunit structurei

Associates with the IFT complex A (IFT-A).

Binary interactionsi

WithEntry#Exp.IntActNotes
vprP125202EBI-5357290,EBI-6164519From a different organism.

Protein-protein interaction databases

BioGridi113140. 3 interactions.
IntActiO75386. 56 interactions.
STRINGi9606.ENSP00000228245.

Structurei

3D structure databases

ProteinModelPortaliO75386.
SMRiO75386. Positions 184-442.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni23 – 6846Required for association with the IFT complex A (IFT-A)Add
BLAST

Sequence similaritiesi

Belongs to the TUB family.Curated

Phylogenomic databases

eggNOGiNOG286778.
GeneTreeiENSGT00610000085970.
HOGENOMiHOG000016044.
HOVERGENiHBG018010.
InParanoidiO75386.
OrthoDBiEOG7P8PC5.
PhylomeDBiO75386.

Family and domain databases

Gene3Di3.20.90.10. 1 hit.
InterProiIPR000007. Tubby_C.
IPR025659. Tubby_C-like.
IPR018066. Tubby_C_CS.
IPR005398. Tubby_N.
[Graphical view]
PfamiPF01167. Tub. 1 hit.
[Graphical view]
PRINTSiPR01573. SUPERTUBBY.
PR01574. TUBBYPROTEIN.
SUPFAMiSSF54518. SSF54518. 1 hit.
PROSITEiPS01200. TUB_1. 1 hit.
PS01201. TUB_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O75386-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEASRCRLSP SGDSVFHEEM MKMRQAKLDY QRLLLEKRQR KKRLEPFMVQ
60 70 80 90 100
PNPEARLRRA KPRASDEQTP LVNCHTPHSN VILHGIDGPA AVLKPDEVHA
110 120 130 140 150
PSVSSSVVEE DAENTVDTAS KPGLQERLQK HDISESVNFD EETDGISQSA
160 170 180 190 200
CLERPNSASS QNSTDTGTSG SATAAQPADN LLGDIDDLED FVYSPAPQGV
210 220 230 240 250
TVRCRIIRDK RGMDRGLFPT YYMYLEKEEN QKIFLLAARK RKKSKTANYL
260 270 280 290 300
ISIDPVDLSR EGESYVGKLR SNLMGTKFTV YDRGICPMKG RGLVGAAHTR
310 320 330 340 350
QELAAISYET NVLGFKGPRK MSVIIPGMTL NHKQIPYQPQ NNHDSLLSRW
360 370 380 390 400
QNRTMENLVE LHNKAPVWNS DTQSYVLNFR GRVTQASVKN FQIVHKNDPD
410 420 430 440
YIVMQFGRVA DDVFTLDYNY PLCAVQAFGI GLSSFDSKLA CE
Length:442
Mass (Da):49,642
Last modified:February 6, 2007 - v2
Checksum:i13DBC83305BFAC1D
GO
Isoform 2 (identifier: O75386-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     437-442: SKLACE → KCIQTLRMQELCELHRQHHSAASLVHRTVCQRWVGHPWRLLPQTSLLWTDLSPPPVVPAPHQISM

Note: No experimental confirmation available. Gene prediction based on EST data.

Show »
Length:501
Mass (Da):56,545
Checksum:i15F3B7C6A80F3ABA
GO
Isoform 3 (identifier: O75386-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-19: Missing.
     165-189: DTGTSGSATAAQPADNLLGDIDDLE → FSSFCQKTEDTGYRHFRFCYCRPTS
     190-442: Missing.

Note: No experimental confirmation available.

Show »
Length:170
Mass (Da):19,273
Checksum:i833707F24020C56E
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti168 – 18114TSGSA…PADNL → IPVLLLPPNQLITF in AAC95431. (PubMed:9828123)CuratedAdd
BLAST
Sequence conflicti187 – 1871D → Y in AAH32587. (PubMed:15489334)Curated
Sequence conflicti193 – 1942YS → LV in AAC95431. (PubMed:9828123)Curated
Sequence conflicti219 – 2268PTYYMYLE → SHLLYVLG in AAC95431. (PubMed:9828123)Curated
Sequence conflicti393 – 3931I → L in AAC95431. (PubMed:9828123)Curated
Sequence conflicti429 – 4313GIG → AIS in AAC95431. (PubMed:9828123)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1919Missing in isoform 3. 1 PublicationVSP_055761Add
BLAST
Alternative sequencei165 – 18925DTGTS…IDDLE → FSSFCQKTEDTGYRHFRFCY CRPTS in isoform 3. 1 PublicationVSP_055762Add
BLAST
Alternative sequencei190 – 442253Missing in isoform 3. 1 PublicationVSP_055763Add
BLAST
Alternative sequencei437 – 4426SKLACE → KCIQTLRMQELCELHRQHHS AASLVHRTVCQRWVGHPWRL LPQTSLLWTDLSPPPVVPAP HQISM in isoform 2. CuratedVSP_054752

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF045583 mRNA. Translation: AAC95431.1.
AK024246 mRNA. Translation: BAG51279.1.
AK299990 mRNA. Translation: BAH13188.1.
AC005911 Genomic DNA. No translation available.
CH471116 Genomic DNA. Translation: EAW88876.1.
CH471116 Genomic DNA. Translation: EAW88877.1.
CH471116 Genomic DNA. Translation: EAW88878.1.
BC032587 mRNA. Translation: AAH32587.1.
CCDSiCCDS53737.1. [O75386-2]
CCDS8519.1. [O75386-1]
RefSeqiNP_001153880.1. NM_001160408.1. [O75386-2]
NP_003315.2. NM_003324.4. [O75386-1]
UniGeneiHs.655333.

Genome annotation databases

EnsembliENST00000397132; ENSP00000380321; ENSG00000078246. [O75386-2]
ENST00000448120; ENSP00000410051; ENSG00000078246. [O75386-1]
ENST00000540184; ENSP00000444110; ENSG00000078246. [O75386-3]
GeneIDi7289.
KEGGihsa:7289.
UCSCiuc010seh.1. human. [O75386-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF045583 mRNA. Translation: AAC95431.1 .
AK024246 mRNA. Translation: BAG51279.1 .
AK299990 mRNA. Translation: BAH13188.1 .
AC005911 Genomic DNA. No translation available.
CH471116 Genomic DNA. Translation: EAW88876.1 .
CH471116 Genomic DNA. Translation: EAW88877.1 .
CH471116 Genomic DNA. Translation: EAW88878.1 .
BC032587 mRNA. Translation: AAH32587.1 .
CCDSi CCDS53737.1. [O75386-2 ]
CCDS8519.1. [O75386-1 ]
RefSeqi NP_001153880.1. NM_001160408.1. [O75386-2 ]
NP_003315.2. NM_003324.4. [O75386-1 ]
UniGenei Hs.655333.

3D structure databases

ProteinModelPortali O75386.
SMRi O75386. Positions 184-442.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 113140. 3 interactions.
IntActi O75386. 56 interactions.
STRINGi 9606.ENSP00000228245.

PTM databases

PhosphoSitei O75386.

Proteomic databases

MaxQBi O75386.
PaxDbi O75386.
PRIDEi O75386.

Protocols and materials databases

DNASUi 7289.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000397132 ; ENSP00000380321 ; ENSG00000078246 . [O75386-2 ]
ENST00000448120 ; ENSP00000410051 ; ENSG00000078246 . [O75386-1 ]
ENST00000540184 ; ENSP00000444110 ; ENSG00000078246 . [O75386-3 ]
GeneIDi 7289.
KEGGi hsa:7289.
UCSCi uc010seh.1. human. [O75386-1 ]

Organism-specific databases

CTDi 7289.
GeneCardsi GC12P002989.
HGNCi HGNC:12425. TULP3.
HPAi HPA015285.
HPA018496.
MIMi 604730. gene.
neXtProti NX_O75386.
PharmGKBi PA37087.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG286778.
GeneTreei ENSGT00610000085970.
HOGENOMi HOG000016044.
HOVERGENi HBG018010.
InParanoidi O75386.
OrthoDBi EOG7P8PC5.
PhylomeDBi O75386.

Miscellaneous databases

GenomeRNAii 7289.
NextBioi 28499.
PROi O75386.
SOURCEi Search...

Gene expression databases

Bgeei O75386.
CleanExi HS_TULP3.
ExpressionAtlasi O75386. baseline and differential.
Genevestigatori O75386.

Family and domain databases

Gene3Di 3.20.90.10. 1 hit.
InterProi IPR000007. Tubby_C.
IPR025659. Tubby_C-like.
IPR018066. Tubby_C_CS.
IPR005398. Tubby_N.
[Graphical view ]
Pfami PF01167. Tub. 1 hit.
[Graphical view ]
PRINTSi PR01573. SUPERTUBBY.
PR01574. TUBBYPROTEIN.
SUPFAMi SSF54518. SSF54518. 1 hit.
PROSITEi PS01200. TUB_1. 1 hit.
PS01201. TUB_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular characterization of a novel tubby gene family member, TULP3, in mouse and humans."
    Nishina P.M., North M.A., Ikeda A., Yan Y., Naggert J.K.
    Genomics 54:215-220(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
  3. "The finished DNA sequence of human chromosome 12."
    Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
    , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
    Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Eye.
  6. Cited for: FUNCTION IN G-PROTEIN SIGNALING, SUBCELLULAR LOCATION.
  7. "TULP3 bridges the IFT-A complex and membrane phosphoinositides to promote trafficking of G protein-coupled receptors into primary cilia."
    Mukhopadhyay S., Wen X., Chih B., Nelson C.D., Lane W.S., Scales S.J., Jackson P.K.
    Genes Dev. 24:2180-2193(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, ASSOCIATION WITH THE IFT-A COMPLEX, MUTAGENESIS OF 24-ARG--LEU-34 AND 268-LYS--ARG-270.

Entry informationi

Entry nameiTULP3_HUMAN
AccessioniPrimary (citable) accession number: O75386
Secondary accession number(s): B3KNB7
, B7Z6A2, D3DUQ4, F8WBZ9, Q8N5B0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: February 6, 2007
Last modified: October 29, 2014
This is version 109 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3