Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Breast carcinoma-amplified sequence 1

Gene

BCAS1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Enzyme and pathway databases

BioCyciZFISH:ENSG00000064787-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Breast carcinoma-amplified sequence 1
Alternative name(s):
Amplified and overexpressed in breast cancer
Novel amplified in breast cancer 1
Gene namesi
Name:BCAS1
Synonyms:AIBC1, NABC1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 20

Organism-specific databases

HGNCiHGNC:974. BCAS1.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: UniProtKB-SubCell
  • extracellular exosome Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi8537.
OpenTargetsiENSG00000064787.
PharmGKBiPA25284.

Polymorphism and mutation databases

BioMutaiBCAS1.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000648591 – 584Breast carcinoma-amplified sequence 1Add BLAST584

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei124PhosphoserineBy similarity1
Modified residuei192PhosphoserineBy similarity1
Modified residuei314PhosphoserineBy similarity1
Modified residuei381PhosphoserineBy similarity1
Modified residuei399PhosphoserineBy similarity1
Modified residuei480PhosphothreonineBy similarity1
Modified residuei552PhosphoserineBy similarity1
Isoform 2 (identifier: O75363-2)
Modified residuei340PhosphoserineCurated1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiO75363.
PaxDbiO75363.
PeptideAtlasiO75363.
PRIDEiO75363.

PTM databases

iPTMnetiO75363.
PhosphoSitePlusiO75363.

Expressioni

Tissue specificityi

Expressed in brain and prostate, and at lower levels in testis, intestine and colon. Overexpressed in most breast cancer cell lines and down-regulated in some colorectal tumors.2 Publications

Gene expression databases

BgeeiENSG00000064787.
CleanExiHS_BCAS1.
ExpressionAtlasiO75363. baseline and differential.
GenevisibleiO75363. HS.

Organism-specific databases

HPAiCAB033558.
HPA051816.
HPA054745.

Interactioni

Subunit structurei

Homodimer. May interact with DYNLL1 and DYNLL2 (By similarity).By similarity

Protein-protein interaction databases

BioGridi114107. 3 interactors.
STRINGi9606.ENSP00000379290.

Structurei

3D structure databases

ProteinModelPortaliO75363.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiENOG410IJ5W. Eukaryota.
ENOG41119UT. LUCA.
GeneTreeiENSGT00390000003167.
HOGENOMiHOG000232037.
HOVERGENiHBG082347.
InParanoidiO75363.
OMAiTQGAAKN.
OrthoDBiEOG091G07RJ.
PhylomeDBiO75363.
TreeFamiTF335555.

Family and domain databases

InterProiIPR026115. NABC1.
[Graphical view]
PANTHERiPTHR15016. PTHR15016. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O75363-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGNQMSVPQR VEDQENEPEA ETYQDNASAL NGVPVVVSTH TVQHLEEVDL
60 70 80 90 100
GISVKTDNVA TSSPETTEIS AVADANGKNL GKEAKPEAPA AKSRFFLMLS
110 120 130 140 150
RPVPGRTGDQ AADSSLGSVK LDVSSNKAPA NKDPSESWTL PVAAGPGQDT
160 170 180 190 200
DKTPGHAPAQ DKVLSAARDP TLLPPETGGA GGEAPSKPKD SSFFDKFFKL
210 220 230 240 250
DKGQEKVPGD SQQEAKRAEH QDKVDEVPGL SGQSDDVPAG KDIVDGKEKE
260 270 280 290 300
GQELGTADCS VPGDPEGLET AKDDSQAAAI AENNNSIMSF FKTLVSPNKA
310 320 330 340 350
ETKKDPEDTG AEKSPTTSAD LKSDKANFTS QETQGAGKNS KGCNPSGHTQ
360 370 380 390 400
SVTTPEPAKE GTKEKSGPTS LPLGKLFWKK SVKEDSVPTG AEENVVCESP
410 420 430 440 450
VEIIKSKEVE SALQTVDLNE GDAAPEPTEA KLKREESKPR TSLMAFLRQM
460 470 480 490 500
SVKGDGGITH SEEINGKDSS CQTSDSTEKT ITPPEPEPTG APQKGKEGSS
510 520 530 540 550
KDKKSAAEMN KQKSNKQEAK EPAQCTEQAT VDTNSLQNGD KLQKRPEKRQ
560 570 580
QSLGGFFKGL GPKRMLDAQV QTDPVSIGPV GKSK
Length:584
Mass (Da):61,709
Last modified:June 13, 2006 - v2
Checksum:i22921C0B37129944
GO
Isoform 2 (identifier: O75363-2) [UniParc]FASTAAdd to basket
Also known as: 5B

The sequence of this isoform differs from the canonical sequence as follows:
     309-309: T → TASKAESVCDGQAGQKTSEIQARGTKKKHLDSPRLGLAFRKFFRHK
     381-394: Missing.
     451-472: Missing.
     584-584: K → KYTGKCVFSHVKKKWPFQEWSY

Show »
Length:614
Mass (Da):65,663
Checksum:iDA05CD7CEB86C170
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti361G → D in CAH18437 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02667424Q → K.Corresponds to variant rs394732dbSNPEnsembl.1
Natural variantiVAR_026675163V → A.Corresponds to variant rs158551dbSNPEnsembl.1
Natural variantiVAR_024251255G → E.Corresponds to variant rs6022903dbSNPEnsembl.1
Natural variantiVAR_050691472Q → H.Corresponds to variant rs35575210dbSNPEnsembl.1
Natural variantiVAR_026676583S → P.1 PublicationCorresponds to variant rs1055246dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_018520309T → TASKAESVCDGQAGQKTSEI QARGTKKKHLDSPRLGLAFR KFFRHK in isoform 2. 2 Publications1
Alternative sequenceiVSP_018521381 – 394Missing in isoform 2. 2 PublicationsAdd BLAST14
Alternative sequenceiVSP_018522451 – 472Missing in isoform 2. 2 PublicationsAdd BLAST22
Alternative sequenceiVSP_018523584K → KYTGKCVFSHVKKKWPFQEW SY in isoform 2. 2 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF041260 mRNA. Translation: AAC39896.1.
AC004501 Genomic DNA. No translation available.
AC005220 Genomic DNA. No translation available.
BC126346 mRNA. Translation: AAI26347.1.
AI904532 mRNA. No translation available.
CR749643 mRNA. Translation: CAH18437.1.
CCDSiCCDS13444.1. [O75363-1]
RefSeqiNP_003648.2. NM_003657.3. [O75363-1]
UniGeneiHs.400556.

Genome annotation databases

EnsembliENST00000395961; ENSP00000379290; ENSG00000064787. [O75363-1]
GeneIDi8537.
KEGGihsa:8537.
UCSCiuc002xws.3. human. [O75363-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF041260 mRNA. Translation: AAC39896.1.
AC004501 Genomic DNA. No translation available.
AC005220 Genomic DNA. No translation available.
BC126346 mRNA. Translation: AAI26347.1.
AI904532 mRNA. No translation available.
CR749643 mRNA. Translation: CAH18437.1.
CCDSiCCDS13444.1. [O75363-1]
RefSeqiNP_003648.2. NM_003657.3. [O75363-1]
UniGeneiHs.400556.

3D structure databases

ProteinModelPortaliO75363.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114107. 3 interactors.
STRINGi9606.ENSP00000379290.

PTM databases

iPTMnetiO75363.
PhosphoSitePlusiO75363.

Polymorphism and mutation databases

BioMutaiBCAS1.

Proteomic databases

MaxQBiO75363.
PaxDbiO75363.
PeptideAtlasiO75363.
PRIDEiO75363.

Protocols and materials databases

DNASUi8537.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000395961; ENSP00000379290; ENSG00000064787. [O75363-1]
GeneIDi8537.
KEGGihsa:8537.
UCSCiuc002xws.3. human. [O75363-1]

Organism-specific databases

CTDi8537.
DisGeNETi8537.
GeneCardsiBCAS1.
H-InvDBHIX0015925.
HGNCiHGNC:974. BCAS1.
HPAiCAB033558.
HPA051816.
HPA054745.
MIMi602968. gene.
neXtProtiNX_O75363.
OpenTargetsiENSG00000064787.
PharmGKBiPA25284.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IJ5W. Eukaryota.
ENOG41119UT. LUCA.
GeneTreeiENSGT00390000003167.
HOGENOMiHOG000232037.
HOVERGENiHBG082347.
InParanoidiO75363.
OMAiTQGAAKN.
OrthoDBiEOG091G07RJ.
PhylomeDBiO75363.
TreeFamiTF335555.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000064787-MONOMER.

Miscellaneous databases

ChiTaRSiBCAS1. human.
GeneWikiiBCAS1.
GenomeRNAii8537.
PROiO75363.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000064787.
CleanExiHS_BCAS1.
ExpressionAtlasiO75363. baseline and differential.
GenevisibleiO75363. HS.

Family and domain databases

InterProiIPR026115. NABC1.
[Graphical view]
PANTHERiPTHR15016. PTHR15016. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiBCAS1_HUMAN
AccessioniPrimary (citable) accession number: O75363
Secondary accession number(s): A0AVG5, Q68CZ3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 24, 2001
Last sequence update: June 13, 2006
Last modified: November 2, 2016
This is version 125 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.