O75363 (BCAS1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 84.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Breast carcinoma-amplified sequence 1 Alternative name(s): Amplified and overexpressed in breast cancer Novel amplified in breast cancer 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 584 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subunit structure | Homodimer. May interact with DYNLL1 and DYNLL2 By similarity. Ref.6 |
| Subcellular location | |
| Tissue specificity | Expressed in brain and prostate, and at lower levels in testis, intestine and colon. Overexpressed in most breast cancer cell lines and down-regulated in some colorectal tumors. Ref.4 Ref.6 |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O75363-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O75363-2) Also known as: 5B; The sequence of this isoform differs from the canonical sequence as follows: 309-309: T → TASKAESVCDGQAGQKTSEIQARGTKKKHLDSPRLGLAFRKFFRHK 381-394: Missing. 451-472: Missing. 584-584: K → KYTGKCVFSHVKKKWPFQEWSY | ||||||
| Note: Phosphorylated on Ser-340 (Probable). |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 584 | 584 | Breast carcinoma-amplified sequence 1 | PRO_0000064859 | |||||
Amino acid modifications | |||||||||
| Modified residue | 552 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 309 | 1 | T → TASKAESVCDGQAGQKTSEI QARGTKKKHLDSPRLGLAFR KFFRHK in isoform 2. | VSP_018520 | |||||
| Alternative sequence | 381 – 394 | 14 | Missing in isoform 2. | VSP_018521 | |||||
| Alternative sequence | 451 – 472 | 22 | Missing in isoform 2. | VSP_018522 | |||||
| Alternative sequence | 584 | 1 | K → KYTGKCVFSHVKKKWPFQEW SY in isoform 2. | VSP_018523 | |||||
| Natural variant | 24 | 1 | Q → K. Corresponds to variant rs394732 [ dbSNP | Ensembl ]. | VAR_026674 | |||||
| Natural variant | 163 | 1 | V → A. Corresponds to variant rs158551 [ dbSNP | Ensembl ]. | VAR_026675 | |||||
| Natural variant | 255 | 1 | G → E. Corresponds to variant rs6022903 [ dbSNP | Ensembl ]. | VAR_024251 | |||||
| Natural variant | 472 | 1 | Q → H. Corresponds to variant rs35575210 [ dbSNP | Ensembl ]. | VAR_050691 | |||||
| Natural variant | 583 | 1 | S → P. Ref.1 Corresponds to variant rs1055246 [ dbSNP | Ensembl ]. | VAR_026676 | |||||
Experimental info | |||||||||
| Sequence conflict | 361 | 1 | G → D in CAH18437. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF041260 mRNA. Translation: AAC39896.1. AC004501 Genomic DNA. No translation available. AC005220 Genomic DNA. No translation available. BC126346 mRNA. Translation: AAI26347.1. AI904532 mRNA. No translation available. CR749643 mRNA. Translation: CAH18437.1. |
| IPI | IPI00025311. IPI00744780. |
| RefSeq | NP_003648.2. NM_003657.2. |
| UniGene | Hs.728940. |
3D structure databases | |
| ProteinModelPortal | O75363. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | O75363. |
PTM databases | |
| PhosphoSite | O75363. |
Proteomic databases | |
| PRIDE | O75363. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000395961; ENSP00000379290; ENSG00000064787. |
| GeneID | 8537. |
| KEGG | hsa:8537. |
| NMPDR | fig|9606.3.peg.20494. |
| UCSC | uc002xws.2. human. uc010gim.1. human. |
Organism-specific databases | |
| CTD | 8537. |
| GeneCards | GC20M052553. |
| H-InvDB | HIX0015925. |
| HGNC | HGNC:974. BCAS1. |
| HPA | CAB033558. |
| MIM | 602968. gene. |
| neXtProt | NX_O75363. |
| PharmGKB | PA25284. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG17630. |
| GeneTree | ENSGT00390000003167. |
| HOVERGEN | HBG082347. |
| OMA | DKLFKLD. |
| OrthoDB | EOG46143P. |
| PhylomeDB | O75363. |
Gene expression databases | |
| ArrayExpress | O75363. |
| Bgee | O75363. |
| CleanEx | HS_BCAS1. |
| Genevestigator | O75363. |
| GermOnline | ENSG00000064787. Homo sapiens. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| NextBio | 31976. |
| SOURCE | Search... |
Entry information
| Entry name | BCAS1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O75363 Secondary accession number(s): A0AVG5, Q68CZ3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |

Clusters with