Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tubulin-specific chaperone A

Gene

TBCA

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Tubulin-folding protein; involved in the early step of the tubulin folding pathway.

GO - Molecular functioni

  • chaperone binding Source: ProtInc
  • poly(A) RNA binding Source: UniProtKB

GO - Biological processi

  • post-chaperonin tubulin folding pathway Source: ProtInc
  • protein folding Source: UniProtKB
  • tubulin complex assembly Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Chaperone

Enzyme and pathway databases

ReactomeiR-HSA-389977. Post-chaperonin tubulin folding pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
Tubulin-specific chaperone A
Alternative name(s):
TCP1-chaperonin cofactor A
Tubulin-folding cofactor A
Short name:
CFA
Gene namesi
Name:TBCA
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:11579. TBCA.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • extracellular exosome Source: UniProtKB
  • microtubule Source: UniProtKB-KW
  • microtubule cytoskeleton Source: HPA
  • nucleolus Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA36343.

Polymorphism and mutation databases

BioMutaiTBCA.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methionineiRemovedBy similarity
Chaini2 – 108107Tubulin-specific chaperone APRO_0000080039Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylalanineBy similarity

Keywords - PTMi

Acetylation

Proteomic databases

EPDiO75347.
MaxQBiO75347.
PaxDbiO75347.
PeptideAtlasiO75347.
PRIDEiO75347.
TopDownProteomicsiO75347-1. [O75347-1]

2D gel databases

OGPiO75347.
SWISS-2DPAGEO75347.

PTM databases

iPTMnetiO75347.
PhosphoSiteiO75347.

Expressioni

Gene expression databases

BgeeiENSG00000171530.
CleanExiHS_TBCA.
ExpressionAtlasiO75347. baseline and differential.
GenevisibleiO75347. HS.

Organism-specific databases

HPAiHPA036487.

Interactioni

Subunit structurei

Supercomplex made of cofactors A to E. Cofactors A and D function by capturing and stabilizing tubulin in a quasi-native conformation. Cofactor E binds to the cofactor D-tubulin complex; interaction with cofactor C then causes the release of tubulin polypeptides that are committed to the native state.

Binary interactionsi

WithEntry#Exp.IntActNotes
TERF2IPQ9NYB02EBI-2686341,EBI-750109

GO - Molecular functioni

  • chaperone binding Source: ProtInc

Protein-protein interaction databases

BioGridi112765. 13 interactions.
IntActiO75347. 5 interactions.
STRINGi9606.ENSP00000369736.

Structurei

Secondary structure

1
108
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi5 – 4440Combined sources
Helixi49 – 6113Combined sources
Helixi64 – 8421Combined sources
Helixi86 – 883Combined sources
Helixi92 – 10514Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1H7CX-ray1.80A2-108[»]
ProteinModelPortaliO75347.
SMRiO75347. Positions 4-106.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO75347.

Family & Domainsi

Sequence similaritiesi

Belongs to the TBCA family.Curated

Phylogenomic databases

eggNOGiKOG3470. Eukaryota.
ENOG4111Y9A. LUCA.
GeneTreeiENSGT00390000009710.
HOGENOMiHOG000213817.
HOVERGENiHBG004499.
InParanoidiO75347.
KOiK17292.
PhylomeDBiO75347.
TreeFamiTF313971.

Family and domain databases

InterProiIPR004226. TBCA.
[Graphical view]
PANTHERiPTHR21500:SF0. PTHR21500:SF0. 1 hit.
PfamiPF02970. TBCA. 1 hit.
[Graphical view]
ProDomiPD010430. CofA_tubulin_bd. 1 hit.
[Graphical view] [Entries sharing at least one domain]
SUPFAMiSSF46988. SSF46988. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O75347-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MADPRVRQIK IKTGVVKRLV KEKVMYEKEA KQQEEKIEKM RAEDGENYDI
60 70 80 90 100
KKQAEILQES RMMIPDCQRR LEAAYLDLQR ILENEKDLEE AEEYKEARLV

LDSVKLEA
Length:108
Mass (Da):12,855
Last modified:January 23, 2007 - v3
Checksum:i222D8D945A5CD162
GO
Isoform 2 (identifier: O75347-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     83-108: ENEKDLEEAEEYKEARLVLDSVKLEA → VSKDFCVMFKFFFSIQYMESQKFKYLTLRTSWQYFLFTCPLYRYILK

Note: No experimental confirmation available.
Show »
Length:129
Mass (Da):15,792
Checksum:iA8BEFA6213E7F786
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei83 – 10826ENEKD…VKLEA → VSKDFCVMFKFFFSIQYMES QKFKYLTLRTSWQYFLFTCP LYRYILK in isoform 2. 1 PublicationVSP_056357Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF038952 mRNA. Translation: AAC39866.1.
BT007354 mRNA. Translation: AAP36018.1.
AK300031 mRNA. Translation: BAG61842.1.
AC026717 Genomic DNA. No translation available.
AC035147 Genomic DNA. No translation available.
AC108482 Genomic DNA. No translation available.
BC018210 mRNA. Translation: AAH18210.1.
CCDSiCCDS4040.1. [O75347-1]
CCDS75263.1. [O75347-2]
RefSeqiNP_001284667.1. NM_001297738.1. [O75347-2]
NP_004598.1. NM_004607.2. [O75347-1]
UniGeneiHs.291212.
Hs.661401.

Genome annotation databases

EnsembliENST00000306388; ENSP00000306362; ENSG00000171530. [O75347-2]
ENST00000380377; ENSP00000369736; ENSG00000171530. [O75347-1]
GeneIDi6902.
KEGGihsa:6902.
UCSCiuc003kfi.2. human. [O75347-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF038952 mRNA. Translation: AAC39866.1.
BT007354 mRNA. Translation: AAP36018.1.
AK300031 mRNA. Translation: BAG61842.1.
AC026717 Genomic DNA. No translation available.
AC035147 Genomic DNA. No translation available.
AC108482 Genomic DNA. No translation available.
BC018210 mRNA. Translation: AAH18210.1.
CCDSiCCDS4040.1. [O75347-1]
CCDS75263.1. [O75347-2]
RefSeqiNP_001284667.1. NM_001297738.1. [O75347-2]
NP_004598.1. NM_004607.2. [O75347-1]
UniGeneiHs.291212.
Hs.661401.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1H7CX-ray1.80A2-108[»]
ProteinModelPortaliO75347.
SMRiO75347. Positions 4-106.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112765. 13 interactions.
IntActiO75347. 5 interactions.
STRINGi9606.ENSP00000369736.

PTM databases

iPTMnetiO75347.
PhosphoSiteiO75347.

Polymorphism and mutation databases

BioMutaiTBCA.

2D gel databases

OGPiO75347.
SWISS-2DPAGEO75347.

Proteomic databases

EPDiO75347.
MaxQBiO75347.
PaxDbiO75347.
PeptideAtlasiO75347.
PRIDEiO75347.
TopDownProteomicsiO75347-1. [O75347-1]

Protocols and materials databases

DNASUi6902.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000306388; ENSP00000306362; ENSG00000171530. [O75347-2]
ENST00000380377; ENSP00000369736; ENSG00000171530. [O75347-1]
GeneIDi6902.
KEGGihsa:6902.
UCSCiuc003kfi.2. human. [O75347-1]

Organism-specific databases

CTDi6902.
GeneCardsiTBCA.
HGNCiHGNC:11579. TBCA.
HPAiHPA036487.
MIMi610058. gene.
neXtProtiNX_O75347.
PharmGKBiPA36343.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3470. Eukaryota.
ENOG4111Y9A. LUCA.
GeneTreeiENSGT00390000009710.
HOGENOMiHOG000213817.
HOVERGENiHBG004499.
InParanoidiO75347.
KOiK17292.
PhylomeDBiO75347.
TreeFamiTF313971.

Enzyme and pathway databases

ReactomeiR-HSA-389977. Post-chaperonin tubulin folding pathway.

Miscellaneous databases

EvolutionaryTraceiO75347.
GeneWikiiTBCA.
GenomeRNAii6902.
PROiO75347.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000171530.
CleanExiHS_TBCA.
ExpressionAtlasiO75347. baseline and differential.
GenevisibleiO75347. HS.

Family and domain databases

InterProiIPR004226. TBCA.
[Graphical view]
PANTHERiPTHR21500:SF0. PTHR21500:SF0. 1 hit.
PfamiPF02970. TBCA. 1 hit.
[Graphical view]
ProDomiPD010430. CofA_tubulin_bd. 1 hit.
[Graphical view] [Entries sharing at least one domain]
SUPFAMiSSF46988. SSF46988. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiTBCA_HUMAN
AccessioniPrimary (citable) accession number: O75347
Secondary accession number(s): B4DT30
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: January 23, 2007
Last modified: September 7, 2016
This is version 143 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.