Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O75323

- NIPS2_HUMAN

UniProt

O75323 - NIPS2_HUMAN

Protein

Protein NipSnap homolog 2

Gene

GBAS

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 118 (01 Oct 2014)
      Sequence version 1 (01 Nov 1998)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Molecular functioni

    1. protein binding Source: IntAct

    GO - Biological processi

    1. ATP biosynthetic process Source: BHF-UCL
    2. negative regulation of ATP citrate synthase activity Source: BHF-UCL
    3. oxidative phosphorylation Source: BHF-UCL

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protein NipSnap homolog 2
    Short name:
    NipSnap2
    Alternative name(s):
    Glioblastoma-amplified sequence
    Gene namesi
    Name:GBAS
    Synonyms:NIPSNAP2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 7

    Organism-specific databases

    HGNCiHGNC:4179. GBAS.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of plasma membrane Source: ProtInc
    2. membrane Source: ProtInc
    3. mitochondrion Source: UniProtKB

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA28593.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 286286Protein NipSnap homolog 2PRO_0000221148Add
    BLAST

    Proteomic databases

    MaxQBiO75323.
    PaxDbiO75323.
    PeptideAtlasiO75323.
    PRIDEiO75323.

    2D gel databases

    UCD-2DPAGEO75323.

    PTM databases

    PhosphoSiteiO75323.

    Expressioni

    Tissue specificityi

    Widely expressed. Most abundant in heart and skeletal muscle.

    Gene expression databases

    ArrayExpressiO75323.
    BgeeiO75323.
    CleanExiHS_GBAS.
    GenevestigatoriO75323.

    Interactioni

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    GABARAPO951665EBI-307133,EBI-712001
    GABARAPL1Q9H0R86EBI-307133,EBI-746969
    GABARAPL2P605206EBI-307133,EBI-720116
    MAP1LC3BQ9GZQ84EBI-307133,EBI-373144
    MAP1LC3CQ9BXW42EBI-307133,EBI-2603996

    Protein-protein interaction databases

    BioGridi108901. 38 interactions.
    IntActiO75323. 36 interactions.
    MINTiMINT-5003890.
    STRINGi9606.ENSP00000313050.

    Structurei

    3D structure databases

    ProteinModelPortaliO75323.
    SMRiO75323. Positions 186-286.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the NipSnap family.Curated

    Phylogenomic databases

    eggNOGiNOG09022.
    HOGENOMiHOG000194298.
    HOVERGENiHBG052627.
    InParanoidiO75323.
    OMAiIMIPLKT.
    PhylomeDBiO75323.
    TreeFamiTF314501.

    Family and domain databases

    InterProiIPR011008. Dimeric_a/b-barrel.
    IPR012577. NIPSNAP.
    [Graphical view]
    PfamiPF07978. NIPSNAP. 1 hit.
    [Graphical view]
    SUPFAMiSSF54909. SSF54909. 2 hits.

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O75323-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAARVLRARG AAWAGGLLQR AAPCSLLPRL RTWTSSSNRS REDSWLKSLF    50
    VRKVDPRKDA HSNLLAKKET SNLYKLQFHN VKPECLEAYN KICQEVLPKI 100
    HEDKHYPCTL VGTWNTWYGE QDQAVHLWRY EGGYPALTEV MNKLRENKEF 150
    LEFRKARSDM LLSRKNQLLL EFSFWNEPVP RSGPNIYELR SYQLRPGTMI 200
    EWGNYWARAI RFRQDGNEAV GGFFSQIGQL YMVHHLWAYR DLQTREDIRN 250
    AAWHKHGWEE LVYYTVPLIQ EMESRIMIPL KTSPLQ 286
    Length:286
    Mass (Da):33,743
    Last modified:November 1, 1998 - v1
    Checksum:i7ED85297E4DC9D08
    GO
    Isoform 2 (identifier: O75323-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         79-148: HNVKPECLEA...EVMNKLRENK → KRCCQRFTKINTTLVLWWGLGTRGMASRTKL

    Note: No experimental confirmation available.

    Show »
    Length:247
    Mass (Da):29,053
    Checksum:iE35362CADF3127B0
    GO

    Sequence cautioni

    The sequence CAA04633.1 differs from that shown. Reason: Frameshift at positions 8, 11 and 17.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti12 – 121A → P in CAA04633. (PubMed:9661659)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei79 – 14870HNVKP…LRENK → KRCCQRFTKINTTLVLWWGL GTRGMASRTKL in isoform 2. 1 PublicationVSP_044708Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF029786 mRNA. Translation: AAC29002.1.
    AJ001259 mRNA. Translation: CAA04633.1. Frameshift.
    BT007112 mRNA. Translation: AAP35776.1.
    AK097049 mRNA. No translation available.
    CR407612 mRNA. Translation: CAG28540.1.
    AC092579 Genomic DNA. No translation available.
    CH471140 Genomic DNA. Translation: EAX07966.1.
    CH471140 Genomic DNA. Translation: EAX07967.1.
    BC000732 mRNA. Translation: AAH00732.1.
    BC001837 mRNA. Translation: AAH01837.1.
    BC030821 mRNA. Translation: AAH30821.1.
    CCDSiCCDS5521.1. [O75323-1]
    CCDS56488.1. [O75323-2]
    RefSeqiNP_001189398.1. NM_001202469.1. [O75323-2]
    NP_001474.1. NM_001483.2. [O75323-1]
    UniGeneiHs.591069.

    Genome annotation databases

    EnsembliENST00000322090; ENSP00000313050; ENSG00000146729. [O75323-1]
    ENST00000446778; ENSP00000406855; ENSG00000146729. [O75323-2]
    GeneIDi2631.
    KEGGihsa:2631.
    UCSCiuc003tre.2. human. [O75323-1]
    uc003trf.2. human.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF029786 mRNA. Translation: AAC29002.1 .
    AJ001259 mRNA. Translation: CAA04633.1 . Frameshift.
    BT007112 mRNA. Translation: AAP35776.1 .
    AK097049 mRNA. No translation available.
    CR407612 mRNA. Translation: CAG28540.1 .
    AC092579 Genomic DNA. No translation available.
    CH471140 Genomic DNA. Translation: EAX07966.1 .
    CH471140 Genomic DNA. Translation: EAX07967.1 .
    BC000732 mRNA. Translation: AAH00732.1 .
    BC001837 mRNA. Translation: AAH01837.1 .
    BC030821 mRNA. Translation: AAH30821.1 .
    CCDSi CCDS5521.1. [O75323-1 ]
    CCDS56488.1. [O75323-2 ]
    RefSeqi NP_001189398.1. NM_001202469.1. [O75323-2 ]
    NP_001474.1. NM_001483.2. [O75323-1 ]
    UniGenei Hs.591069.

    3D structure databases

    ProteinModelPortali O75323.
    SMRi O75323. Positions 186-286.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 108901. 38 interactions.
    IntActi O75323. 36 interactions.
    MINTi MINT-5003890.
    STRINGi 9606.ENSP00000313050.

    PTM databases

    PhosphoSitei O75323.

    2D gel databases

    UCD-2DPAGE O75323.

    Proteomic databases

    MaxQBi O75323.
    PaxDbi O75323.
    PeptideAtlasi O75323.
    PRIDEi O75323.

    Protocols and materials databases

    DNASUi 2631.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000322090 ; ENSP00000313050 ; ENSG00000146729 . [O75323-1 ]
    ENST00000446778 ; ENSP00000406855 ; ENSG00000146729 . [O75323-2 ]
    GeneIDi 2631.
    KEGGi hsa:2631.
    UCSCi uc003tre.2. human. [O75323-1 ]
    uc003trf.2. human.

    Organism-specific databases

    CTDi 2631.
    GeneCardsi GC07P056020.
    HGNCi HGNC:4179. GBAS.
    MIMi 603004. gene.
    neXtProti NX_O75323.
    PharmGKBi PA28593.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG09022.
    HOGENOMi HOG000194298.
    HOVERGENi HBG052627.
    InParanoidi O75323.
    OMAi IMIPLKT.
    PhylomeDBi O75323.
    TreeFami TF314501.

    Miscellaneous databases

    GeneWikii GBAS_(gene).
    GenomeRNAii 2631.
    NextBioi 10372.
    PROi O75323.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O75323.
    Bgeei O75323.
    CleanExi HS_GBAS.
    Genevestigatori O75323.

    Family and domain databases

    InterProi IPR011008. Dimeric_a/b-barrel.
    IPR012577. NIPSNAP.
    [Graphical view ]
    Pfami PF07978. NIPSNAP. 1 hit.
    [Graphical view ]
    SUPFAMi SSF54909. SSF54909. 2 hits.
    ProtoNeti Search...

    Publicationsi

    1. "GBAS, a novel gene encoding a protein with tyrosine phosphorylation sites and a transmembrane domain, is co-amplified with EGFR."
      Wang X.-Y., Smith D.I., Liu W., James C.D.
      Genomics 49:448-451(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "Characterization of the human NIPSNAP1 gene from 22q12: a member of a novel gene family."
      Seroussi E., Pan H.Q., Kedra D., Roe B.A., Dumanski J.P.
      Gene 212:13-20(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    3. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
      Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
      Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Small intestine.
    5. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
      Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
      Submitted (MAY-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    6. "The DNA sequence of human chromosome 7."
      Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
      , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
      Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Colon and Lung.
    9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiNIPS2_HUMAN
    AccessioniPrimary (citable) accession number: O75323
    Secondary accession number(s): C9IYJ3, O43801, Q53X96
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 26, 2001
    Last sequence update: November 1, 1998
    Last modified: October 1, 2014
    This is version 118 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 7
      Human chromosome 7: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3