SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O75323

- NIPS2_HUMAN

UniProt

O75323 - NIPS2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Protein NipSnap homolog 2
Gene
GBAS, NIPSNAP2
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  1. protein binding Source: IntAct

GO - Biological processi

  1. ATP biosynthetic process Source: BHF-UCL
  2. negative regulation of ATP citrate synthase activity Source: BHF-UCL
  3. oxidative phosphorylation Source: BHF-UCL
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Protein NipSnap homolog 2
Short name:
NipSnap2
Alternative name(s):
Glioblastoma-amplified sequence
Gene namesi
Name:GBAS
Synonyms:NIPSNAP2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 7

Organism-specific databases

HGNCiHGNC:4179. GBAS.

Subcellular locationi

GO - Cellular componenti

  1. integral component of plasma membrane Source: ProtInc
  2. membrane Source: ProtInc
  3. mitochondrion Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA28593.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 286286Protein NipSnap homolog 2
PRO_0000221148Add
BLAST

Proteomic databases

MaxQBiO75323.
PaxDbiO75323.
PeptideAtlasiO75323.
PRIDEiO75323.

2D gel databases

UCD-2DPAGEO75323.

PTM databases

PhosphoSiteiO75323.

Expressioni

Tissue specificityi

Widely expressed. Most abundant in heart and skeletal muscle.

Gene expression databases

ArrayExpressiO75323.
BgeeiO75323.
CleanExiHS_GBAS.
GenevestigatoriO75323.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
GABARAPO951665EBI-307133,EBI-712001
GABARAPL1Q9H0R86EBI-307133,EBI-746969
GABARAPL2P605206EBI-307133,EBI-720116
MAP1LC3BQ9GZQ84EBI-307133,EBI-373144
MAP1LC3CQ9BXW42EBI-307133,EBI-2603996

Protein-protein interaction databases

BioGridi108901. 38 interactions.
IntActiO75323. 36 interactions.
MINTiMINT-5003890.
STRINGi9606.ENSP00000313050.

Structurei

3D structure databases

ProteinModelPortaliO75323.
SMRiO75323. Positions 186-286.

Family & Domainsi

Sequence similaritiesi

Belongs to the NipSnap family.

Phylogenomic databases

eggNOGiNOG09022.
HOGENOMiHOG000194298.
HOVERGENiHBG052627.
InParanoidiO75323.
OMAiIMIPLKT.
PhylomeDBiO75323.
TreeFamiTF314501.

Family and domain databases

InterProiIPR011008. Dimeric_a/b-barrel.
IPR012577. NIPSNAP.
[Graphical view]
PfamiPF07978. NIPSNAP. 1 hit.
[Graphical view]
SUPFAMiSSF54909. SSF54909. 2 hits.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O75323-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAARVLRARG AAWAGGLLQR AAPCSLLPRL RTWTSSSNRS REDSWLKSLF    50
VRKVDPRKDA HSNLLAKKET SNLYKLQFHN VKPECLEAYN KICQEVLPKI 100
HEDKHYPCTL VGTWNTWYGE QDQAVHLWRY EGGYPALTEV MNKLRENKEF 150
LEFRKARSDM LLSRKNQLLL EFSFWNEPVP RSGPNIYELR SYQLRPGTMI 200
EWGNYWARAI RFRQDGNEAV GGFFSQIGQL YMVHHLWAYR DLQTREDIRN 250
AAWHKHGWEE LVYYTVPLIQ EMESRIMIPL KTSPLQ 286
Length:286
Mass (Da):33,743
Last modified:November 1, 1998 - v1
Checksum:i7ED85297E4DC9D08
GO
Isoform 2 (identifier: O75323-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     79-148: HNVKPECLEA...EVMNKLRENK → KRCCQRFTKINTTLVLWWGLGTRGMASRTKL

Note: No experimental confirmation available.

Show »
Length:247
Mass (Da):29,053
Checksum:iE35362CADF3127B0
GO

Sequence cautioni

The sequence CAA04633.1 differs from that shown. Reason: Frameshift at positions 8, 11 and 17.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei79 – 14870HNVKP…LRENK → KRCCQRFTKINTTLVLWWGL GTRGMASRTKL in isoform 2.
VSP_044708Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti12 – 121A → P in CAA04633. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF029786 mRNA. Translation: AAC29002.1.
AJ001259 mRNA. Translation: CAA04633.1. Frameshift.
BT007112 mRNA. Translation: AAP35776.1.
AK097049 mRNA. No translation available.
CR407612 mRNA. Translation: CAG28540.1.
AC092579 Genomic DNA. No translation available.
CH471140 Genomic DNA. Translation: EAX07966.1.
CH471140 Genomic DNA. Translation: EAX07967.1.
BC000732 mRNA. Translation: AAH00732.1.
BC001837 mRNA. Translation: AAH01837.1.
BC030821 mRNA. Translation: AAH30821.1.
CCDSiCCDS5521.1. [O75323-1]
CCDS56488.1. [O75323-2]
RefSeqiNP_001189398.1. NM_001202469.1. [O75323-2]
NP_001474.1. NM_001483.2. [O75323-1]
UniGeneiHs.591069.

Genome annotation databases

EnsembliENST00000322090; ENSP00000313050; ENSG00000146729. [O75323-1]
ENST00000446778; ENSP00000406855; ENSG00000146729. [O75323-2]
GeneIDi2631.
KEGGihsa:2631.
UCSCiuc003tre.2. human. [O75323-1]
uc003trf.2. human.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF029786 mRNA. Translation: AAC29002.1 .
AJ001259 mRNA. Translation: CAA04633.1 . Frameshift.
BT007112 mRNA. Translation: AAP35776.1 .
AK097049 mRNA. No translation available.
CR407612 mRNA. Translation: CAG28540.1 .
AC092579 Genomic DNA. No translation available.
CH471140 Genomic DNA. Translation: EAX07966.1 .
CH471140 Genomic DNA. Translation: EAX07967.1 .
BC000732 mRNA. Translation: AAH00732.1 .
BC001837 mRNA. Translation: AAH01837.1 .
BC030821 mRNA. Translation: AAH30821.1 .
CCDSi CCDS5521.1. [O75323-1 ]
CCDS56488.1. [O75323-2 ]
RefSeqi NP_001189398.1. NM_001202469.1. [O75323-2 ]
NP_001474.1. NM_001483.2. [O75323-1 ]
UniGenei Hs.591069.

3D structure databases

ProteinModelPortali O75323.
SMRi O75323. Positions 186-286.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 108901. 38 interactions.
IntActi O75323. 36 interactions.
MINTi MINT-5003890.
STRINGi 9606.ENSP00000313050.

PTM databases

PhosphoSitei O75323.

2D gel databases

UCD-2DPAGE O75323.

Proteomic databases

MaxQBi O75323.
PaxDbi O75323.
PeptideAtlasi O75323.
PRIDEi O75323.

Protocols and materials databases

DNASUi 2631.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000322090 ; ENSP00000313050 ; ENSG00000146729 . [O75323-1 ]
ENST00000446778 ; ENSP00000406855 ; ENSG00000146729 . [O75323-2 ]
GeneIDi 2631.
KEGGi hsa:2631.
UCSCi uc003tre.2. human. [O75323-1 ]
uc003trf.2. human.

Organism-specific databases

CTDi 2631.
GeneCardsi GC07P056020.
HGNCi HGNC:4179. GBAS.
MIMi 603004. gene.
neXtProti NX_O75323.
PharmGKBi PA28593.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG09022.
HOGENOMi HOG000194298.
HOVERGENi HBG052627.
InParanoidi O75323.
OMAi IMIPLKT.
PhylomeDBi O75323.
TreeFami TF314501.

Miscellaneous databases

GeneWikii GBAS_(gene).
GenomeRNAii 2631.
NextBioi 10372.
PROi O75323.
SOURCEi Search...

Gene expression databases

ArrayExpressi O75323.
Bgeei O75323.
CleanExi HS_GBAS.
Genevestigatori O75323.

Family and domain databases

InterProi IPR011008. Dimeric_a/b-barrel.
IPR012577. NIPSNAP.
[Graphical view ]
Pfami PF07978. NIPSNAP. 1 hit.
[Graphical view ]
SUPFAMi SSF54909. SSF54909. 2 hits.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "GBAS, a novel gene encoding a protein with tyrosine phosphorylation sites and a transmembrane domain, is co-amplified with EGFR."
    Wang X.-Y., Smith D.I., Liu W., James C.D.
    Genomics 49:448-451(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Characterization of the human NIPSNAP1 gene from 22q12: a member of a novel gene family."
    Seroussi E., Pan H.Q., Kedra D., Roe B.A., Dumanski J.P.
    Gene 212:13-20(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
    Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
    Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Small intestine.
  5. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (MAY-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  6. "The DNA sequence of human chromosome 7."
    Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
    , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
    Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Colon and Lung.
  9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiNIPS2_HUMAN
AccessioniPrimary (citable) accession number: O75323
Secondary accession number(s): C9IYJ3, O43801, Q53X96
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 26, 2001
Last sequence update: November 1, 1998
Last modified: September 3, 2014
This is version 117 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi