O75323 (NIPS2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 105.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein NipSnap homolog 2 Short name=NipSnap2 Alternative name(s): Glioblastoma-amplified sequence | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 286 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Tissue specificity | Widely expressed. Most abundant in heart and skeletal muscle. |
| Sequence similarities | Belongs to the NipSnap family. |
| Sequence caution | The sequence CAA04633.1 differs from that shown. Reason: Frameshift at positions 8, 11 and 17. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | ATP biosynthetic process Inferred from mutant phenotype PubMed 20888800. Source: BHF-UCL negative regulation of ATP citrate synthase activityInferred from mutant phenotype PubMed 20888800. Source: BHF-UCL oxidative phosphorylationInferred from mutant phenotype PubMed 20888800. Source: BHF-UCL |
| Cellular_component | integral to plasma membrane Traceable author statement Ref.1. Source: ProtInc mitochondrionInferred from sequence or structural similarity. Source: UniProtKB |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| GABARAP | O95166 | 5 | EBI-307133,EBI-712001 | |
| GABARAPL1 | Q9H0R8 | 6 | EBI-307133,EBI-746969 | |
| GABARAPL2 | P60520 | 6 | EBI-307133,EBI-720116 | |
| MAP1LC3B | Q9GZQ8 | 4 | EBI-307133,EBI-373144 | |
| MAP1LC3C | Q9BXW4 | 2 | EBI-307133,EBI-2603996 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O75323-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O75323-2) The sequence of this isoform differs from the canonical sequence as follows: 79-148: HNVKPECLEA...EVMNKLRENK → KRCCQRFTKINTTLVLWWGLGTRGMASRTKL | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 286 | 286 | Protein NipSnap homolog 2 | PRO_0000221148 | |||||
Natural variations | |||||||||
| Alternative sequence | 79 – 148 | 70 | HNVKP…LRENK → KRCCQRFTKINTTLVLWWGL GTRGMASRTKL in isoform 2. | VSP_044708 | |||||
Experimental info | |||||||||
| Sequence conflict | 12 | 1 | A → P in CAA04633. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "GBAS, a novel gene encoding a protein with tyrosine phosphorylation sites and a transmembrane domain, is co-amplified with EGFR." Wang X.-Y., Smith D.I., Liu W., James C.D. Genomics 49:448-451(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Characterization of the human NIPSNAP1 gene from 22q12: a member of a novel gene family." Seroussi E., Pan H.Q., Kedra D., Roe B.A., Dumanski J.P. Gene 212:13-20(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Small intestine. |
| [5] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (MAY-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [6] | "The DNA sequence of human chromosome 7." Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. Wilson R.K.Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Colon and Lung. |
| [9] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF029786 mRNA. Translation: AAC29002.1. AJ001259 mRNA. Translation: CAA04633.1. Frameshift. BT007112 mRNA. Translation: AAP35776.1. AK097049 mRNA. No translation available. CR407612 mRNA. Translation: CAG28540.1. AC092579 Genomic DNA. No translation available. CH471140 Genomic DNA. Translation: EAX07966.1. CH471140 Genomic DNA. Translation: EAX07967.1. BC000732 mRNA. Translation: AAH00732.1. BC001837 mRNA. Translation: AAH01837.1. BC030821 mRNA. Translation: AAH30821.1. |
| IPI | IPI00016077. IPI00925757. |
| RefSeq | NP_001189398.1. NM_001202469.1. NP_001474.1. NM_001483.2. |
| UniGene | Hs.591069. |
3D structure databases | |
| ProteinModelPortal | O75323. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O75323. 34 interactions. |
| MINT | MINT-5003890. |
| STRING | 9606.ENSP00000313050. |
PTM databases | |
| PhosphoSite | O75323. |
2D gel databases | |
| UCD-2DPAGE | O75323. |
Proteomic databases | |
| PaxDb | O75323. |
| PeptideAtlas | O75323. |
| PRIDE | O75323. |
Protocols and materials databases | |
| DNASU | 2631. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000322090; ENSP00000313050; ENSG00000146729. ENST00000446778; ENSP00000406855; ENSG00000146729. |
| GeneID | 2631. |
| KEGG | hsa:2631. |
| UCSC | uc003tre.2. human. uc003trf.2. human. |
Organism-specific databases | |
| CTD | 2631. |
| GeneCards | GC07P056020. |
| HGNC | HGNC:4179. GBAS. |
| MIM | 603004. gene. |
| neXtProt | NX_O75323. |
| PharmGKB | PA28593. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG09022. |
| HOGENOM | HOG000194298. |
| HOVERGEN | HBG052627. |
| InParanoid | O75323. |
| OMA | DIRNAAW. |
| PhylomeDB | O75323. |
Gene expression databases | |
| ArrayExpress | O75323. |
| Bgee | O75323. |
| CleanEx | HS_GBAS. |
| Genevestigator | O75323. |
| GermOnline | ENSG00000146729. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR011008. Dimeric_a/b-barrel. IPR012577. NIPSNAP. [Graphical view] |
| Pfam | PF07978. NIPSNAP. 1 hit. [Graphical view] |
| SUPFAM | SSF54909. Dimer_A_B_barrel. 2 hits. |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 2631. |
| NextBio | 10372. |
| SOURCE | Search... |
Entry information
| Entry name | NIPS2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O75323 Secondary accession number(s): C9IYJ3, O43801, Q53X96 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
