Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Peroxisomal membrane protein 11A

Gene

PEX11A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May be involved in peroxisomal proliferation and may regulate peroxisomes division (PubMed:9792670). May mediate binding of coatomer proteins to the peroxisomal membrane (By similarity). Promotes membrane protrusion and elongation on the peroxisomal surface (PubMed:20826455).By similarity2 Publications

GO - Molecular functioni

  • protein homodimerization activity Source: UniProtKB

GO - Biological processi

  • brown fat cell differentiation Source: Ensembl
  • cellular lipid metabolic process Source: Reactome
  • peroxisome fission Source: UniProtKB
  • peroxisome membrane biogenesis Source: Ensembl
  • peroxisome organization Source: UniProtKB
  • regulation of peroxisome size Source: UniProtKB
  • signal transduction Source: UniProtKB
  • small molecule metabolic process Source: Reactome
Complete GO annotation...

Keywords - Biological processi

Peroxisome biogenesis

Enzyme and pathway databases

ReactomeiR-HSA-1989781. PPARA activates gene expression.

Protein family/group databases

TCDBi1.A.101.1.2. the peroxisomal pore-forming pex11 (pex11) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Peroxisomal membrane protein 11A
Short name:
HsPEX11p
Alternative name(s):
28 kDa peroxisomal integral membrane protein
Short name:
PMP28
Peroxin-11A
Peroxisomal biogenesis factor 11A
Protein PEX11 homolog alpha
Short name:
PEX11-alpha
Gene namesi
Name:PEX11A
Synonyms:PEX11
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

HGNCiHGNC:8852. PEX11A.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 8383CytoplasmicSequence analysisAdd
BLAST
Transmembranei84 – 10522HelicalSequence analysisAdd
BLAST
Topological domaini106 – 219114LumenalSequence analysisAdd
BLAST
Transmembranei220 – 23920HelicalSequence analysisAdd
BLAST
Topological domaini240 – 2478CytoplasmicSequence analysis

GO - Cellular componenti

  • integral component of peroxisomal membrane Source: UniProtKB
  • peroxisomal membrane Source: Reactome
  • peroxisome Source: UniProtKB
  • protein complex Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Membrane, Peroxisome

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi9 – 91N → D: No effect on peroxisomal location. 1 Publication
Mutagenesisi243 – 2453KLK → SLS: No effect on peroxisomal location. 1 Publication

Organism-specific databases

PharmGKBiPA33194.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 247247Peroxisomal membrane protein 11APRO_0000105964Add
BLAST

Post-translational modificationi

Seems not to be N-glycosylated.

Proteomic databases

MaxQBiO75192.
PaxDbiO75192.
PRIDEiO75192.

PTM databases

iPTMnetiO75192.
PhosphoSiteiO75192.

Expressioni

Gene expression databases

BgeeiO75192.
CleanExiHS_PEX11A.
ExpressionAtlasiO75192. baseline and differential.
GenevisibleiO75192. HS.

Organism-specific databases

HPAiHPA039115.

Interactioni

Subunit structurei

Homodimer (PubMed:20826455). Heterodimer with PEX11G (PubMed:20826455). Probably interacts with COPB2 and COPA (By similarity). Interacts with PEX19 (PubMed:10704444). Interacts with FIS1 (PubMed:20826455).By similarity2 Publications

GO - Molecular functioni

  • protein homodimerization activity Source: UniProtKB

Protein-protein interaction databases

BioGridi114328. 6 interactions.
IntActiO75192. 1 interaction.
MINTiMINT-3001088.
STRINGi9606.ENSP00000300056.

Structurei

3D structure databases

ProteinModelPortaliO75192.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni220 – 23920Required for homodimerization, interaction with PEX11G, and peroxisomal localization1 PublicationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi159 – 18224Gly-richAdd
BLAST

Sequence similaritiesi

Belongs to the peroxin-11 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4186. Eukaryota.
ENOG4111NS6. LUCA.
GeneTreeiENSGT00390000014273.
HOGENOMiHOG000251589.
HOVERGENiHBG053771.
InParanoidiO75192.
KOiK13351.
OMAiNLCDILN.
PhylomeDBiO75192.
TreeFamiTF325704.

Family and domain databases

InterProiIPR008733. PEX11.
[Graphical view]
PfamiPF05648. PEX11. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O75192-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDAFTRFTNQ TQGRDRLFRA TQYTCMLLRY LLEPKAGKEK VVMKLKKLES
60 70 80 90 100
SVSTGRKWFR LGNVVHAIQA TEQSIHATDL VPRLCLTLAN LNRVIYFICD
110 120 130 140 150
TILWVRSVGL TSGINKEKWR TRAAHHYYYS LLLSLVRDLY EISLQMKRVT
160 170 180 190 200
CDRAKKEKSA SQDPLWFSVA EEETEWLQSF LLLLFRSLKQ HPPLLLDTVK
210 220 230 240
NLCDILNPLD QLGIYKSNPG IIGLGGLVSS IAGMITVAYP QMKLKTR
Length:247
Mass (Da):28,353
Last modified:November 1, 1998 - v1
Checksum:iD904EC715271FF87
GO
Isoform 2 (identifier: O75192-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     58-89: WFRLGNVVHAIQATEQSIHATDLVPRLCLTLA → S

Show »
Length:216
Mass (Da):24,884
Checksum:i3BACCDB9F688112B
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei58 – 8932WFRLG…CLTLA → S in isoform 2. 1 PublicationVSP_054753Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB015594 mRNA. Translation: BAA32533.1.
AF093668 mRNA. Translation: AAC78658.1.
CR542046 mRNA. Translation: CAG46843.1.
CR542075 mRNA. Translation: CAG46872.1.
AK300978 mRNA. Translation: BAG62600.1.
AC013787 Genomic DNA. No translation available.
BC009697 mRNA. Translation: AAH09697.1.
CCDSiCCDS10354.1. [O75192-1]
CCDS61751.1. [O75192-2]
RefSeqiNP_001258501.1. NM_001271572.1. [O75192-2]
NP_003838.1. NM_003847.2. [O75192-1]
UniGeneiHs.31034.

Genome annotation databases

EnsembliENST00000300056; ENSP00000300056; ENSG00000166821. [O75192-1]
ENST00000561257; ENSP00000453492; ENSG00000166821. [O75192-2]
GeneIDi8800.
KEGGihsa:8800.
UCSCiuc002boi.5. human. [O75192-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB015594 mRNA. Translation: BAA32533.1.
AF093668 mRNA. Translation: AAC78658.1.
CR542046 mRNA. Translation: CAG46843.1.
CR542075 mRNA. Translation: CAG46872.1.
AK300978 mRNA. Translation: BAG62600.1.
AC013787 Genomic DNA. No translation available.
BC009697 mRNA. Translation: AAH09697.1.
CCDSiCCDS10354.1. [O75192-1]
CCDS61751.1. [O75192-2]
RefSeqiNP_001258501.1. NM_001271572.1. [O75192-2]
NP_003838.1. NM_003847.2. [O75192-1]
UniGeneiHs.31034.

3D structure databases

ProteinModelPortaliO75192.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114328. 6 interactions.
IntActiO75192. 1 interaction.
MINTiMINT-3001088.
STRINGi9606.ENSP00000300056.

Protein family/group databases

TCDBi1.A.101.1.2. the peroxisomal pore-forming pex11 (pex11) family.

PTM databases

iPTMnetiO75192.
PhosphoSiteiO75192.

Proteomic databases

MaxQBiO75192.
PaxDbiO75192.
PRIDEiO75192.

Protocols and materials databases

DNASUi8800.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000300056; ENSP00000300056; ENSG00000166821. [O75192-1]
ENST00000561257; ENSP00000453492; ENSG00000166821. [O75192-2]
GeneIDi8800.
KEGGihsa:8800.
UCSCiuc002boi.5. human. [O75192-1]

Organism-specific databases

CTDi8800.
GeneCardsiPEX11A.
HGNCiHGNC:8852. PEX11A.
HPAiHPA039115.
MIMi603866. gene.
neXtProtiNX_O75192.
PharmGKBiPA33194.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4186. Eukaryota.
ENOG4111NS6. LUCA.
GeneTreeiENSGT00390000014273.
HOGENOMiHOG000251589.
HOVERGENiHBG053771.
InParanoidiO75192.
KOiK13351.
OMAiNLCDILN.
PhylomeDBiO75192.
TreeFamiTF325704.

Enzyme and pathway databases

ReactomeiR-HSA-1989781. PPARA activates gene expression.

Miscellaneous databases

GeneWikiiPEX11A.
GenomeRNAii8800.
NextBioi33008.
PROiO75192.
SOURCEiSearch...

Gene expression databases

BgeeiO75192.
CleanExiHS_PEX11A.
ExpressionAtlasiO75192. baseline and differential.
GenevisibleiO75192. HS.

Family and domain databases

InterProiIPR008733. PEX11.
[Graphical view]
PfamiPF05648. PEX11. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Clofibrate-inducible, 28-kDa peroxisomal integral membrane protein is encoded by PEX11."
    Abe I., Okumoto K., Tamura S., Fujiki Y.
    FEBS Lett. 431:468-472(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, MUTAGENESIS OF ASN-9 AND 243-LYS--LYS-245, TOPOLOGY.
    Tissue: Liver.
  2. "Expression of PEX11beta mediates peroxisome proliferation in the absence of extracellular stimuli."
    Schrader M., Reuber B.E., Morrell J.C., Jimenez-Sanchez G., Obie C., Stroh T.A., Valle D., Schroer T.A., Gould S.J.
    J. Biol. Chem. 273:29607-29614(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, FUNCTION.
  3. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Small intestine.
  5. "Analysis of the DNA sequence and duplication history of human chromosome 15."
    Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A.
    , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
    Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Lung.
  7. "PEX19 binds multiple peroxisomal membrane proteins, is predominantly cytoplasmic, and is required for peroxisome membrane synthesis."
    Sacksteder K.A., Jones J.M., South S.T., Li X., Liu Y., Gould S.J.
    J. Cell Biol. 148:931-944(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH PEX19.
  8. "PEX11 family members are membrane elongation factors that coordinate peroxisome proliferation and maintenance."
    Koch J., Pranjic K., Huber A., Ellinger A., Hartig A., Kragler F., Brocard C.
    J. Cell Sci. 123:3389-3400(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBUNIT, INTERACTION WITH FIS1 AND PEX11G, SUBCELLULAR LOCATION.

Entry informationi

Entry nameiPX11A_HUMAN
AccessioniPrimary (citable) accession number: O75192
Secondary accession number(s): B4DV88
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 26, 2005
Last sequence update: November 1, 1998
Last modified: March 16, 2016
This is version 114 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.