SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O75190

- DNJB6_HUMAN

UniProt

O75190 - DNJB6_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
DnaJ homolog subfamily B member 6
Gene
DNAJB6, HSJ2, MRJ, MSJ1
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Plays an indispensable role in the organization of KRT8/KRT18 filaments. Acts as an endogenous molecular chaperone for neuronal proteins including huntingtin. Suppresses aggregation and toxicity of polyglutamine-containing, aggregation-prone proteins. Isoform B but not isoform A inhibits huntingtin aggregation. Has a stimulatory effect on the ATPase activity of HSP70 in a dose-dependent and time-dependent manner and hence acts as a co-chaperone of HSP70. Also reduces cellular toxicity and caspase-3 activity.4 Publications

GO - Molecular functioni

  1. ATPase activator activity Source: UniProtKB
  2. DNA binding Source: Ensembl
  3. chaperone binding Source: UniProtKB
  4. heat shock protein binding Source: UniProtKB
  5. protein binding Source: UniProtKB
  6. unfolded protein binding Source: UniProt

GO - Biological processi

  1. actin cytoskeleton organization Source: Ensembl
  2. chorio-allantoic fusion Source: Ensembl
  3. chorion development Source: Ensembl
  4. extracellular matrix organization Source: Ensembl
  5. intermediate filament organization Source: UniProtKB
  6. negative regulation of cysteine-type endopeptidase activity involved in apoptotic process Source: UniProtKB
  7. negative regulation of inclusion body assembly Source: UniProt
  8. negative regulation of transcription, DNA-templated Source: Ensembl
  9. positive regulation of ATPase activity Source: GOC
  10. protein folding Source: UniProtKB
  11. protein localization to nucleus Source: Ensembl
  12. syncytiotrophoblast cell differentiation involved in labyrinthine layer development Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Chaperone

Names & Taxonomyi

Protein namesi
Recommended name:
DnaJ homolog subfamily B member 6
Alternative name(s):
HHDJ1
Heat shock protein J2
Short name:
HSJ-2
MRJ
MSJ-1
Gene namesi
Name:DNAJB6
Synonyms:HSJ2, MRJ, MSJ1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 7

Organism-specific databases

HGNCiHGNC:14888. DNAJB6.

Subcellular locationi

Cytoplasmperinuclear region. Nucleus. CytoplasmmyofibrilsarcomereZ line 2 Publications

GO - Cellular componenti

  1. Z disc Source: UniProtKB
  2. cytoplasm Source: HPA
  3. cytosol Source: UniProt
  4. nucleus Source: UniProtKB
  5. perinuclear region of cytoplasm Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Involvement in diseasei

Limb-girdle muscular dystrophy 1E (LGMD1E) [MIM:603511]: An autosomal dominant myopathy characterized by adult onset of proximal muscle weakness, beginning in the hip girdle region and later progressing to the shoulder girdle region.
Note: The disease is caused by mutations affecting the gene represented in this entry. There is evidence that LGMD1E is caused by dysfunction of isoform B (1 Publication).2 Publications
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti89 – 891F → I in LGMD1E; the mutation results in inefficient inhibition of protein aggregation by isoform B. 1 Publication
VAR_067833
Natural varianti93 – 931F → L in LGMD1E; the mutation results in inefficient inhibition of protein aggregation by isoform B. 2 Publications
VAR_067834
Natural varianti96 – 961P → R in LGMD1E. 1 Publication
VAR_067835

Keywords - Diseasei

Disease mutation, Limb-girdle muscular dystrophy

Organism-specific databases

MIMi603511. phenotype.
Orphaneti34516. Autosomal dominant limb-girdle muscular dystrophy type 1D.
PharmGKBiPA27418.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed1 Publication
Chaini2 – 326325DnaJ homolog subfamily B member 6
PRO_0000071025Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei277 – 2771Phosphoserine2 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiO75190.
PaxDbiO75190.
PRIDEiO75190.

PTM databases

PhosphoSiteiO75190.

Expressioni

Tissue specificityi

Widely expressed. Highest levels in testis and brain, and lower levels in heart, spleen, intestine, ovary, placenta, lung, kidney, pancreas, thymus, prostate, skeletal muscle, liver and leukocytes. In testis, expressed in germ cells in the earlier stages of differentiation pathway as well as in spermatids. In brain, expressed at a higher level in hippocampus and thalamus and a lower level in amygdala, substantia nigra, corpus callosum and caudate nucleus.4 Publications

Gene expression databases

ArrayExpressiO75190.
BgeeiO75190.
CleanExiHS_DNAJB6.
GenevestigatoriO75190.

Organism-specific databases

HPAiCAB004670.
HPA024258.

Interactioni

Subunit structurei

Homooligomer. Interacts with BAG3, HSPB8 and STUB1. Interacts with ALKBH1 By similarity. Interacts with HSP70, KRT18 and PTTG. Isoform B interacts with histone deacetylases HDAC4, HDAC6, and SIRT2, HDAC activity is required for antiaggregation.3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
BRMS1Q9HCU92EBI-1053164,EBI-714781
DYSFO759232EBI-1053164,EBI-2799016
KRT18P057836EBI-1053164,EBI-297888
SGCGQ133262EBI-1053164,EBI-5357343

Protein-protein interaction databases

BioGridi115360. 21 interactions.
IntActiO75190. 26 interactions.
MINTiMINT-4713234.

Structurei

3D structure databases

ProteinModelPortaliO75190.
SMRiO75190. Positions 1-105.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini2 – 6968J
Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni2 – 146145Interaction with HSP70
Add
BLAST
Regioni119 – 242124Interaction with KRT18
Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi83 – 17290Gly/Phe-rich
Add
BLAST
Compositional biasi155 – 19440Ser-rich
Add
BLAST

Domaini

The antiaggregation activity of isoform B resides in the serine-rich region and the C-terminus.

Sequence similaritiesi

Contains 1 J domain.

Phylogenomic databases

eggNOGiCOG0484.
HOVERGENiHBG066998.
InParanoidiO75190.
KOiK09512.
OMAiNPFEFGF.
PhylomeDBiO75190.
TreeFamiTF105142.

Family and domain databases

Gene3Di1.10.287.110. 1 hit.
InterProiIPR001623. DnaJ_domain.
IPR018253. DnaJ_domain_CS.
[Graphical view]
PfamiPF00226. DnaJ. 1 hit.
[Graphical view]
PRINTSiPR00625. JDOMAIN.
SMARTiSM00271. DnaJ. 1 hit.
[Graphical view]
SUPFAMiSSF46565. SSF46565. 1 hit.
PROSITEiPS00636. DNAJ_1. 1 hit.
PS50076. DNAJ_2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform A (identifier: O75190-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MVDYYEVLGV QRHASPEDIK KAYRKLALKW HPDKNPENKE EAERKFKQVA    50
EAYEVLSDAK KRDIYDKYGK EGLNGGGGGG SHFDSPFEFG FTFRNPDDVF 100
REFFGGRDPF SFDFFEDPFE DFFGNRRGPR GSRSRGTGSF FSAFSGFPSF 150
GSGFSSFDTG FTSFGSLGHG GLTSFSSTSF GGSGMGNFKS ISTSTKMVNG 200
RKITTKRIVE NGQERVEVEE DGQLKSLTIN GVADDDALAE ERMRRGQNAL 250
PAQPAGLRPP KPPRPASLLR HAPHCLSEEE GEQDRPRAPG PWDPLASAAG 300
LKEGGKRKKQ KQREESKKKK STKGNH 326
Length:326
Mass (Da):36,087
Last modified:October 18, 2001 - v2
Checksum:iECF1628BF7A524F3
GO
Isoform B (identifier: O75190-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     232-241: VADDDALAEE → KEQLLRLDNK
     242-326: Missing.

Show »
Length:241
Mass (Da):26,900
Checksum:iCD5A49CAB66C2E16
GO
Isoform C (identifier: O75190-3) [UniParc]FASTAAdd to Basket

Also known as: a

The sequence of this isoform differs from the canonical sequence as follows:
     301-326: LKEGGKRKKQKQREESKKKKSTKGNH → VQREAAVEQAQSETSLGARGQRGHK

Note: No experimental confirmation available.

Show »
Length:325
Mass (Da):35,714
Checksum:i01F47DA9A87EBC74
GO
Isoform D (identifier: O75190-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-59: MVDYYEVLGVQRHASPEDIKKAYRKLALKWHPDKNPENKEEAERKFKQVAEAYEVLSDA → MPHPRILKRP

Note: No experimental confirmation available.

Show »
Length:277
Mass (Da):30,369
Checksum:i97C70A8C1DF2CACC
GO

Sequence cautioni

The sequence AAD16010.1 differs from that shown. Reason: Frameshift at position 197.
The sequence BAD93096.1 differs from that shown. Reason: Erroneous initiation.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti89 – 891F → I in LGMD1E; the mutation results in inefficient inhibition of protein aggregation by isoform B. 1 Publication
VAR_067833
Natural varianti93 – 931F → L in LGMD1E; the mutation results in inefficient inhibition of protein aggregation by isoform B. 2 Publications
VAR_067834
Natural varianti96 – 961P → R in LGMD1E. 1 Publication
VAR_067835

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5959MVDYY…VLSDA → MPHPRILKRP in isoform D.
VSP_053894Add
BLAST
Alternative sequencei232 – 24110VADDDALAEE → KEQLLRLDNK in isoform B.
VSP_001289
Alternative sequencei242 – 32685Missing in isoform B.
VSP_001290Add
BLAST
Alternative sequencei301 – 32626LKEGG…TKGNH → VQREAAVEQAQSETSLGARG QRGHK in isoform C.
VSP_026180Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti128 – 1281G → S in BAD97321. 1 Publication
Sequence conflicti303 – 3031E → G in BAF85714. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF080569 mRNA. Translation: AAD16010.1. Frameshift.
AB015798 mRNA. Translation: BAA88769.1.
AB015799 mRNA. Translation: BAA88770.1.
AF060703 mRNA. Translation: AAF21257.1.
AB014888 mRNA. Translation: BAA32209.1.
AF075601 mRNA. Translation: AAD43194.1.
CR533498 mRNA. Translation: CAG38529.1.
AB209859 mRNA. Translation: BAD93096.1. Different initiation.
AK223601 mRNA. Translation: BAD97321.1.
AK291953 mRNA. Translation: BAF84642.1.
AK293025 mRNA. Translation: BAF85714.1.
AK297796 mRNA. Translation: BAG60135.1.
AL136707 mRNA. Translation: CAB66642.1.
AC006372 Genomic DNA. No translation available.
AC079306 Genomic DNA. Translation: AAS07392.1.
AC079306 Genomic DNA. Translation: AAS07393.1.
CH236954 Genomic DNA. Translation: EAL23923.1.
CH236954 Genomic DNA. Translation: EAL23924.1.
CH471149 Genomic DNA. Translation: EAX04570.1.
BC000177 mRNA. Translation: AAH00177.1.
BC002446 mRNA. Translation: AAH02446.1.
CCDSiCCDS47755.1. [O75190-2]
CCDS5946.1. [O75190-1]
RefSeqiNP_005485.1. NM_005494.2. [O75190-2]
NP_490647.1. NM_058246.3. [O75190-1]
UniGeneiHs.188591.
Hs.490745.

Genome annotation databases

EnsembliENST00000262177; ENSP00000262177; ENSG00000105993. [O75190-1]
ENST00000429029; ENSP00000397556; ENSG00000105993. [O75190-2]
ENST00000452797; ENSP00000402270; ENSG00000105993.
GeneIDi10049.
KEGGihsa:10049.
UCSCiuc003wnj.3. human. [O75190-2]
uc003wnk.3. human. [O75190-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF080569 mRNA. Translation: AAD16010.1 . Frameshift.
AB015798 mRNA. Translation: BAA88769.1 .
AB015799 mRNA. Translation: BAA88770.1 .
AF060703 mRNA. Translation: AAF21257.1 .
AB014888 mRNA. Translation: BAA32209.1 .
AF075601 mRNA. Translation: AAD43194.1 .
CR533498 mRNA. Translation: CAG38529.1 .
AB209859 mRNA. Translation: BAD93096.1 . Different initiation.
AK223601 mRNA. Translation: BAD97321.1 .
AK291953 mRNA. Translation: BAF84642.1 .
AK293025 mRNA. Translation: BAF85714.1 .
AK297796 mRNA. Translation: BAG60135.1 .
AL136707 mRNA. Translation: CAB66642.1 .
AC006372 Genomic DNA. No translation available.
AC079306 Genomic DNA. Translation: AAS07392.1 .
AC079306 Genomic DNA. Translation: AAS07393.1 .
CH236954 Genomic DNA. Translation: EAL23923.1 .
CH236954 Genomic DNA. Translation: EAL23924.1 .
CH471149 Genomic DNA. Translation: EAX04570.1 .
BC000177 mRNA. Translation: AAH00177.1 .
BC002446 mRNA. Translation: AAH02446.1 .
CCDSi CCDS47755.1. [O75190-2 ]
CCDS5946.1. [O75190-1 ]
RefSeqi NP_005485.1. NM_005494.2. [O75190-2 ]
NP_490647.1. NM_058246.3. [O75190-1 ]
UniGenei Hs.188591.
Hs.490745.

3D structure databases

ProteinModelPortali O75190.
SMRi O75190. Positions 1-105.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 115360. 21 interactions.
IntActi O75190. 26 interactions.
MINTi MINT-4713234.

PTM databases

PhosphoSitei O75190.

Proteomic databases

MaxQBi O75190.
PaxDbi O75190.
PRIDEi O75190.

Protocols and materials databases

DNASUi 10049.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000262177 ; ENSP00000262177 ; ENSG00000105993 . [O75190-1 ]
ENST00000429029 ; ENSP00000397556 ; ENSG00000105993 . [O75190-2 ]
ENST00000452797 ; ENSP00000402270 ; ENSG00000105993 .
GeneIDi 10049.
KEGGi hsa:10049.
UCSCi uc003wnj.3. human. [O75190-2 ]
uc003wnk.3. human. [O75190-1 ]

Organism-specific databases

CTDi 10049.
GeneCardsi GC07P157128.
GeneReviewsi DNAJB6.
HGNCi HGNC:14888. DNAJB6.
HPAi CAB004670.
HPA024258.
MIMi 603511. phenotype.
611332. gene.
neXtProti NX_O75190.
Orphaneti 34516. Autosomal dominant limb-girdle muscular dystrophy type 1D.
PharmGKBi PA27418.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0484.
HOVERGENi HBG066998.
InParanoidi O75190.
KOi K09512.
OMAi NPFEFGF.
PhylomeDBi O75190.
TreeFami TF105142.

Miscellaneous databases

ChiTaRSi DNAJB6. human.
GeneWikii DNAJB6.
GenomeRNAii 10049.
NextBioi 35464742.
PROi O75190.
SOURCEi Search...

Gene expression databases

ArrayExpressi O75190.
Bgeei O75190.
CleanExi HS_DNAJB6.
Genevestigatori O75190.

Family and domain databases

Gene3Di 1.10.287.110. 1 hit.
InterProi IPR001623. DnaJ_domain.
IPR018253. DnaJ_domain_CS.
[Graphical view ]
Pfami PF00226. DnaJ. 1 hit.
[Graphical view ]
PRINTSi PR00625. JDOMAIN.
SMARTi SM00271. DnaJ. 1 hit.
[Graphical view ]
SUPFAMi SSF46565. SSF46565. 1 hit.
PROSITEi PS00636. DNAJ_1. 1 hit.
PS50076. DNAJ_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Pituitary tumor-transforming gene protein associates with ribosomal protein S10 and a novel human homologue of DnaJ in testicular cells."
    Pei L.
    J. Biol. Chem. 274:3151-3158(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B), INTERACTION WITH PTTG, TISSUE SPECIFICITY.
    Tissue: Testis.
  2. "Characterization of a brain-enriched chaperone, MRJ, that inhibits Huntingtin aggregation and toxicity independently."
    Chuang J.-Z., Zhou H., Zhu M., Li S.-H., Li X.-J., Sung C.-H.
    J. Biol. Chem. 277:19831-19838(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B), FUNCTION, TISSUE SPECIFICITY.
  3. "Characterization of two isoforms of a human DnaJ homologue, HSJ2."
    Hanai R., Mashima K.
    Mol. Biol. Rep. 30:149-153(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A AND B).
  4. Zhang J.S., Nelson M., Wang L., Smith D.I.
    Submitted (APR-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B).
    Tissue: Pancreas.
  5. "Cloning, tissue expression, and chromosomal assignment of human MRJ gene for a member of the DNAJ protein family."
    Seki N., Hattori A., Hayashi A., Kozuma S., Miyajima N., Saito T.
    J. Hum. Genet. 44:185-189(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B), TISSUE SPECIFICITY.
    Tissue: Testis.
  6. "HSJ2, a novel human homologue of the bacterial heat-shock protein DnaJ."
    Zhang W., Wan T., Yuan Z., Cao X.
    Submitted (JUL-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B).
  7. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM B).
  8. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS A; B AND C).
    Tissue: Uterus.
  9. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
    Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS A AND C).
    Tissue: Aortic endothelium and Kidney.
  10. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM B).
    Tissue: Fetal kidney.
  11. "The DNA sequence of human chromosome 7."
    Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
    , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
    Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  12. "Human chromosome 7: DNA sequence and biology."
    Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S.
    , Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.
    Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  13. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  14. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS A AND B).
    Tissue: Placenta and Skin.
  15. Bienvenut W.V., Waridel P., Quadroni M.
    Submitted (MAR-2009) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 2-12; 48-60; 71-101; 208-242 AND 271-287, CLEAVAGE OF INITIATOR METHIONINE, IDENTIFICATION BY MASS SPECTROMETRY.
    Tissue: Embryonic kidney.
  16. "Identification of Mrj, a DnaJ/Hsp40 family protein, as a keratin 8/18 filament regulatory protein."
    Izawa I., Nishizawa M., Ohtakara K., Ohtsuka K., Inada H., Inagaki M.
    J. Biol. Chem. 275:34521-34527(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH HSP70 AND KRT18, SUBCELLULAR LOCATION.
  17. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-277, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  18. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  19. "A DNAJB chaperone subfamily with HDAC-dependent activities suppresses toxic protein aggregation."
    Hageman J., Rujano M.A., van Waarde M.A., Kakkar V., Dirks R.P., Govorukhina N., Oosterveld-Hut H.M., Lubsen N.H., Kampinga H.H.
    Mol. Cell 37:355-369(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION AS SUPPRESSOR OF PROTEIN AGGREGATION.
  20. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  21. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-277, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  22. Cited for: FUNCTION IN INHIBITION OF HUNTINGTIN AGGREGATION, SUBUNIT, INTERACTION WITH BAG3; HSPB8 AND STUB1, TISSUE SPECIFICITY, SUBCELLULAR LOCATION, VARIANTS LGMD1E ILE-89 AND LEU-93, CHARACTERIZATION OF VARIANTS LGMD1E ILE-89 AND LEU-93.
  23. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  24. "Exome sequencing reveals DNAJB6 mutations in dominantly-inherited myopathy."
    Harms M.B., Sommerville R.B., Allred P., Bell S., Ma D., Cooper P., Lopate G., Pestronk A., Weihl C.C., Baloh R.H.
    Ann. Neurol. 71:407-416(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS LGMD1E LEU-93 AND ARG-96.

Entry informationi

Entry nameiDNJB6_HUMAN
AccessioniPrimary (citable) accession number: O75190
Secondary accession number(s): A4D232
, A8K7D8, A8KAG0, B4DN73, E9PCZ2, O95806, Q53EN8, Q59EF2, Q6FIC8, Q75MA2, Q9UIK6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: October 18, 2001
Last modified: September 3, 2014
This is version 141 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi