O75154 (RFIP3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 113.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Rab11 family-interacting protein 3 Short name=FIP3-Rab11 Short name=Rab11-FIP3 Alternative name(s): Arfophilin-1 EF hands-containing Rab-interacting protein Short name=Eferin MU-MB-17.148 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 756 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Acts as a regulator of endocytic traffic by participating in membrane delivery. Required for the abcission step in cytokinesis, possibly by acting as an 'address tag' delivering recycling endosome membranes to the cleavage furrow during late cytokinesis. Also required for the structural integrity of the endosomal recycling compartment during interphase. May play a role in breast cancer cell motility by regulating actin cytoskeleton. Ref.12 Ref.15 Ref.17 |
| Subunit structure | Homodimer. Forms a complex with Rab11 (RAB11A or RAB11B) and ARF6. Interacts with RAB11A; the interaction is direct. Interacts with RAB11B, RAB25 and RAB11FIP4. Interacts with ARF6; according to Ref.11, it specifically interacts with ARF6 but not ARF5. Interacts with ARF6; according to Ref.20 but not Ref.11. Interacts with RACGAP1/MgcRacGAP; interaction takes place during late stage of cytokinesis and is required for recruitment to the midbody. Interacts with ASAP1 and EXOC7. Ref.8 Ref.9 Ref.11 Ref.12 Ref.13 Ref.14 Ref.16 Ref.19 Ref.20 |
| Subcellular location | Recycling endosome membrane; Peripheral membrane protein. Cytoplasm › cytoskeleton › centrosome. Cleavage furrow. Midbody. Note: In early mitosis remains diffuse and distributed through the cell. The onset of anaphase sequesters these vesicles to the centrosomes at the opposite poles of the cell. During telophase these vesicles move from the centrosomes, to the furrow, and then to the midbody to aid in abscission. Interaction with Rab11 mediates localization to endosomes. Interaction with ARF6 mediates localization to the midbody. Ref.8 Ref.10 Ref.11 Ref.12 Ref.15 Ref.16 Ref.19 |
| Domain | The RBD-FIP domain mediates the interaction with Rab11 (RAB11A or RAB11B). Ref.20 |
| Post-translational modification | Phosphorylated at Ser-102 by CDK1 during metaphase, and dephosphorylated as cells enter telophase. Ref.18 |
| Sequence similarities | Contains 2 EF-hand domains. Contains 1 FIP-RBD domain. |
| Sequence caution | The sequence BAA31640.2 differs from that shown. Reason: Erroneous initiation. The sequence BAG57098.1 differs from that shown. Reason: Erroneous initiation. The sequence CAQ09358.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAQ09642.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAQ11003.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O75154-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O75154-2) The sequence of this isoform differs from the canonical sequence as follows: 1-296: Missing. 297-301: FVTYE → MPFLK | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: O75154-3) The sequence of this isoform differs from the canonical sequence as follows: 421-421: P → PSTDPLAAKLHSILTDEAFEFYCSQCHKQINRLEDLSARLSDLEMN | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||
Molecule processing | |||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 756 | 756 | Rab11 family-interacting protein 3 | PRO_0000073879 | |||||||||||
Regions | |||||||||||||||
| Domain | 202 – 237 | 36 | EF-hand 1 | ||||||||||||
| Domain | 234 – 269 | 36 | EF-hand 2 | ||||||||||||
| Domain | 694 – 756 | 63 | FIP-RBD | ||||||||||||
| Calcium binding | 215 – 226 | 12 | 1 Potential | ||||||||||||
| Calcium binding | 247 – 258 | 12 | 2 Potential | ||||||||||||
| Region | 484 – 588 | 105 | ARF-binding domain (ABD) | ||||||||||||
| Coiled coil | 485 – 694 | 210 | Potential | ||||||||||||
| Compositional bias | 5 – 197 | 193 | Pro-rich | ||||||||||||
| Compositional bias | 148 – 151 | 4 | Poly-Ser | ||||||||||||
| Compositional bias | 366 – 369 | 4 | Poly-Leu | ||||||||||||
Amino acid modifications | |||||||||||||||
| Modified residue | 102 | 1 | Phosphoserine; by CDK1 Ref.18 | ||||||||||||
| Modified residue | 281 | 1 | Phosphoserine Ref.18 | ||||||||||||
| Modified residue | 348 | 1 | Phosphoserine Ref.18 | ||||||||||||
| Modified residue | 488 | 1 | Phosphoserine Ref.18 | ||||||||||||
| Modified residue | 538 | 1 | Phosphoserine Ref.18 | ||||||||||||
| Modified residue | 647 | 1 | Phosphoserine Ref.18 | ||||||||||||
| Modified residue | 648 | 1 | Phosphoserine Ref.18 | ||||||||||||
Natural variations | |||||||||||||||
| Alternative sequence | 1 – 296 | 296 | Missing in isoform 2. | VSP_038664 | |||||||||||
| Alternative sequence | 297 – 301 | 5 | FVTYE → MPFLK in isoform 2. | VSP_038665 | |||||||||||
| Alternative sequence | 421 | 1 | P → PSTDPLAAKLHSILTDEAFE FYCSQCHKQINRLEDLSARL SDLEMN in isoform 3. | VSP_038666 | |||||||||||
Experimental info | |||||||||||||||
| Mutagenesis | 737 | 1 | Y → S: Abolishes Rab11-binding. Ref.20 | ||||||||||||
| Mutagenesis | 738 | 1 | I → E: Abolishes Rab11-binding. Ref.11 Ref.12 | ||||||||||||
| Mutagenesis | 739 | 1 | D → A: Abolishes Rab11-binding. Ref.20 | ||||||||||||
| Mutagenesis | 746 | 1 | M → S: Abolishes Rab11-binding. Ref.20 | ||||||||||||
| Mutagenesis | 747 | 1 | E → A: Abolishes Rab11-binding. Ref.20 | ||||||||||||
Secondary structure | |||||||||||||||
Helix Strand Turn | |||||||||||||||
| Helix | 704 – 709 | 6 | |||||||||||||
| Helix | 717 – 746 | 30 | |||||||||||||
| Helix | 750 – 753 | 4 | |||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of a novel Rab11/25 binding domain present in eferin and rip proteins." Prekeris R., Davies J.M., Scheller R.H. J. Biol. Chem. 276:38966-38970(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro." Ishikawa K., Nagase T., Suyama M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:169-176(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 311-756 (ISOFORM 3). Tissue: Cerebellum and Testis. |
| [4] | "Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16." Daniels R.J., Peden J.F., Lloyd C., Horsley S.W., Clark K., Tufarelli C., Kearney L., Buckle V.J., Doggett N.A., Flint J., Higgs D.R. Hum. Mol. Genet. 10:339-352(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The sequence and analysis of duplication-rich human chromosome 16." Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. Pennacchio L.A.Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Ovary. |
| [7] | "Novel tumor antigens identified by autologous antibody screening of childhood medulloblastoma cDNA libraries." Behrends U., Schneider I., Roessler S., Frauenknecht H., Golbeck A., Lechner B., Eigenstetter G., Zobywalski C., Mueller-Weihrich S., Graubner U., Schmid I., Sackerer D., Spaeth M., Goetz C., Prantl F., Asmuss H.-P., Bise K., Mautner J. Int. J. Cancer 106:244-251(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 532-756. |
| [8] | "Identification and characterization of a family of Rab11-interacting proteins." Hales C.M., Griner R., Hobdy-Henderson K.C., Dorn M.C., Hardy D., Kumar R., Navarre J., Chan E.K.L., Lapierre L.A., Goldenring J.R. J. Biol. Chem. 276:39067-39075(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH RAB11A; RAB11B AND RAB25, SUBCELLULAR LOCATION. |
| [9] | "Rab11-FIP4 interacts with Rab11 in a GTP-dependent manner and its overexpression condenses the Rab11 positive compartment in HeLa cells." Wallace D.M., Lindsay A.J., Hendrick A.G., McCaffrey M.W. Biochem. Biophys. Res. Commun. 299:770-779(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH RAB11FIP4. |
| [10] | "Rab11-FIP3 localises to a Rab11-positive pericentrosomal compartment during interphase and to the cleavage furrow during cytokinesis." Horgan C.P., Walsh M., Zurawski T.H., McCaffrey M.W. Biochem. Biophys. Res. Commun. 319:83-94(2004) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [11] | "Rab11-FIP3 and FIP4 interact with Arf6 and the exocyst to control membrane traffic in cytokinesis." Fielding A.B., Schonteich E., Matheson J., Wilson G., Yu X., Hickson G.R., Srivastava S., Baldwin S.A., Prekeris R., Gould G.W. EMBO J. 24:3389-3399(2005) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, INTERACTION WITH EXOC7; RAB11A AND ARF6, MUTAGENESIS OF ILE-738. |
| [12] | "The FIP3-Rab11 protein complex regulates recycling endosome targeting to the cleavage furrow during late cytokinesis." Wilson G.M., Fielding A.B., Simon G.C., Yu X., Andrews P.D., Hames R.S., Frey A.M., Peden A.A., Gould G.W., Prekeris R. Mol. Biol. Cell 16:849-860(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH RAB11A, MUTAGENESIS OF ILE-738. |
| [13] | "Molecular characterization of Rab11-FIP3 binding to ARF GTPases." Schonteich E., Pilli M., Simon G.C., Matern H.T., Junutula J.R., Sentz D., Holmes R.K., Prekeris R. Eur. J. Cell Biol. 86:417-431(2007) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH RAB11A AND ARF6. |
| [14] | "Identification of Rab11 as a small GTPase binding protein for the Evi5 oncogene." Westlake C.J., Junutula J.R., Simon G.C., Pilli M., Prekeris R., Scheller R.H., Jackson P.K., Eldridge A.G. Proc. Natl. Acad. Sci. U.S.A. 104:1236-1241(2007) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH RAB11A. |
| [15] | "Rab11-FIP3 is critical for the structural integrity of the endosomal recycling compartment." Horgan C.P., Oleksy A., Zhdanov A.V., Lall P.Y., White I.J., Khan A.R., Futter C.E., McCaffrey J.G., McCaffrey M.W. Traffic 8:414-430(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION. |
| [16] | "Sequential Cyk-4 binding to ECT2 and FIP3 regulates cleavage furrow ingression and abscission during cytokinesis." Simon G.C., Schonteich E., Wu C.C., Piekny A., Ekiert D., Yu X., Gould G.W., Glotzer M., Prekeris R. EMBO J. 27:1791-1803(2008) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, INTERACTION WITH RACGAP1. |
| [17] | "Rab11-FIP3 is a Rab11-binding protein that regulates breast cancer cell motility by modulating the actin cytoskeleton." Jing J., Tarbutton E., Wilson G., Prekeris R. Eur. J. Cell Biol. 88:325-341(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [18] | "Rab11-FIP3 is a cell cycle-regulated phosphoprotein." Collins L.L., Simon G., Matheson J., Wu C., Miller M.C., Otani T., Yu X., Hayashi S., Prekeris R., Gould G.W. BMC Cell Biol. 13:4-4(2012) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SER-102; SER-281; SER-348; SER-488; SER-538; SER-647 AND SER-648. |
| [19] | "Structural basis for Rab11-mediated recruitment of FIP3 to recycling endosomes." Eathiraj S., Mishra A., Prekeris R., Lambright D.G. J. Mol. Biol. 364:121-135(2006) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.86 ANGSTROMS) OF 695-756 IN COMPLEX WITH RAB11A, SUBCELLULAR LOCATION, HOMODIMERIZATION. |
| [20] | "Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1." Shiba T., Koga H., Shin H.-W., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. Proc. Natl. Acad. Sci. U.S.A. 103:15416-15421(2006) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.75 ANGSTROMS) OF 715-756 IN COMPLEX WITH RAB11A, DOMAIN RBD-FIP, HOMODIMERIZATION, INTERACTION WITH RAB11A; ARF5 AND ARF6, MUTAGENESIS OF TYR-737; ASP-739; MET-746 AND GLU-747. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF395731 mRNA. Translation: AAL12940.1. AB014565 mRNA. Translation: BAA31640.2. Different initiation. AK293644 mRNA. Translation: BAG57098.1. Different initiation. AK303061 mRNA. Translation: BAG64178.1. AE006463 Genomic DNA. Translation: AAK61232.1. AL023881, AL049542, Z98882 Genomic DNA. Translation: CAI95593.1. AL049542, AL023881, Z98882 Genomic DNA. Translation: CAI95788.1. AL023881, AL049542, Z98882 Genomic DNA. Translation: CAQ11003.1. Sequence problems. AL049542, AL023881, Z98882 Genomic DNA. Translation: CAQ09358.1. Sequence problems. Z98882, AL023881, AL049542 Genomic DNA. Translation: CAQ09642.1. Sequence problems. Z98882, AL023881, AL049542 Genomic DNA. Translation: CAI95591.1. BC051360 mRNA. Translation: AAH51360.1. AY130007 mRNA. Translation: AAN05091.1. | ||||||||||||||||||
| IPI | IPI00024426. IPI00853085. IPI00879102. | ||||||||||||||||||
| PIR | T00367. | ||||||||||||||||||
| RefSeq | NP_001135744.1. NM_001142272.1. NP_055515.1. NM_014700.3. | ||||||||||||||||||
| UniGene | Hs.531642. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | O75154. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| MINT | MINT-6799564. | ||||||||||||||||||
| STRING | 9606.ENSP00000262305. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | O75154. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | O75154. | ||||||||||||||||||
| PRIDE | O75154. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000262305; ENSP00000262305; ENSG00000090565. ENST00000434585; ENSP00000399644; ENSG00000090565. ENST00000450428; ENSP00000415919; ENSG00000090565. ENST00000457159; ENSP00000398730; ENSG00000090565. | ||||||||||||||||||
| GeneID | 9727. | ||||||||||||||||||
| KEGG | hsa:9727. | ||||||||||||||||||
| UCSC | uc002chf.3. human. uc010uuf.2. human. uc010uug.2. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 9727. | ||||||||||||||||||
| GeneCards | GC16P000475. | ||||||||||||||||||
| HGNC | HGNC:17224. RAB11FIP3. | ||||||||||||||||||
| HPA | HPA028088. HPA028631. HPA030086. | ||||||||||||||||||
| MIM | 608738. gene. | ||||||||||||||||||
| neXtProt | NX_O75154. | ||||||||||||||||||
| PharmGKB | PA134950896. | ||||||||||||||||||
| HUGE | Search... | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | NOG259959. | ||||||||||||||||||
| HOVERGEN | HBG054059. | ||||||||||||||||||
| InParanoid | O75154. | ||||||||||||||||||
| KO | K12485. | ||||||||||||||||||
| OMA | CYGGVAS. | ||||||||||||||||||
| OrthoDB | EOG4R23V0. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| Pathway_Interaction_DB | arf6downstreampathway. Arf6 downstream pathway. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | O75154. | ||||||||||||||||||
| Bgee | O75154. | ||||||||||||||||||
| CleanEx | HS_RAB11FIP3. | ||||||||||||||||||
| Genevestigator | O75154. | ||||||||||||||||||
| GermOnline | ENSG00000090565. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| Gene3D | 1.10.238.10. 1 hit. | ||||||||||||||||||
| InterPro | IPR011992. EF-hand-like_dom. IPR002048. EF_hand_dom. IPR019018. Rab-bd_FIP-RBD. [Graphical view] | ||||||||||||||||||
| Pfam | PF13499. EF_hand_5. 1 hit. PF09457. RBD-FIP. 1 hit. [Graphical view] | ||||||||||||||||||
| SMART | SM00054. EFh. 2 hits. [Graphical view] | ||||||||||||||||||
| PROSITE | PS00018. EF_HAND_1. False negative. PS50222. EF_HAND_2. 2 hits. PS51511. FIP_RBD. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| ChiTaRS | RAB11FIP3. human. | ||||||||||||||||||
| EvolutionaryTrace | O75154. | ||||||||||||||||||
| GenomeRNAi | 9727. | ||||||||||||||||||
| NextBio | 36593. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | RFIP3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O75154 Secondary accession number(s): B0QYI8 Q9NUI0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
