O75143 (ATG13_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 99.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Autophagy-related protein 13 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 517 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Autophagy factor required for autophagosome formation. Target of the TOR kinase signaling pathway that regulates autophagy through the control of the phosphorylation status of ATG13 and ULK1, and the regulation of the ATG13-ULK1-RB1CC1 complex. Ref.8 Ref.9 Ref.10 |
| Subunit structure | Part of a complex consisting of ATG13, ATG101, ULK1 and RB1CC1. Interacts with ATG101; this interaction stabilizes ATG13, protecting it from proteasomal degradation. Interacts with ULK1 (via C-terminus). Neither ATG101-, nor ULK1-binding are affected by ATG13 phosphorylation status. Interacts with ULK2 (via C-terminus). Ref.7 Ref.8 Ref.9 Ref.10 |
| Subcellular location | Cytoplasm › cytosol By similarity. Preautophagosomal structure By similarity. Note: Under starvation conditions, is localized to puncate structures primarily representing the isolation membrane; the isolation membrane sequesters a portion of the cytoplasm resulting in autophagosome formation By similarity. |
| Post-translational modification | Phosphorylated by ULK1 and ULK2. Phosphorylation status depends on nutrient-rich conditions; dephosphorylated during starvation or following treatment with rapamycin By similarity. Ref.8 Ref.9 Ref.10 |
| Sequence similarities | Belongs to the ATG13 metazoan family. |
| Sequence caution | The sequence BAA31627.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence BAD97323.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Autophagy |
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | autophagic vacuole assembly Inferred from mutant phenotype Ref.9. Source: UniProtKB |
| Cellular_component | ULK1-ATG13-FIP200 complex Inferred from physical interaction Ref.9. Source: UniProtKB cytosolInferred from electronic annotation. Source: UniProtKB-SubCell pre-autophagosomal structureInferred from sequence or structural similarity. Source: UniProtKB |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ATG101 | Q9BSB4 | 4 | EBI-2798775,EBI-2946739 | |
| GABARAPL1 | Q9H0R8 | 2 | EBI-2798775,EBI-746969 | |
| GABARAPL2 | P60520 | 2 | EBI-2798775,EBI-720116 | |
| MAP1LC3B | Q9GZQ8 | 2 | EBI-2798775,EBI-373144 | |
| RB1CC1 | Q8TDY2 | 5 | EBI-2798775,EBI-1047793 |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] Note: Experimental confirmation may be lacking for some isoforms. | ||||||
| Isoform 1 (identifier: O75143-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O75143-2) The sequence of this isoform differs from the canonical sequence as follows: 265-301: Missing. | ||||||
| Isoform 3 (identifier: O75143-3) The sequence of this isoform differs from the canonical sequence as follows: 265-301: Missing. 428-442: HSDGSSGGSSGNTHD → PCSWPLPCLLSPSTV 443-517: Missing. | ||||||
| Isoform 4 (identifier: O75143-4) The sequence of this isoform differs from the canonical sequence as follows: 1-79: Missing. 263-299: Missing. | ||||||
| Isoform 5 (identifier: O75143-5) The sequence of this isoform differs from the canonical sequence as follows: 262-262: S → SQCVFTVTKAHFQTPTPVVTDTLRVPMAGLAFSH | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 517 | 517 | Autophagy-related protein 13 | PRO_0000050767 | |||||
Regions | |||||||||
| Compositional bias | 41 – 44 | 4 | Poly-Ser | ||||||
Amino acid modifications | |||||||||
| Modified residue | 361 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 79 | 79 | Missing in isoform 4. | VSP_044503 | |||||
| Alternative sequence | 262 | 1 | S → SQCVFTVTKAHFQTPTPVVT DTLRVPMAGLAFSH in isoform 5. | VSP_044640 | |||||
| Alternative sequence | 263 – 299 | 37 | Missing in isoform 4. | VSP_044504 | |||||
| Alternative sequence | 265 – 301 | 37 | Missing in isoform 2 and isoform 3. | VSP_002431 | |||||
| Alternative sequence | 428 – 442 | 15 | HSDGS…GNTHD → PCSWPLPCLLSPSTV in isoform 3. | VSP_002432 | |||||
| Alternative sequence | 443 – 517 | 75 | Missing in isoform 3. | VSP_002433 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro." Ishikawa K., Nagase T., Suyama M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:169-176(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4). Tissue: Brain cortex and Thyroid. |
| [3] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5). Tissue: Brain. |
| [4] | "Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. Sakaki Y.Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3). Tissue: Cervix, Lung and Muscle. |
| [7] | "Atg101, a novel mammalian autophagy protein interacting with Atg13." Hosokawa N., Sasaki T., Iemura S.I., Natsume T., Hara T., Mizushima N. Autophagy 5:973-979(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ATG101; ULK1 AND RB1CC1. |
| [8] | "A novel, human Atg13 binding protein, Atg101, interacts with ULK1 and is essential for macroautophagy." Mercer C.A., Kaliappan A., Dennis P.B. Autophagy 5:649-662(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION AS AUTOPHAGY FACTOR, PHOSPHORYLATION, INTERACTION WITH ULK1 AND ATG101. |
| [9] | "Nutrient-dependent mTORC1 association with the ULK1-Atg13-FIP200 complex required for autophagy." Hosokawa N., Hara T., Kaizuka T., Kishi C., Takamura A., Miura Y., Iemura S., Natsume T., Takehana K., Yamada N., Guan J.L., Oshiro N., Mizushima N. Mol. Biol. Cell 20:1981-1991(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH ULK1 AND RB1CC1, PHOSPHORYLATION. |
| [10] | "Kinase-inactivated ULK proteins inhibit autophagy via their conserved C-terminal domains using an Atg13-independent mechanism." Chan E.Y.W., Longatti A., McKnight N.C., Tooze S.A. Mol. Cell. Biol. 29:157-171(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION AS AUTOPHAGY FACTOR, INTERACTION WITH ULK1 AND ULK2, PHOSPHORYLATION BY ULK1 AND ULK2. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB014552 mRNA. Translation: BAA31627.2. Different initiation. AK023867 mRNA. Translation: BAB14707.1. AK294110 mRNA. Translation: BAG57445.1. AK223603 mRNA. Translation: BAD97323.1. Different initiation. AC115088 Genomic DNA. No translation available. AC127035 Genomic DNA. No translation available. CH471064 Genomic DNA. Translation: EAW67985.1. CH471064 Genomic DNA. Translation: EAW67986.1. CH471064 Genomic DNA. Translation: EAW67987.1. CH471064 Genomic DNA. Translation: EAW67988.1. CH471064 Genomic DNA. Translation: EAW67989.1. CH471064 Genomic DNA. Translation: EAW67990.1. CH471064 Genomic DNA. Translation: EAW67991.1. BC001331 mRNA. Translation: AAH01331.1. BC002378 mRNA. Translation: AAH02378.1. BC006191 mRNA. Translation: AAH06191.1. |
| IPI | IPI00006080. IPI00219053. IPI00219054. IPI00981591. |
| RefSeq | NP_001136145.1. NM_001142673.2. NP_001192048.1. NM_001205119.1. NP_001192049.1. NM_001205120.1. NP_001192050.1. NM_001205121.1. NP_001192051.1. NM_001205122.1. NP_055556.2. NM_014741.4. |
| UniGene | Hs.127403. |
3D structure databases | |
| ProteinModelPortal | O75143. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O75143. 10 interactions. |
PTM databases | |
| PhosphoSite | O75143. |
Proteomic databases | |
| PaxDb | O75143. |
| PRIDE | O75143. |
Protocols and materials databases | |
| DNASU | 9776. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000312040; ENSP00000310321; ENSG00000175224. ENST00000359513; ENSP00000352500; ENSG00000175224. ENST00000434074; ENSP00000400642; ENSG00000175224. ENST00000451945; ENSP00000404900; ENSG00000175224. ENST00000524625; ENSP00000433543; ENSG00000175224. ENST00000526508; ENSP00000431974; ENSG00000175224. ENST00000528494; ENSP00000432412; ENSG00000175224. ENST00000529655; ENSP00000433756; ENSG00000175224. ENST00000530500; ENSP00000434390; ENSG00000175224. |
| GeneID | 9776. |
| KEGG | hsa:9776. |
| UCSC | uc001ncz.3. human. uc001ndb.3. human. |
Organism-specific databases | |
| CTD | 9776. |
| GeneCards | GC11P046638. |
| HGNC | HGNC:29091. ATG13. |
| HPA | HPA039350. |
| MIM | 615088. gene. |
| neXtProt | NX_O75143. |
| PharmGKB | PA165543187. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG266388. |
| HOGENOM | HOG000008446. |
| OMA | LGEKICT. |
| PhylomeDB | O75143. |
Gene expression databases | |
| ArrayExpress | O75143. |
| Bgee | O75143. |
| CleanEx | HS_KIAA0652. |
| Genevestigator | O75143. |
| GermOnline | ENSG00000175224. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR018731. Autophagy-rel_p13. [Graphical view] |
| Pfam | PF10033. ATG13. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | ATG13. human. |
| GenomeRNAi | 9776. |
| NextBio | 36806. |
| SOURCE | Search... |
Entry information
| Entry name | ATG13_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O75143 Secondary accession number(s): B4DFI4 Q9H8B0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
