Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Autophagy-related protein 13

Gene

ATG13

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Autophagy factor required for autophagosome formation and mitophagy. Target of the TOR kinase signaling pathway that regulates autophagy through the control of the phosphorylation status of ATG13 and ULK1, and the regulation of the ATG13-ULK1-RB1CC1 complex. Through its regulation of ULK1 activity, plays a role in the regulation of the kinase activity of mTORC1 and cell proliferation.6 Publications

GO - Molecular functioni

  • protein kinase binding Source: UniProtKB

GO - Biological processi

  • autophagosome assembly Source: UniProtKB
  • macroautophagy Source: Reactome
  • mitophagy in response to mitochondrial depolarization Source: Ensembl
  • positive regulation of protein targeting to mitochondrion Source: ParkinsonsUK-UCL
Complete GO annotation...

Keywords - Biological processi

Autophagy

Enzyme and pathway databases

BioCyciZFISH:ENSG00000175224-MONOMER.
ReactomeiR-HSA-1632852. Macroautophagy.
SIGNORiO75143.

Names & Taxonomyi

Protein namesi
Recommended name:
Autophagy-related protein 13
Gene namesi
Name:ATG13
Synonyms:KIAA0652
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:29091. ATG13.

Subcellular locationi

GO - Cellular componenti

  • ATG1/ULK1 kinase complex Source: UniProtKB
  • cytosol Source: GO_Central
  • mitochondrion Source: ParkinsonsUK-UCL
  • pre-autophagosomal structure Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi127S → H: Abolishes interaction with ATG101; when associated with D-133. 1 Publication1
Mutagenesisi131I → D: Decreases interaction with ATG101; when associated with D-134. 1 Publication1
Mutagenesisi133R → D: Abolishes interaction with ATG101; when associated with H-127. 1 Publication1
Mutagenesisi134V → D: Decreases interaction with ATG101; when associated with D-131. 1 Publication1
Mutagenesisi444F → A: Decreases interaction with MAP1LC3A. 1 Publication1
Mutagenesisi447I → A: Decreases interaction with MAP1LC3A. 1 Publication1

Organism-specific databases

OpenTargetsiENSG00000175224.
PharmGKBiPA165543187.

Polymorphism and mutation databases

BioMutaiATG13.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000507671 – 517Autophagy-related protein 13Add BLAST517

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei355Phosphoserine; by ULK1Combined sources1 Publication1
Modified residuei356PhosphoserineCombined sources1
Modified residuei361PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated by ULK1, ULK2 and mTOR. Phosphorylation status depends on nutrient-rich conditions; dephosphorylated during starvation or following treatment with rapamycin. ULK1-mediated phosphorylation of ATG13 at Ser-355 is required for efficient clearance of depolarized mitochondria.6 Publications

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiO75143.
MaxQBiO75143.
PeptideAtlasiO75143.
PRIDEiO75143.

PTM databases

iPTMnetiO75143.
PhosphoSitePlusiO75143.

Expressioni

Gene expression databases

BgeeiENSG00000175224.
CleanExiHS_KIAA0652.
ExpressionAtlasiO75143. baseline and differential.
GenevisibleiO75143. HS.

Organism-specific databases

HPAiHPA039350.

Interactioni

Subunit structurei

Part of a complex consisting of ATG13, ULK1 and RB1CC1 (PubMed:19597335, PubMed:19211835, PubMed:19225151, PubMed:24290141). Interacts with ATG101 (PubMed:19597335, PubMed:19287211, PubMed:26299944). Interacts with ULK1 (via C-terminus) (PubMed:19287211, PubMed:21855797, PubMed:18936157). Interacts with ULK2 (via C-terminus) (PubMed:19225151, PubMed:18936157). Interacts (via the LIR motif) with GABARAP, GABARAPL, GABARAPL2 (PubMed:23043107). Interacts (via the LIR motif) with MAP1LC3A, MAP1LC3B and MAP1LC3C (PubMed:24290141). Interacts with TAB2 and TAB3 (PubMed:21976705).10 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
ATG101Q9BSB410EBI-2798775,EBI-2946739
GABARAPL1Q9H0R82EBI-2798775,EBI-746969
GABARAPL2P605203EBI-2798775,EBI-720116
MAP1LC3BQ9GZQ82EBI-2798775,EBI-373144
RB1CC1Q8TDY29EBI-2798775,EBI-1047793
ULK1O753854EBI-2798775,EBI-908831

GO - Molecular functioni

  • protein kinase binding Source: UniProtKB

Protein-protein interaction databases

BioGridi115120. 21 interactors.
DIPiDIP-60540N.
IntActiO75143. 15 interactors.
MINTiMINT-8247472.

Structurei

Secondary structure

1517
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi12 – 30Combined sources19
Beta strandi33 – 35Combined sources3
Beta strandi42 – 44Combined sources3
Helixi59 – 69Combined sources11
Beta strandi78 – 88Combined sources11
Beta strandi93 – 103Combined sources11
Helixi114 – 131Combined sources18
Turni132 – 134Combined sources3
Helixi137 – 142Combined sources6
Beta strandi145 – 158Combined sources14
Beta strandi169 – 178Combined sources10
Beta strandi181 – 189Combined sources9

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3WANX-ray1.77A/B436-447[»]
3WAOX-ray2.60A/B/C/D436-447[»]
3WAPX-ray3.10A436-447[»]
5C50X-ray1.63B12-200[»]
ProteinModelPortaliO75143.
SMRiO75143.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni127 – 134Important for interaction with ATG1011 Publication8

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi444 – 447LIR1 Publication4

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi41 – 44Poly-Ser4

Domaini

The LIR motif (LC3-interacting region) is required for the interaction with the ATG8 family proteins GABARAP, GABARAPL, GABARAPL2, and MAP1LC3A.1 Publication

Sequence similaritiesi

Belongs to the ATG13 family. Metazoan subfamily.Curated

Phylogenomic databases

GeneTreeiENSGT00390000007055.
HOGENOMiHOG000008446.
InParanoidiO75143.
KOiK08331.
OMAiMCVEISL.
OrthoDBiEOG091G0TEK.
PhylomeDBiO75143.
TreeFamiTF321599.

Family and domain databases

InterProiIPR018731. Atg13.
[Graphical view]
PfamiPF10033. ATG13. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Experimental confirmation may be lacking for some isoforms.
Isoform 1 (identifier: O75143-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
METDLNSQDR KDLDKFIKFF ALKTVQVIVQ ARLGEKICTR SSSSPTGSDW
60 70 80 90 100
FNLAIKDIPE VTHEAKKALA GQLPAVGRSM CVEISLKTSE GDSMELEIWC
110 120 130 140 150
LEMNEKCDKE IKVSYTVYNR LSLLLKSLLA ITRVTPAYRL SRKQGHEYVI
160 170 180 190 200
LYRIYFGEVQ LSGLGEGFQT VRVGTVGTPV GTITLSCAYR INLAFMSTRQ
210 220 230 240 250
FERTPPIMGI IIDHFVDRPY PSSSPMHPCN YRTAGEDTGV IYPSVEDSQE
260 270 280 290 300
VCTTSFSTSP PSQLSSSRLS YQPAALGVGS ADLAYPVVFA AGLNATHPHQ
310 320 330 340 350
LMVPGKEGGV PLAPNQPVHG TQADQERLAT CTPSDRTHCA ATPSSSEDTE
360 370 380 390 400
TVSNSSEGRA SPHDVLETIF VRKVGAFVNK PINQVTLTSL DIPFAMFAPK
410 420 430 440 450
NLELEDTDPM VNPPDSPETE SPLQGSLHSD GSSGGSSGNT HDDFVMIDFK
460 470 480 490 500
PAFSKDDILP MDLGTFYREF QNPPQLSSLS IDIGAQSMAE DLDSLPEKLA
510
VHEKNVREFD AFVETLQ
Length:517
Mass (Da):56,572
Last modified:November 1, 1998 - v1
Checksum:i4D6905985EAB78A7
GO
Isoform 2 (identifier: O75143-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     265-301: Missing.

Show »
Length:480
Mass (Da):52,823
Checksum:i4EB66893A99956A1
GO
Isoform 3 (identifier: O75143-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     265-301: Missing.
     428-442: HSDGSSGGSSGNTHD → PCSWPLPCLLSPSTV
     443-517: Missing.

Show »
Length:405
Mass (Da):44,487
Checksum:iF2CE69C9082ABFA5
GO
Isoform 4 (identifier: O75143-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-79: Missing.
     263-299: Missing.

Show »
Length:401
Mass (Da):44,093
Checksum:i157846C39C54650F
GO
Isoform 5 (identifier: O75143-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     262-262: S → SQCVFTVTKAHFQTPTPVVTDTLRVPMAGLAFSH

Note: No experimental confirmation available.
Show »
Length:550
Mass (Da):60,155
Checksum:i0965E80906316BD0
GO

Sequence cautioni

The sequence BAA31627 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAD97323 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0445031 – 79Missing in isoform 4. 1 PublicationAdd BLAST79
Alternative sequenceiVSP_044640262S → SQCVFTVTKAHFQTPTPVVT DTLRVPMAGLAFSH in isoform 5. 1 Publication1
Alternative sequenceiVSP_044504263 – 299Missing in isoform 4. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_002431265 – 301Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST37
Alternative sequenceiVSP_002432428 – 442HSDGS…GNTHD → PCSWPLPCLLSPSTV in isoform 3. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_002433443 – 517Missing in isoform 3. 1 PublicationAdd BLAST75

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB014552 mRNA. Translation: BAA31627.2. Different initiation.
AK023867 mRNA. Translation: BAB14707.1.
AK294110 mRNA. Translation: BAG57445.1.
AK223603 mRNA. Translation: BAD97323.1. Different initiation.
AC115088 Genomic DNA. No translation available.
AC127035 Genomic DNA. No translation available.
CH471064 Genomic DNA. Translation: EAW67985.1.
CH471064 Genomic DNA. Translation: EAW67986.1.
CH471064 Genomic DNA. Translation: EAW67987.1.
CH471064 Genomic DNA. Translation: EAW67988.1.
CH471064 Genomic DNA. Translation: EAW67989.1.
CH471064 Genomic DNA. Translation: EAW67990.1.
CH471064 Genomic DNA. Translation: EAW67991.1.
BC001331 mRNA. Translation: AAH01331.1.
BC002378 mRNA. Translation: AAH02378.1.
BC006191 mRNA. Translation: AAH06191.1.
CCDSiCCDS44582.1. [O75143-1]
CCDS55760.1. [O75143-5]
CCDS55761.1. [O75143-4]
CCDS7921.1. [O75143-2]
RefSeqiNP_001136145.1. NM_001142673.2. [O75143-1]
NP_001192048.1. NM_001205119.1. [O75143-5]
NP_001192049.1. NM_001205120.1. [O75143-1]
NP_001192050.1. NM_001205121.1. [O75143-2]
NP_001192051.1. NM_001205122.1. [O75143-4]
NP_055556.2. NM_014741.4. [O75143-2]
XP_005253319.1. XM_005253262.2. [O75143-5]
XP_005253320.1. XM_005253263.2. [O75143-5]
XP_005253322.1. XM_005253265.2. [O75143-5]
XP_005253323.1. XM_005253266.2. [O75143-5]
XP_005253325.1. XM_005253268.2. [O75143-5]
XP_006718457.1. XM_006718394.2. [O75143-5]
XP_006718458.1. XM_006718395.2. [O75143-5]
XP_006718459.1. XM_006718396.2. [O75143-5]
XP_011518795.1. XM_011520493.1. [O75143-5]
XP_011518798.1. XM_011520496.2. [O75143-5]
XP_011518801.1. XM_011520499.2. [O75143-5]
XP_011518803.1. XM_011520501.1. [O75143-1]
XP_011518805.1. XM_011520503.1. [O75143-2]
XP_016874088.1. XM_017018599.1. [O75143-5]
XP_016874091.1. XM_017018602.1. [O75143-1]
XP_016874092.1. XM_017018603.1. [O75143-1]
XP_016874093.1. XM_017018604.1. [O75143-1]
XP_016874094.1. XM_017018605.1. [O75143-1]
XP_016874095.1. XM_017018606.1. [O75143-1]
XP_016874096.1. XM_017018607.1. [O75143-1]
XP_016874101.1. XM_017018612.1. [O75143-2]
XP_016874102.1. XM_017018613.1. [O75143-2]
XP_016874103.1. XM_017018614.1. [O75143-2]
XP_016874104.1. XM_017018615.1. [O75143-2]
XP_016874105.1. XM_017018616.1. [O75143-2]
XP_016874106.1. XM_017018617.1. [O75143-2]
UniGeneiHs.127403.

Genome annotation databases

EnsembliENST00000359513; ENSP00000352500; ENSG00000175224. [O75143-1]
ENST00000524625; ENSP00000433543; ENSG00000175224. [O75143-2]
ENST00000526508; ENSP00000431974; ENSG00000175224. [O75143-1]
ENST00000528494; ENSP00000432412; ENSG00000175224. [O75143-5]
ENST00000529655; ENSP00000433756; ENSG00000175224. [O75143-2]
ENST00000530500; ENSP00000434390; ENSG00000175224. [O75143-4]
GeneIDi9776.
KEGGihsa:9776.
UCSCiuc001ncz.4. human. [O75143-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB014552 mRNA. Translation: BAA31627.2. Different initiation.
AK023867 mRNA. Translation: BAB14707.1.
AK294110 mRNA. Translation: BAG57445.1.
AK223603 mRNA. Translation: BAD97323.1. Different initiation.
AC115088 Genomic DNA. No translation available.
AC127035 Genomic DNA. No translation available.
CH471064 Genomic DNA. Translation: EAW67985.1.
CH471064 Genomic DNA. Translation: EAW67986.1.
CH471064 Genomic DNA. Translation: EAW67987.1.
CH471064 Genomic DNA. Translation: EAW67988.1.
CH471064 Genomic DNA. Translation: EAW67989.1.
CH471064 Genomic DNA. Translation: EAW67990.1.
CH471064 Genomic DNA. Translation: EAW67991.1.
BC001331 mRNA. Translation: AAH01331.1.
BC002378 mRNA. Translation: AAH02378.1.
BC006191 mRNA. Translation: AAH06191.1.
CCDSiCCDS44582.1. [O75143-1]
CCDS55760.1. [O75143-5]
CCDS55761.1. [O75143-4]
CCDS7921.1. [O75143-2]
RefSeqiNP_001136145.1. NM_001142673.2. [O75143-1]
NP_001192048.1. NM_001205119.1. [O75143-5]
NP_001192049.1. NM_001205120.1. [O75143-1]
NP_001192050.1. NM_001205121.1. [O75143-2]
NP_001192051.1. NM_001205122.1. [O75143-4]
NP_055556.2. NM_014741.4. [O75143-2]
XP_005253319.1. XM_005253262.2. [O75143-5]
XP_005253320.1. XM_005253263.2. [O75143-5]
XP_005253322.1. XM_005253265.2. [O75143-5]
XP_005253323.1. XM_005253266.2. [O75143-5]
XP_005253325.1. XM_005253268.2. [O75143-5]
XP_006718457.1. XM_006718394.2. [O75143-5]
XP_006718458.1. XM_006718395.2. [O75143-5]
XP_006718459.1. XM_006718396.2. [O75143-5]
XP_011518795.1. XM_011520493.1. [O75143-5]
XP_011518798.1. XM_011520496.2. [O75143-5]
XP_011518801.1. XM_011520499.2. [O75143-5]
XP_011518803.1. XM_011520501.1. [O75143-1]
XP_011518805.1. XM_011520503.1. [O75143-2]
XP_016874088.1. XM_017018599.1. [O75143-5]
XP_016874091.1. XM_017018602.1. [O75143-1]
XP_016874092.1. XM_017018603.1. [O75143-1]
XP_016874093.1. XM_017018604.1. [O75143-1]
XP_016874094.1. XM_017018605.1. [O75143-1]
XP_016874095.1. XM_017018606.1. [O75143-1]
XP_016874096.1. XM_017018607.1. [O75143-1]
XP_016874101.1. XM_017018612.1. [O75143-2]
XP_016874102.1. XM_017018613.1. [O75143-2]
XP_016874103.1. XM_017018614.1. [O75143-2]
XP_016874104.1. XM_017018615.1. [O75143-2]
XP_016874105.1. XM_017018616.1. [O75143-2]
XP_016874106.1. XM_017018617.1. [O75143-2]
UniGeneiHs.127403.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3WANX-ray1.77A/B436-447[»]
3WAOX-ray2.60A/B/C/D436-447[»]
3WAPX-ray3.10A436-447[»]
5C50X-ray1.63B12-200[»]
ProteinModelPortaliO75143.
SMRiO75143.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115120. 21 interactors.
DIPiDIP-60540N.
IntActiO75143. 15 interactors.
MINTiMINT-8247472.

PTM databases

iPTMnetiO75143.
PhosphoSitePlusiO75143.

Polymorphism and mutation databases

BioMutaiATG13.

Proteomic databases

EPDiO75143.
MaxQBiO75143.
PeptideAtlasiO75143.
PRIDEiO75143.

Protocols and materials databases

DNASUi9776.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000359513; ENSP00000352500; ENSG00000175224. [O75143-1]
ENST00000524625; ENSP00000433543; ENSG00000175224. [O75143-2]
ENST00000526508; ENSP00000431974; ENSG00000175224. [O75143-1]
ENST00000528494; ENSP00000432412; ENSG00000175224. [O75143-5]
ENST00000529655; ENSP00000433756; ENSG00000175224. [O75143-2]
ENST00000530500; ENSP00000434390; ENSG00000175224. [O75143-4]
GeneIDi9776.
KEGGihsa:9776.
UCSCiuc001ncz.4. human. [O75143-1]

Organism-specific databases

CTDi9776.
GeneCardsiATG13.
HGNCiHGNC:29091. ATG13.
HPAiHPA039350.
MIMi615088. gene.
neXtProtiNX_O75143.
OpenTargetsiENSG00000175224.
PharmGKBiPA165543187.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00390000007055.
HOGENOMiHOG000008446.
InParanoidiO75143.
KOiK08331.
OMAiMCVEISL.
OrthoDBiEOG091G0TEK.
PhylomeDBiO75143.
TreeFamiTF321599.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000175224-MONOMER.
ReactomeiR-HSA-1632852. Macroautophagy.
SIGNORiO75143.

Miscellaneous databases

ChiTaRSiATG13. human.
GeneWikiiAutophagy-related_protein_13.
GenomeRNAii9776.
PROiO75143.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000175224.
CleanExiHS_KIAA0652.
ExpressionAtlasiO75143. baseline and differential.
GenevisibleiO75143. HS.

Family and domain databases

InterProiIPR018731. Atg13.
[Graphical view]
PfamiPF10033. ATG13. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiATG13_HUMAN
AccessioniPrimary (citable) accession number: O75143
Secondary accession number(s): B4DFI4
, D3DQQ1, D3DQQ2, E9PQZ8, Q53EN6, Q9BRL3, Q9H8B0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 23, 2002
Last sequence update: November 1, 1998
Last modified: November 2, 2016
This is version 133 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.