Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Astrotactin-2

Gene

ASTN2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Mediates recycling of the neuronal cell adhesion molecule ASTN1 to the anterior pole of the cell membrane in migrating neurons. Promotes ASTN1 internalization and intracellular transport of endocytosed ASTN1 (By similarity). Selectively binds inositol-4,5-bisphosphate, inositol-3,4,5-trisphosphate and inositol-1,3,4,5-tetrakisphosphate, suggesting it is recruited to membranes that contain lipids with a phosphoinositide headgroup (Ref. 6).By similarity1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Protein transport, Transport

Keywords - Ligandi

Calcium, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Astrotactin-2
Gene namesi
Name:ASTN2
Synonyms:KIAA0634
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

HGNCiHGNC:17021. ASTN2.

Subcellular locationi

  • Membrane By similarity; Multi-pass membrane protein By similarity
  • Perikaryon By similarity
  • Cytoplasmcell cortex By similarity
  • Early endosome By similarity
  • Late endosome By similarity
  • Cytoplasmic vesicleclathrin-coated vesicle By similarity
  • Cytoplasmic vesicle By similarity

  • Note: Integral membrane protein not detected at the cell membrane. Detected in cytoplasmic vesicles in the cell cortex, close to the anterior pole of migrating neurons. Detected at the base of the leading process in migrating neurons.By similarity

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini50 – 206LumenalCuratedAdd BLAST157
Transmembranei207 – 227HelicalSequence analysisAdd BLAST21
Topological domaini228 – 434CytoplasmicSequence analysisAdd BLAST207
Transmembranei435 – 455HelicalSequence analysisAdd BLAST21
Topological domaini456 – 1339LumenalCuratedAdd BLAST884

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoplasmic vesicle, Endosome, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi1175R → T: Abolishes inositol-4,5-bisphosphate binding. Strongly reduces affinity for inositol-3,4,5-trisphosphate. 1 Publication1

Organism-specific databases

DisGeNETi23245.
OpenTargetsiENSG00000148219.
PharmGKBiPA25076.

Polymorphism and mutation databases

BioMutaiASTN2.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 49Sequence analysisAdd BLAST49
ChainiPRO_000030825250 – 1339Astrotactin-2Add BLAST1290

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi168N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi514 ↔ 526By similarity
Disulfide bondi522 ↔ 533By similarity
Disulfide bondi535 ↔ 549By similarity
Disulfide bondi655 ↔ 668By similarity
Disulfide bondi662 ↔ 679By similarity
Disulfide bondi681 ↔ 694By similarity
Disulfide bondi703 ↔ 715By similarity
Disulfide bondi711 ↔ 735By similarity
Disulfide bondi737 ↔ 750By similarity
Glycosylationi770N-linked (GlcNAc...)1 Publication1
Glycosylationi783N-linked (GlcNAc...)1 Publication1
Disulfide bondi825 ↔ 9871 Publication
Disulfide bondi916 ↔ 9771 Publication
Disulfide bondi983 ↔ 9901 Publication
Glycosylationi1020N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi1036 ↔ 10471 Publication
Disulfide bondi1049 ↔ 10621 Publication
Disulfide bondi1136 ↔ 11581 Publication
Disulfide bondi1190 ↔ 12771 Publication
Disulfide bondi1298 ↔ 13211 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiO75129.
PeptideAtlasiO75129.
PRIDEiO75129.

PTM databases

iPTMnetiO75129.
PhosphoSitePlusiO75129.

Expressioni

Gene expression databases

BgeeiENSG00000148219.
CleanExiHS_ASTN2.
ExpressionAtlasiO75129. baseline and differential.
GenevisibleiO75129. HS.

Organism-specific databases

HPAiHPA027035.

Interactioni

Subunit structurei

Interacts with ASTN1; the interaction is not calcium-dependent.By similarity

Protein-protein interaction databases

BioGridi116849. 3 interactors.
STRINGi9606.ENSP00000354504.

Structurei

Secondary structure

11339
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Turni777 – 779Combined sources3
Beta strandi783 – 785Combined sources3
Beta strandi805 – 807Combined sources3
Beta strandi814 – 818Combined sources5
Turni821 – 825Combined sources5
Beta strandi826 – 829Combined sources4
Helixi836 – 839Combined sources4
Beta strandi840 – 843Combined sources4
Turni847 – 849Combined sources3
Beta strandi853 – 860Combined sources8
Beta strandi864 – 868Combined sources5
Helixi875 – 886Combined sources12
Helixi890 – 900Combined sources11
Beta strandi902 – 911Combined sources10
Beta strandi913 – 921Combined sources9
Helixi923 – 937Combined sources15
Helixi951 – 961Combined sources11
Turni962 – 964Combined sources3
Turni969 – 972Combined sources4
Beta strandi974 – 981Combined sources8
Beta strandi984 – 986Combined sources3
Beta strandi988 – 990Combined sources3
Turni993 – 995Combined sources3
Beta strandi997 – 999Combined sources3
Beta strandi1003 – 1012Combined sources10
Helixi1013 – 1016Combined sources4
Helixi1020 – 1035Combined sources16
Beta strandi1039 – 1043Combined sources5
Beta strandi1046 – 1049Combined sources4
Beta strandi1083 – 1088Combined sources6
Beta strandi1093 – 1095Combined sources3
Beta strandi1098 – 1108Combined sources11
Beta strandi1110 – 1113Combined sources4
Beta strandi1120 – 1123Combined sources4
Helixi1124 – 1128Combined sources5
Turni1134 – 1136Combined sources3
Beta strandi1137 – 1143Combined sources7
Beta strandi1145 – 1148Combined sources4
Beta strandi1150 – 1156Combined sources7
Beta strandi1164 – 1173Combined sources10
Beta strandi1182 – 1187Combined sources6
Helixi1195 – 1211Combined sources17
Helixi1215 – 1227Combined sources13
Helixi1230 – 1244Combined sources15
Helixi1245 – 1247Combined sources3
Helixi1250 – 1258Combined sources9
Helixi1260 – 1271Combined sources12
Helixi1275 – 1280Combined sources6
Beta strandi1283 – 1302Combined sources20
Helixi1314 – 1316Combined sources3
Beta strandi1319 – 1337Combined sources19

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5J67X-ray3.16A/B/C/D768-1339[»]
5J68X-ray5.22A768-1339[»]
5J69X-ray3.63A/B768-1033[»]
ProteinModelPortaliO75129.
SMRiO75129.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini510 – 550EGF-like 1Add BLAST41
Domaini651 – 695EGF-like 2Add BLAST45
Domaini699 – 751EGF-like 3Add BLAST53
Domaini1065 – 1188Fibronectin type-IIIAdd BLAST124

Domaini

The C-terminal region after the fibronectin type-III domain presents structural similarity to annexin domains and binds calcium ions.1 Publication

Sequence similaritiesi

Belongs to the astrotactin family.Curated
Contains 3 EGF-like domains.Curated
Contains 1 fibronectin type-III domain.Curated

Keywords - Domaini

EGF-like domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IHIU. Eukaryota.
ENOG4110VB2. LUCA.
GeneTreeiENSGT00390000003140.
HOVERGENiHBG050597.
InParanoidiO75129.
OMAiDDYDCEE.
OrthoDBiEOG091G00IB.
PhylomeDBiO75129.
TreeFamiTF332034.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR026995. Astrotactin.
IPR003961. FN3_dom.
IPR013783. Ig-like_fold.
IPR020864. MACPF.
[Graphical view]
PANTHERiPTHR16592. PTHR16592. 2 hits.
PfamiPF01823. MACPF. 1 hit.
[Graphical view]
SMARTiSM00457. MACPF. 1 hit.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 2 hits.

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O75129-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAAGARLSP GPGSGLRGRP RLCFHPGPPP LLPLLLLFLL LLPPPPLLAG
60 70 80 90 100
ATAAASREPD SPCRLKTVTV STLPALRESD IGWSGARAGA GAGTGAGAAA
110 120 130 140 150
AAASPGSPGS AGTAAESRLL LFVRNELPGR IAVQDDLDNT ELPFFTLEMS
160 170 180 190 200
GTAADISLVH WRQQWLENGT LYFHVSMSSS GQLAQATAPT LQEPSEIVEE
210 220 230 240 250
QMHILHISVM GGLIALLLLL LVFTVALYAQ RRWQKRRRIP QKSASTEATH
260 270 280 290 300
EIHYIPSVLL GPQARESFRS SRLQTHNSVI GVPIRETPIL DDYDCEEDEE
310 320 330 340 350
PPRRANHVSR EDEFGSQVTH TLDSLGHPGE EKVDFEKKAA AEATQETVES
360 370 380 390 400
LMQKFKESFR ANTPIEIGQL QPPLRSTSAG KRKRRSKSRG GISFGRAKGT
410 420 430 440 450
SGSEADDETQ LTFYTEQYRS RRRSKGLLKS PVNKTALTLI AVSSCILAMV
460 470 480 490 500
CGSQMSCPLT VKVTLHVPEH FIADGSSFVV SEGSYLDISD WLNPAKLSLY
510 520 530 540 550
YQINATSPWV RDLCGQRTTD ACEQLCDPET GECSCHEGYA PDPVHRHLCV
560 570 580 590 600
RSDWGQSEGP WPYTTLERGY DLVTGEQAPE KILRSTFSLG QGLWLPVSKS
610 620 630 640 650
FVVPPVELSI NPLASCKTDV LVTEDPADVR EEAMLSTYFE TINDLLSSFG
660 670 680 690 700
PVRDCSRNNG GCTRNFKCVS DRQVDSSGCV CPEELKPMKD GSGCYDHSKG
710 720 730 740 750
IDCSDGFNGG CEQLCLQQTL PLPYDATSST IFMFCGCVEE YKLAPDGKSC
760 770 780 790 800
LMLSDVCEGP KCLKPDSKFN DTLFGEMLHG YNNRTQHVNQ GQVFQMTFRE
810 820 830 840 850
NNFIKDFPQL ADGLLVIPLP VEEQCRGVLS EPLPDLQLLT GDIRYDEAMG
860 870 880 890 900
YPMVQQWRVR SNLYRVKLST ITLAAGFTNV LKILTKESSR EELLSFIQHY
910 920 930 940 950
GSHYIAEALY GSELTCIIHF PSKKVQQQLW LQYQKETTEL GSKKELKSMP
960 970 980 990 1000
FITYLSGLLT AQMLSDDQLI SGVEIRCEEK GRCPSTCHLC RRPGKEQLSP
1010 1020 1030 1040 1050
TPVLLEINRV VPLYTLIQDN GTKEAFKSAL MSSYWCSGKG DVIDDWCRCD
1060 1070 1080 1090 1100
LSAFDANGLP NCSPLLQPVL RLSPTVEPSS TVVSLEWVDV QPAIGTKVSD
1110 1120 1130 1140 1150
YILQHKKVDE YTDTDLYTGE FLSFADDLLS GLGTSCVAAG RSHGEVPEVS
1160 1170 1180 1190 1200
IYSVIFKCLE PDGLYKFTLY AVDTRGRHSE LSTVTLRTAC PLVDDNKAEE
1210 1220 1230 1240 1250
IADKIYNLYN GYTSGKEQQM AYNTLMEVSA SMLFRVQHHY NSHYEKFGDF
1260 1270 1280 1290 1300
VWRSEDELGP RKAHLILRRL ERVSSHCSSL LRSAYIQSRV ETVPYLFCRS
1310 1320 1330
EEVRPAGMVW YSILKDTKIT CEEKMVSMAR NTYGESKGR
Length:1,339
Mass (Da):148,243
Last modified:October 23, 2007 - v2
Checksum:i7B914F1A736F798F
GO
Isoform 2 (identifier: O75129-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     339-389: Missing.

Show »
Length:1,288
Mass (Da):142,544
Checksum:i7136F3D8ACFE0733
GO
Isoform 3 (identifier: O75129-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     584-587: Missing.

Show »
Length:1,335
Mass (Da):147,752
Checksum:i598978297C7DC986
GO
Isoform 4 (identifier: O75129-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-899: Missing.
     900-935: YGSHYIAEALYGSELTCIIHFPSKKVQQQLWLQYQK → MNTLLCKGMFCLLSWEADSRGRLGEYTLQPLSLQTE

Note: No experimental confirmation available.
Show »
Length:440
Mass (Da):49,558
Checksum:iCAF4E32F3DFBA9DA
GO
Isoform 6 (identifier: O75129-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-948: Missing.
     1334-1339: GESKGR → YLTLSKVSPF

Show »
Length:395
Mass (Da):44,561
Checksum:i54514BC7B749E4B8
GO

Sequence cautioni

The sequence AAF14357 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAA31609 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti1320T → M in AAH29272 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03676570V → I.Corresponds to variant rs16933591dbSNPEnsembl.1
Natural variantiVAR_064699229A → V Found in a clear cell renal carcinoma case; somatic mutation. 1 Publication1
Natural variantiVAR_036766865R → H.Corresponds to variant rs3818503dbSNPEnsembl.1
Natural variantiVAR_0367671149V → I.Corresponds to variant rs16933591dbSNPEnsembl.1
Natural variantiVAR_0367681293V → L in a breast cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0289301 – 948Missing in isoform 6. 1 PublicationAdd BLAST948
Alternative sequenceiVSP_0289311 – 899Missing in isoform 4. 1 PublicationAdd BLAST899
Alternative sequenceiVSP_028932339 – 389Missing in isoform 2. 3 PublicationsAdd BLAST51
Alternative sequenceiVSP_028933584 – 587Missing in isoform 3. 1 Publication4
Alternative sequenceiVSP_028934900 – 935YGSHY…LQYQK → MNTLLCKGMFCLLSWEADSR GRLGEYTLQPLSLQTE in isoform 4. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_0289371334 – 1339GESKGR → YLTLSKVSPF in isoform 6. 1 Publication6

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB014534 mRNA. Translation: BAA31609.1. Different initiation.
AL133284, AL133282, AL137024 Genomic DNA. Translation: CAM22874.1.
AL133284
, AL133282, AL137024, AL157829, AL354981, AL355608, AL358792, AL392085 Genomic DNA. Translation: CAI16371.1.
AL358792
, AL133282, AL133284, AL137024, AL157829, AL354981, AL355608, AL392085 Genomic DNA. Translation: CAH71966.1.
AL157829
, AL133282, AL133284, AL137024, AL354981, AL355608, AL358792, AL392085 Genomic DNA. Translation: CAH72264.1.
AL133284 Genomic DNA. Translation: CAI16369.1.
AL133284, AL133282, AL137024 Genomic DNA. Translation: CAI16370.1.
AL133282
, AL133284, AL137024, AL157829, AL354981, AL355608, AL358792, AL392085 Genomic DNA. Translation: CAI39864.1.
AL133282, AL133284, AL137024 Genomic DNA. Translation: CAM15245.1.
BC018759 mRNA. Translation: AAH18759.2.
BC029272 mRNA. Translation: AAH29272.1.
BC093835 mRNA. Translation: AAH93835.2.
BC101667 mRNA. Translation: AAI01668.1.
BC146756 mRNA. Translation: AAI46757.1.
AF116574 mRNA. Translation: AAF14357.1. Different initiation.
DA336442 mRNA. No translation available.
CCDSiCCDS48009.2. [O75129-4]
CCDS6814.1. [O75129-6]
CCDS6815.1. [O75129-2]
PIRiT00382.
RefSeqiNP_054729.3. NM_014010.4. [O75129-2]
NP_937829.3. NM_198186.3. [O75129-4]
NP_937831.1. NM_198188.2. [O75129-6]
UniGeneiHs.601562.

Genome annotation databases

EnsembliENST00000288520; ENSP00000288520; ENSG00000148219. [O75129-4]
ENST00000313400; ENSP00000314038; ENSG00000148219. [O75129-1]
ENST00000341734; ENSP00000339925; ENSG00000148219. [O75129-6]
ENST00000361209; ENSP00000354504; ENSG00000148219. [O75129-2]
GeneIDi23245.
KEGGihsa:23245.
UCSCiuc004bjp.3. human. [O75129-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB014534 mRNA. Translation: BAA31609.1. Different initiation.
AL133284, AL133282, AL137024 Genomic DNA. Translation: CAM22874.1.
AL133284
, AL133282, AL137024, AL157829, AL354981, AL355608, AL358792, AL392085 Genomic DNA. Translation: CAI16371.1.
AL358792
, AL133282, AL133284, AL137024, AL157829, AL354981, AL355608, AL392085 Genomic DNA. Translation: CAH71966.1.
AL157829
, AL133282, AL133284, AL137024, AL354981, AL355608, AL358792, AL392085 Genomic DNA. Translation: CAH72264.1.
AL133284 Genomic DNA. Translation: CAI16369.1.
AL133284, AL133282, AL137024 Genomic DNA. Translation: CAI16370.1.
AL133282
, AL133284, AL137024, AL157829, AL354981, AL355608, AL358792, AL392085 Genomic DNA. Translation: CAI39864.1.
AL133282, AL133284, AL137024 Genomic DNA. Translation: CAM15245.1.
BC018759 mRNA. Translation: AAH18759.2.
BC029272 mRNA. Translation: AAH29272.1.
BC093835 mRNA. Translation: AAH93835.2.
BC101667 mRNA. Translation: AAI01668.1.
BC146756 mRNA. Translation: AAI46757.1.
AF116574 mRNA. Translation: AAF14357.1. Different initiation.
DA336442 mRNA. No translation available.
CCDSiCCDS48009.2. [O75129-4]
CCDS6814.1. [O75129-6]
CCDS6815.1. [O75129-2]
PIRiT00382.
RefSeqiNP_054729.3. NM_014010.4. [O75129-2]
NP_937829.3. NM_198186.3. [O75129-4]
NP_937831.1. NM_198188.2. [O75129-6]
UniGeneiHs.601562.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5J67X-ray3.16A/B/C/D768-1339[»]
5J68X-ray5.22A768-1339[»]
5J69X-ray3.63A/B768-1033[»]
ProteinModelPortaliO75129.
SMRiO75129.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116849. 3 interactors.
STRINGi9606.ENSP00000354504.

PTM databases

iPTMnetiO75129.
PhosphoSitePlusiO75129.

Polymorphism and mutation databases

BioMutaiASTN2.

Proteomic databases

PaxDbiO75129.
PeptideAtlasiO75129.
PRIDEiO75129.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000288520; ENSP00000288520; ENSG00000148219. [O75129-4]
ENST00000313400; ENSP00000314038; ENSG00000148219. [O75129-1]
ENST00000341734; ENSP00000339925; ENSG00000148219. [O75129-6]
ENST00000361209; ENSP00000354504; ENSG00000148219. [O75129-2]
GeneIDi23245.
KEGGihsa:23245.
UCSCiuc004bjp.3. human. [O75129-1]

Organism-specific databases

CTDi23245.
DisGeNETi23245.
GeneCardsiASTN2.
HGNCiHGNC:17021. ASTN2.
HPAiHPA027035.
MIMi612856. gene.
neXtProtiNX_O75129.
OpenTargetsiENSG00000148219.
PharmGKBiPA25076.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IHIU. Eukaryota.
ENOG4110VB2. LUCA.
GeneTreeiENSGT00390000003140.
HOVERGENiHBG050597.
InParanoidiO75129.
OMAiDDYDCEE.
OrthoDBiEOG091G00IB.
PhylomeDBiO75129.
TreeFamiTF332034.

Miscellaneous databases

ChiTaRSiASTN2. human.
GenomeRNAii23245.
PROiO75129.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000148219.
CleanExiHS_ASTN2.
ExpressionAtlasiO75129. baseline and differential.
GenevisibleiO75129. HS.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR026995. Astrotactin.
IPR003961. FN3_dom.
IPR013783. Ig-like_fold.
IPR020864. MACPF.
[Graphical view]
PANTHERiPTHR16592. PTHR16592. 2 hits.
PfamiPF01823. MACPF. 1 hit.
[Graphical view]
SMARTiSM00457. MACPF. 1 hit.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 2 hits.
ProtoNetiSearch...

Entry informationi

Entry nameiASTN2_HUMAN
AccessioniPrimary (citable) accession number: O75129
Secondary accession number(s): A2A2T7
, A2A2T9, Q52LQ2, Q5JVX8, Q5JVX9, Q5JVY1, Q5VXG8, Q5VZX6, Q8N6P8, Q8WV47, Q96FL4, Q9UHW6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: October 23, 2007
Last modified: November 30, 2016
This is version 121 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.