Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Astrotactin-2

Gene

ASTN2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Mediates recycling of the neuronal cell adhesion molecule ASTN1 to the anterior pole of the cell membrane in migrating neurons. Promotes ASTN1 internalization and intracellular transport of endocytosed ASTN1 (By similarity). Selectively binds inositol-4,5-bisphosphate, inositol-3,4,5-trisphosphate and inositol-1,3,4,5-tetrakisphosphate, suggesting it is recruited to membranes that contain lipids with a phosphoinositide headgroup (Ref. 6).By similarity1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Protein transport, Transport

Keywords - Ligandi

Calcium, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Astrotactin-2
Gene namesi
Name:ASTN2
Synonyms:KIAA0634
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

HGNCiHGNC:17021. ASTN2.

Subcellular locationi

  • Membrane By similarity; Multi-pass membrane protein By similarity
  • Perikaryon By similarity
  • Cytoplasmcell cortex By similarity
  • Early endosome By similarity
  • Late endosome By similarity
  • Cytoplasmic vesicleclathrin-coated vesicle By similarity
  • Cytoplasmic vesicle By similarity

  • Note: Integral membrane protein not detected at the cell membrane. Detected in cytoplasmic vesicles in the cell cortex, close to the anterior pole of migrating neurons. Detected at the base of the leading process in migrating neurons.By similarity

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini50 – 206157LumenalCuratedAdd
BLAST
Transmembranei207 – 22721HelicalSequence analysisAdd
BLAST
Topological domaini228 – 434207CytoplasmicSequence analysisAdd
BLAST
Transmembranei435 – 45521HelicalSequence analysisAdd
BLAST
Topological domaini456 – 1339884LumenalCuratedAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoplasmic vesicle, Endosome, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi1175 – 11751R → T: Abolishes inositol-4,5-bisphosphate binding. Strongly reduces affinity for inositol-3,4,5-trisphosphate. 1 Publication

Organism-specific databases

PharmGKBiPA25076.

Polymorphism and mutation databases

BioMutaiASTN2.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 4949Sequence analysisAdd
BLAST
Chaini50 – 13391290Astrotactin-2PRO_0000308252Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi168 – 1681N-linked (GlcNAc...)Sequence analysis
Disulfide bondi514 ↔ 526By similarity
Disulfide bondi522 ↔ 533By similarity
Disulfide bondi535 ↔ 549By similarity
Disulfide bondi655 ↔ 668By similarity
Disulfide bondi662 ↔ 679By similarity
Disulfide bondi681 ↔ 694By similarity
Disulfide bondi703 ↔ 715By similarity
Disulfide bondi711 ↔ 735By similarity
Disulfide bondi737 ↔ 750By similarity
Glycosylationi770 – 7701N-linked (GlcNAc...)1 Publication
Glycosylationi783 – 7831N-linked (GlcNAc...)1 Publication
Disulfide bondi825 ↔ 9871 Publication
Disulfide bondi916 ↔ 9771 Publication
Disulfide bondi983 ↔ 9901 Publication
Glycosylationi1020 – 10201N-linked (GlcNAc...)Sequence analysis
Disulfide bondi1036 ↔ 10471 Publication
Disulfide bondi1049 ↔ 10621 Publication
Disulfide bondi1136 ↔ 11581 Publication
Disulfide bondi1190 ↔ 12771 Publication
Disulfide bondi1298 ↔ 13211 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiO75129.
PeptideAtlasiO75129.
PRIDEiO75129.

PTM databases

iPTMnetiO75129.
PhosphoSiteiO75129.

Expressioni

Gene expression databases

BgeeiENSG00000148219.
CleanExiHS_ASTN2.
ExpressionAtlasiO75129. baseline and differential.
GenevisibleiO75129. HS.

Organism-specific databases

HPAiHPA027035.

Interactioni

Subunit structurei

Interacts with ASTN1; the interaction is not calcium-dependent.By similarity

Protein-protein interaction databases

BioGridi116849. 3 interactions.
STRINGi9606.ENSP00000354504.

Structurei

Secondary structure

1
1339
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Turni777 – 7793Combined sources
Beta strandi783 – 7853Combined sources
Beta strandi805 – 8073Combined sources
Beta strandi814 – 8185Combined sources
Turni821 – 8255Combined sources
Beta strandi826 – 8294Combined sources
Helixi836 – 8394Combined sources
Beta strandi840 – 8434Combined sources
Turni847 – 8493Combined sources
Beta strandi853 – 8608Combined sources
Beta strandi864 – 8685Combined sources
Helixi875 – 88612Combined sources
Helixi890 – 90011Combined sources
Beta strandi902 – 91110Combined sources
Beta strandi913 – 9219Combined sources
Helixi923 – 93715Combined sources
Helixi951 – 96111Combined sources
Turni962 – 9643Combined sources
Turni969 – 9724Combined sources
Beta strandi974 – 9818Combined sources
Beta strandi984 – 9863Combined sources
Beta strandi988 – 9903Combined sources
Turni993 – 9953Combined sources
Beta strandi997 – 9993Combined sources
Beta strandi1003 – 101210Combined sources
Helixi1013 – 10164Combined sources
Helixi1020 – 103516Combined sources
Beta strandi1039 – 10435Combined sources
Beta strandi1046 – 10494Combined sources
Beta strandi1083 – 10886Combined sources
Beta strandi1093 – 10953Combined sources
Beta strandi1098 – 110811Combined sources
Beta strandi1110 – 11134Combined sources
Beta strandi1120 – 11234Combined sources
Helixi1124 – 11285Combined sources
Turni1134 – 11363Combined sources
Beta strandi1137 – 11437Combined sources
Beta strandi1145 – 11484Combined sources
Beta strandi1150 – 11567Combined sources
Beta strandi1164 – 117310Combined sources
Beta strandi1182 – 11876Combined sources
Helixi1195 – 121117Combined sources
Helixi1215 – 122713Combined sources
Helixi1230 – 124415Combined sources
Helixi1245 – 12473Combined sources
Helixi1250 – 12589Combined sources
Helixi1260 – 127112Combined sources
Helixi1275 – 12806Combined sources
Beta strandi1283 – 130220Combined sources
Helixi1314 – 13163Combined sources
Beta strandi1319 – 133719Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
5J67X-ray3.16A/B/C/D768-1339[»]
5J68X-ray5.22A768-1339[»]
5J69X-ray3.63A/B768-1033[»]
ProteinModelPortaliO75129.
SMRiO75129. Positions 655-752.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini510 – 55041EGF-like 1Add
BLAST
Domaini651 – 69545EGF-like 2Add
BLAST
Domaini699 – 75153EGF-like 3Add
BLAST
Domaini1065 – 1188124Fibronectin type-IIIAdd
BLAST

Domaini

The C-terminal region after the fibronectin type-III domain presents structural similarity to annexin domains and binds calcium ions.1 Publication

Sequence similaritiesi

Belongs to the astrotactin family.Curated
Contains 3 EGF-like domains.Curated
Contains 1 fibronectin type-III domain.Curated

Keywords - Domaini

EGF-like domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IHIU. Eukaryota.
ENOG4110VB2. LUCA.
GeneTreeiENSGT00390000003140.
HOVERGENiHBG050597.
InParanoidiO75129.
OMAiDDYDCEE.
OrthoDBiEOG091G00IB.
PhylomeDBiO75129.
TreeFamiTF332034.

Family and domain databases

InterProiIPR026995. Astrotactin.
IPR003961. FN3_dom.
IPR020864. MACPF.
[Graphical view]
PANTHERiPTHR16592. PTHR16592. 2 hits.
PfamiPF01823. MACPF. 1 hit.
[Graphical view]
SMARTiSM00457. MACPF. 1 hit.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 2 hits.

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O75129-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAAGARLSP GPGSGLRGRP RLCFHPGPPP LLPLLLLFLL LLPPPPLLAG
60 70 80 90 100
ATAAASREPD SPCRLKTVTV STLPALRESD IGWSGARAGA GAGTGAGAAA
110 120 130 140 150
AAASPGSPGS AGTAAESRLL LFVRNELPGR IAVQDDLDNT ELPFFTLEMS
160 170 180 190 200
GTAADISLVH WRQQWLENGT LYFHVSMSSS GQLAQATAPT LQEPSEIVEE
210 220 230 240 250
QMHILHISVM GGLIALLLLL LVFTVALYAQ RRWQKRRRIP QKSASTEATH
260 270 280 290 300
EIHYIPSVLL GPQARESFRS SRLQTHNSVI GVPIRETPIL DDYDCEEDEE
310 320 330 340 350
PPRRANHVSR EDEFGSQVTH TLDSLGHPGE EKVDFEKKAA AEATQETVES
360 370 380 390 400
LMQKFKESFR ANTPIEIGQL QPPLRSTSAG KRKRRSKSRG GISFGRAKGT
410 420 430 440 450
SGSEADDETQ LTFYTEQYRS RRRSKGLLKS PVNKTALTLI AVSSCILAMV
460 470 480 490 500
CGSQMSCPLT VKVTLHVPEH FIADGSSFVV SEGSYLDISD WLNPAKLSLY
510 520 530 540 550
YQINATSPWV RDLCGQRTTD ACEQLCDPET GECSCHEGYA PDPVHRHLCV
560 570 580 590 600
RSDWGQSEGP WPYTTLERGY DLVTGEQAPE KILRSTFSLG QGLWLPVSKS
610 620 630 640 650
FVVPPVELSI NPLASCKTDV LVTEDPADVR EEAMLSTYFE TINDLLSSFG
660 670 680 690 700
PVRDCSRNNG GCTRNFKCVS DRQVDSSGCV CPEELKPMKD GSGCYDHSKG
710 720 730 740 750
IDCSDGFNGG CEQLCLQQTL PLPYDATSST IFMFCGCVEE YKLAPDGKSC
760 770 780 790 800
LMLSDVCEGP KCLKPDSKFN DTLFGEMLHG YNNRTQHVNQ GQVFQMTFRE
810 820 830 840 850
NNFIKDFPQL ADGLLVIPLP VEEQCRGVLS EPLPDLQLLT GDIRYDEAMG
860 870 880 890 900
YPMVQQWRVR SNLYRVKLST ITLAAGFTNV LKILTKESSR EELLSFIQHY
910 920 930 940 950
GSHYIAEALY GSELTCIIHF PSKKVQQQLW LQYQKETTEL GSKKELKSMP
960 970 980 990 1000
FITYLSGLLT AQMLSDDQLI SGVEIRCEEK GRCPSTCHLC RRPGKEQLSP
1010 1020 1030 1040 1050
TPVLLEINRV VPLYTLIQDN GTKEAFKSAL MSSYWCSGKG DVIDDWCRCD
1060 1070 1080 1090 1100
LSAFDANGLP NCSPLLQPVL RLSPTVEPSS TVVSLEWVDV QPAIGTKVSD
1110 1120 1130 1140 1150
YILQHKKVDE YTDTDLYTGE FLSFADDLLS GLGTSCVAAG RSHGEVPEVS
1160 1170 1180 1190 1200
IYSVIFKCLE PDGLYKFTLY AVDTRGRHSE LSTVTLRTAC PLVDDNKAEE
1210 1220 1230 1240 1250
IADKIYNLYN GYTSGKEQQM AYNTLMEVSA SMLFRVQHHY NSHYEKFGDF
1260 1270 1280 1290 1300
VWRSEDELGP RKAHLILRRL ERVSSHCSSL LRSAYIQSRV ETVPYLFCRS
1310 1320 1330
EEVRPAGMVW YSILKDTKIT CEEKMVSMAR NTYGESKGR
Length:1,339
Mass (Da):148,243
Last modified:October 23, 2007 - v2
Checksum:i7B914F1A736F798F
GO
Isoform 2 (identifier: O75129-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     339-389: Missing.

Show »
Length:1,288
Mass (Da):142,544
Checksum:i7136F3D8ACFE0733
GO
Isoform 3 (identifier: O75129-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     584-587: Missing.

Show »
Length:1,335
Mass (Da):147,752
Checksum:i598978297C7DC986
GO
Isoform 4 (identifier: O75129-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-899: Missing.
     900-935: YGSHYIAEALYGSELTCIIHFPSKKVQQQLWLQYQK → MNTLLCKGMFCLLSWEADSRGRLGEYTLQPLSLQTE

Note: No experimental confirmation available.
Show »
Length:440
Mass (Da):49,558
Checksum:iCAF4E32F3DFBA9DA
GO
Isoform 6 (identifier: O75129-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-948: Missing.
     1334-1339: GESKGR → YLTLSKVSPF

Show »
Length:395
Mass (Da):44,561
Checksum:i54514BC7B749E4B8
GO

Sequence cautioni

The sequence AAF14357 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAA31609 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti1320 – 13201T → M in AAH29272 (PubMed:15489334).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti70 – 701V → I.
Corresponds to variant rs16933591 [ dbSNP | Ensembl ].
VAR_036765
Natural varianti229 – 2291A → V Found in a clear cell renal carcinoma case; somatic mutation. 1 Publication
VAR_064699
Natural varianti865 – 8651R → H.
Corresponds to variant rs3818503 [ dbSNP | Ensembl ].
VAR_036766
Natural varianti1149 – 11491V → I.
Corresponds to variant rs16933591 [ dbSNP | Ensembl ].
VAR_036767
Natural varianti1293 – 12931V → L in a breast cancer sample; somatic mutation. 1 Publication
VAR_036768

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 948948Missing in isoform 6. 1 PublicationVSP_028930Add
BLAST
Alternative sequencei1 – 899899Missing in isoform 4. 1 PublicationVSP_028931Add
BLAST
Alternative sequencei339 – 38951Missing in isoform 2. 3 PublicationsVSP_028932Add
BLAST
Alternative sequencei584 – 5874Missing in isoform 3. 1 PublicationVSP_028933
Alternative sequencei900 – 93536YGSHY…LQYQK → MNTLLCKGMFCLLSWEADSR GRLGEYTLQPLSLQTE in isoform 4. 1 PublicationVSP_028934Add
BLAST
Alternative sequencei1334 – 13396GESKGR → YLTLSKVSPF in isoform 6. 1 PublicationVSP_028937

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB014534 mRNA. Translation: BAA31609.1. Different initiation.
AL133284, AL133282, AL137024 Genomic DNA. Translation: CAM22874.1.
AL133284
, AL133282, AL137024, AL157829, AL354981, AL355608, AL358792, AL392085 Genomic DNA. Translation: CAI16371.1.
AL358792
, AL133282, AL133284, AL137024, AL157829, AL354981, AL355608, AL392085 Genomic DNA. Translation: CAH71966.1.
AL157829
, AL133282, AL133284, AL137024, AL354981, AL355608, AL358792, AL392085 Genomic DNA. Translation: CAH72264.1.
AL133284 Genomic DNA. Translation: CAI16369.1.
AL133284, AL133282, AL137024 Genomic DNA. Translation: CAI16370.1.
AL133282
, AL133284, AL137024, AL157829, AL354981, AL355608, AL358792, AL392085 Genomic DNA. Translation: CAI39864.1.
AL133282, AL133284, AL137024 Genomic DNA. Translation: CAM15245.1.
BC018759 mRNA. Translation: AAH18759.2.
BC029272 mRNA. Translation: AAH29272.1.
BC093835 mRNA. Translation: AAH93835.2.
BC101667 mRNA. Translation: AAI01668.1.
BC146756 mRNA. Translation: AAI46757.1.
AF116574 mRNA. Translation: AAF14357.1. Different initiation.
DA336442 mRNA. No translation available.
CCDSiCCDS48009.2. [O75129-4]
CCDS6814.1. [O75129-6]
CCDS6815.1. [O75129-2]
PIRiT00382.
RefSeqiNP_054729.3. NM_014010.4. [O75129-2]
NP_937829.3. NM_198186.3. [O75129-4]
NP_937831.1. NM_198188.2. [O75129-6]
UniGeneiHs.601562.

Genome annotation databases

EnsembliENST00000288520; ENSP00000288520; ENSG00000148219. [O75129-4]
ENST00000313400; ENSP00000314038; ENSG00000148219. [O75129-1]
ENST00000341734; ENSP00000339925; ENSG00000148219. [O75129-6]
ENST00000361209; ENSP00000354504; ENSG00000148219. [O75129-2]
GeneIDi23245.
KEGGihsa:23245.
UCSCiuc004bjp.3. human. [O75129-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB014534 mRNA. Translation: BAA31609.1. Different initiation.
AL133284, AL133282, AL137024 Genomic DNA. Translation: CAM22874.1.
AL133284
, AL133282, AL137024, AL157829, AL354981, AL355608, AL358792, AL392085 Genomic DNA. Translation: CAI16371.1.
AL358792
, AL133282, AL133284, AL137024, AL157829, AL354981, AL355608, AL392085 Genomic DNA. Translation: CAH71966.1.
AL157829
, AL133282, AL133284, AL137024, AL354981, AL355608, AL358792, AL392085 Genomic DNA. Translation: CAH72264.1.
AL133284 Genomic DNA. Translation: CAI16369.1.
AL133284, AL133282, AL137024 Genomic DNA. Translation: CAI16370.1.
AL133282
, AL133284, AL137024, AL157829, AL354981, AL355608, AL358792, AL392085 Genomic DNA. Translation: CAI39864.1.
AL133282, AL133284, AL137024 Genomic DNA. Translation: CAM15245.1.
BC018759 mRNA. Translation: AAH18759.2.
BC029272 mRNA. Translation: AAH29272.1.
BC093835 mRNA. Translation: AAH93835.2.
BC101667 mRNA. Translation: AAI01668.1.
BC146756 mRNA. Translation: AAI46757.1.
AF116574 mRNA. Translation: AAF14357.1. Different initiation.
DA336442 mRNA. No translation available.
CCDSiCCDS48009.2. [O75129-4]
CCDS6814.1. [O75129-6]
CCDS6815.1. [O75129-2]
PIRiT00382.
RefSeqiNP_054729.3. NM_014010.4. [O75129-2]
NP_937829.3. NM_198186.3. [O75129-4]
NP_937831.1. NM_198188.2. [O75129-6]
UniGeneiHs.601562.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
5J67X-ray3.16A/B/C/D768-1339[»]
5J68X-ray5.22A768-1339[»]
5J69X-ray3.63A/B768-1033[»]
ProteinModelPortaliO75129.
SMRiO75129. Positions 655-752.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116849. 3 interactions.
STRINGi9606.ENSP00000354504.

PTM databases

iPTMnetiO75129.
PhosphoSiteiO75129.

Polymorphism and mutation databases

BioMutaiASTN2.

Proteomic databases

PaxDbiO75129.
PeptideAtlasiO75129.
PRIDEiO75129.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000288520; ENSP00000288520; ENSG00000148219. [O75129-4]
ENST00000313400; ENSP00000314038; ENSG00000148219. [O75129-1]
ENST00000341734; ENSP00000339925; ENSG00000148219. [O75129-6]
ENST00000361209; ENSP00000354504; ENSG00000148219. [O75129-2]
GeneIDi23245.
KEGGihsa:23245.
UCSCiuc004bjp.3. human. [O75129-1]

Organism-specific databases

CTDi23245.
GeneCardsiASTN2.
HGNCiHGNC:17021. ASTN2.
HPAiHPA027035.
MIMi612856. gene.
neXtProtiNX_O75129.
PharmGKBiPA25076.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IHIU. Eukaryota.
ENOG4110VB2. LUCA.
GeneTreeiENSGT00390000003140.
HOVERGENiHBG050597.
InParanoidiO75129.
OMAiDDYDCEE.
OrthoDBiEOG091G00IB.
PhylomeDBiO75129.
TreeFamiTF332034.

Miscellaneous databases

ChiTaRSiASTN2. human.
GenomeRNAii23245.
PROiO75129.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000148219.
CleanExiHS_ASTN2.
ExpressionAtlasiO75129. baseline and differential.
GenevisibleiO75129. HS.

Family and domain databases

InterProiIPR026995. Astrotactin.
IPR003961. FN3_dom.
IPR020864. MACPF.
[Graphical view]
PANTHERiPTHR16592. PTHR16592. 2 hits.
PfamiPF01823. MACPF. 1 hit.
[Graphical view]
SMARTiSM00457. MACPF. 1 hit.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 2 hits.
ProtoNetiSearch...

Entry informationi

Entry nameiASTN2_HUMAN
AccessioniPrimary (citable) accession number: O75129
Secondary accession number(s): A2A2T7
, A2A2T9, Q52LQ2, Q5JVX8, Q5JVX9, Q5JVY1, Q5VXG8, Q5VZX6, Q8N6P8, Q8WV47, Q96FL4, Q9UHW6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: October 23, 2007
Last modified: September 7, 2016
This is version 118 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.