O75128 (COBL_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 79.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein cordon-bleu | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1261 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Plays an important role in the reorganization of the actin cytoskeleton. Regulates neuron morphogenesis and increases branching of axons and dendrites. Regulates dendrite branching in Purkinje cells By similarity. Binds to and sequesters actin monomers (G actin). Nucleates actin polymerization by assembling three actin monomers in cross-filament orientation and thereby promotes growth of actin filaments at the barbed end. Can also mediate actin depolymerization at barbed ends and severing of actin filaments. Promotes formation of cell ruffles. Ref.9 |
| Subunit structure | Identified in a complex composed of ACTA1, COBL, GSN AND TMSB4X. Interacts (via WH2 domains) with actin monomers. Interacts with both PACSIN1 and DBNL. Identified in a complex composed of COBL, PACSIN1 and WASL. Interacts with PACSIN1, PACSIN2 and PACSIN3 By similarity. |
| Subcellular location | Cell membrane; Peripheral membrane protein; Cytoplasmic side By similarity. Cytoplasm › cytoskeleton By similarity. Cell projection › ruffle By similarity. Cytoplasm By similarity. Note: Recruited to the cell membrane via interaction with PACSIN1. Colocalizes with the actin cytoskeleton. Detected throughout the neuron cell body, as well as in axons and dendrites By similarity. |
| Sequence similarities | Contains 3 WH2 domains. |
| Sequence caution | The sequence BAA31608.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O75128-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O75128-2) The sequence of this isoform differs from the canonical sequence as follows: 261-261: K → KAEQLVLSGADSDEDTSRAAPGRGLN 366-366: V → GGGRQVPQKPPRGTARGPPQLVLPPPPPYPPPDTDVVEPLSFPGEGAGSEASDPIPKL | ||||||
| Isoform 3 (identifier: O75128-3) The sequence of this isoform differs from the canonical sequence as follows: 1169-1215: Missing. | ||||||
| Isoform 4 (identifier: O75128-4) The sequence of this isoform differs from the canonical sequence as follows: 367-469: SLPLGSGSHC...KNGSENSHLR → YGAAEAVIRL...LAFGRQSLIS 470-1261: Missing. | ||||||
| Isoform 5 (identifier: O75128-5) The sequence of this isoform differs from the canonical sequence as follows: 367-379: SLPLGSGSHCSPD → YCCASFPTQAKRF 380-1261: Missing. | ||||||
| Isoform 6 (identifier: O75128-6) The sequence of this isoform differs from the canonical sequence as follows: 1-458: Missing. 459-468: EKNGSENSHL → MSAPFSLVFP | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 7 (identifier: O75128-7) The sequence of this isoform differs from the canonical sequence as follows: 366-366: V → GGGRQVPQKPPRGTARGPPQLVLPPPPPYPPPDTDVVEPLSFPGEGAGSEASDPIPKL 1169-1215: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1261 | 1261 | Protein cordon-bleu | PRO_0000260491 | |||||
Regions | |||||||||
| Domain | 1109 – 1129 | 21 | WH2 1 | ||||||
| Domain | 1149 – 1169 | 21 | WH2 2 | ||||||
| Domain | 1237 – 1257 | 21 | WH2 3 | ||||||
| Motif | 298 – 303 | 6 | KKRRAP 1 | ||||||
| Motif | 331 – 336 | 6 | KKRRAP 2 | ||||||
| Compositional bias | 22 – 25 | 4 | Poly-Pro | ||||||
| Compositional bias | 303 – 351 | 49 | Pro-rich | ||||||
| Compositional bias | 1021 – 1024 | 4 | Poly-Pro | ||||||
| Compositional bias | 1207 – 1213 | 7 | Poly-Pro | ||||||
Amino acid modifications | |||||||||
| Modified residue | 235 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 741 | 1 | Phosphoserine Ref.6 Ref.8 | ||||||
| Modified residue | 751 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 815 | 1 | Phosphoserine Ref.8 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 458 | 458 | Missing in isoform 6. | VSP_040711 | |||||
| Alternative sequence | 261 | 1 | K → KAEQLVLSGADSDEDTSRAA PGRGLN in isoform 2. | VSP_021607 | |||||
| Alternative sequence | 366 | 1 | V → GGGRQVPQKPPRGTARGPPQ LVLPPPPPYPPPDTDVVEPL SFPGEGAGSEASDPIPKL in isoform 2 and isoform 7. | VSP_021608 | |||||
| Alternative sequence | 367 – 469 | 103 | SLPLG…NSHLR → YGAAEAVIRLLSLLLNTTAP GTAKPRTLWMSEGRSSLHNP EIKCSCFSSSSPFPQSLLSL LLGLSSICECMCTLRHTHAH THNPSCVLPTSEILAFGRQS LIS in isoform 4. | VSP_021609 | |||||
| Alternative sequence | 367 – 379 | 13 | SLPLG…HCSPD → YCCASFPTQAKRF in isoform 5. | VSP_021610 | |||||
| Alternative sequence | 380 – 1261 | 882 | Missing in isoform 5. | VSP_021611 | |||||
| Alternative sequence | 459 – 468 | 10 | EKNGSENSHL → MSAPFSLVFP in isoform 6. | VSP_040712 | |||||
| Alternative sequence | 470 – 1261 | 792 | Missing in isoform 4. | VSP_021612 | |||||
| Alternative sequence | 1169 – 1215 | 47 | Missing in isoform 3 and isoform 7. | VSP_021613 | |||||
| Natural variant | 526 | 1 | P → L. Ref.2 Corresponds to variant rs17656599 [ dbSNP | Ensembl ]. | VAR_050894 | |||||
| Natural variant | 577 | 1 | D → A. Ref.2 Ref.4 Ref.5 Corresponds to variant rs10230120 [ dbSNP | Ensembl ]. | VAR_029043 | |||||
| Natural variant | 607 | 1 | V → I. Ref.2 Ref.4 Ref.5 Corresponds to variant rs2240090 [ dbSNP | Ensembl ]. | VAR_029044 | |||||
| Natural variant | 919 | 1 | H → Q. Ref.2 Corresponds to variant rs2240089 [ dbSNP | Ensembl ]. | VAR_050895 | |||||
| Natural variant | 927 | 1 | D → N. Ref.5 Corresponds to variant rs17134128 [ dbSNP | Ensembl ]. | VAR_029045 | |||||
| Natural variant | 1015 | 1 | A → P. Ref.5 Corresponds to variant rs17134127 [ dbSNP | Ensembl ]. | VAR_029046 | |||||
Experimental info | |||||||||
| Sequence conflict | 481 | 1 | Missing in AAH29275. Ref.5 | ||||||
| Sequence conflict | 601 | 1 | H → Y in AAH45771. Ref.5 | ||||||
| Sequence conflict | 881 | 1 | V → A in AAI44100. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro." Ishikawa K., Nagase T., Suyama M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:169-176(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6), VARIANTS LEU-526; ALA-577; ILE-607 AND GLN-919. Tissue: Brain. |
| [3] | "The DNA sequence of human chromosome 7." Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. Wilson R.K.Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANTS ALA-577 AND ILE-607. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3; 4; 5 AND 7), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 198-1261 (ISOFORM 2), VARIANTS ALA-577; ILE-607; ASN-927 AND PRO-1015. Tissue: Brain, Cervix, Muscle, Placenta and Testis. |
| [6] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-741, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [7] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [8] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-741 AND SER-815, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [9] | "Cordon-Bleu uses WH2 domains as multifunctional dynamizers of actin filament assembly." Husson C., Renault L., Didry D., Pantaloni D., Carlier M.F. Mol. Cell 43:464-477(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB014533 mRNA. Translation: BAA31608.1. Different initiation. AL713786 mRNA. Translation: CAD28543.1. AC005535 Genomic DNA. No translation available. AC012372 Genomic DNA. No translation available. AC004414 Genomic DNA. No translation available. CH236955 Genomic DNA. Translation: EAL23896.1. CH471128 Genomic DNA. Translation: EAW60962.1. BC029275 mRNA. Translation: AAH29275.1. BC045771 mRNA. Translation: AAH45771.1. BC094695 mRNA. Translation: AAH94695.1. BC111496 mRNA. Translation: AAI11497.1. BC136441 mRNA. Translation: AAI36442.1. BC144099 mRNA. Translation: AAI44100.1. BC150263 mRNA. Translation: AAI50264.1. |
| IPI | IPI00329653. IPI00384529. IPI00807589. IPI00807621. IPI00807645. IPI00927568. IPI00979308. |
| PIR | T00381. |
| RefSeq | NP_056013.2. NM_015198.3. |
| UniGene | Hs.99141. |
3D structure databases | |
| HSSP | HSSP built from PDB template 2DAJ based on UniProtKB Q6IQ33. |
| ProteinModelPortal | O75128. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O75128. 1 interaction. |
| STRING | 9606.ENSP00000265136. |
PTM databases | |
| PhosphoSite | O75128. |
Proteomic databases | |
| PaxDb | O75128. |
| PRIDE | O75128. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000265136; ENSP00000265136; ENSG00000106078. ENST00000395540; ENSP00000378910; ENSG00000106078. ENST00000395542; ENSP00000378912; ENSG00000106078. ENST00000441453; ENSP00000399500; ENSG00000106078. |
| GeneID | 23242. |
| KEGG | hsa:23242. |
| UCSC | uc003tpo.4. human. uc003tpp.4. human. uc003tpq.4. human. uc003tpr.4. human. uc003tps.3. human. uc003tpt.3. human. |
Organism-specific databases | |
| CTD | 23242. |
| GeneCards | GC07M051051. |
| HGNC | HGNC:22199. COBL. |
| HPA | HPA019033. HPA019167. |
| MIM | 610317. gene. |
| neXtProt | NX_O75128. |
| PharmGKB | PA134869580. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG76967. |
| HOVERGEN | HBG081301. |
| OMA | QKPPRGT. |
| OrthoDB | EOG4R23TC. |
Gene expression databases | |
| ArrayExpress | O75128. |
| Bgee | O75128. |
| CleanEx | HS_COBL. |
| Genevestigator | O75128. |
| GermOnline | ENSG00000106078. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR019025. Cordon-bleu_domain. IPR003124. WH2_dom. [Graphical view] |
| Pfam | PF09469. Cobl. 1 hit. PF02205. WH2. 3 hits. [Graphical view] |
| SMART | SM00246. WH2. 3 hits. [Graphical view] |
| PROSITE | PS51082. WH2. 3 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 23242. |
| NextBio | 44908. |
| SOURCE | Search... |
Entry information
| Entry name | COBL_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O75128 Secondary accession number(s): A4D257 Q8TCM1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
