Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein cordon-bleu

Gene

COBL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plays an important role in the reorganization of the actin cytoskeleton. Regulates neuron morphogenesis and increases branching of axons and dendrites. Regulates dendrite branching in Purkinje cells (By similarity). Binds to and sequesters actin monomers (G actin). Nucleates actin polymerization by assembling three actin monomers in cross-filament orientation and thereby promotes growth of actin filaments at the barbed end. Can also mediate actin depolymerization at barbed ends and severing of actin filaments. Promotes formation of cell ruffles.By similarity1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Ligandi

Actin-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000106078-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein cordon-bleu
Gene namesi
Name:COBL
Synonyms:KIAA0633
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:22199. COBL.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi23242.
OpenTargetsiENSG00000106078.
PharmGKBiPA134869580.

Polymorphism and mutation databases

BioMutaiCOBL.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002604911 – 1261Protein cordon-bleuAdd BLAST1261

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei47PhosphoserineBy similarity1
Modified residuei212PhosphoserineBy similarity1
Modified residuei235PhosphoserineBy similarity1
Modified residuei269PhosphoserineCombined sources1
Modified residuei321PhosphoserineBy similarity1
Modified residuei324PhosphoserineCombined sources1
Modified residuei347PhosphoserineCombined sources1
Modified residuei447PhosphothreonineBy similarity1
Modified residuei574PhosphoserineCombined sources1
Modified residuei578PhosphoserineCombined sources1
Modified residuei741PhosphoserineCombined sources1
Modified residuei815PhosphoserineCombined sources1
Modified residuei962PhosphoserineCombined sources1
Modified residuei1192PhosphoserineCombined sources1
Modified residuei1227PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiO75128.
PaxDbiO75128.
PeptideAtlasiO75128.
PRIDEiO75128.

PTM databases

iPTMnetiO75128.
PhosphoSitePlusiO75128.

Expressioni

Gene expression databases

BgeeiENSG00000106078.
CleanExiHS_COBL.
ExpressionAtlasiO75128. baseline and differential.
GenevisibleiO75128. HS.

Organism-specific databases

HPAiHPA019033.
HPA019167.

Interactioni

Subunit structurei

Identified in a complex composed of ACTA1, COBL, GSN AND TMSB4X. Interacts (via WH2 domains) with actin monomers. Interacts with both PACSIN1 and DBNL. Identified in a complex composed of COBL, PACSIN1 and WASL. Interacts with PACSIN1, PACSIN2 and PACSIN3 (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi116846. 46 interactors.
IntActiO75128. 34 interactors.
STRINGi9606.ENSP00000265136.

Structurei

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4PL8X-ray2.00H1095-1106[»]
ProteinModelPortaliO75128.
SMRiO75128.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1109 – 1129WH2 1PROSITE-ProRule annotationAdd BLAST21
Domaini1149 – 1169WH2 2PROSITE-ProRule annotationAdd BLAST21
Domaini1237 – 1257WH2 3PROSITE-ProRule annotationAdd BLAST21

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi298 – 303KKRRAP 16
Motifi331 – 336KKRRAP 26

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi22 – 25Poly-Pro4
Compositional biasi303 – 351Pro-richAdd BLAST49
Compositional biasi1021 – 1024Poly-Pro4
Compositional biasi1207 – 1213Poly-Pro7

Sequence similaritiesi

Contains 3 WH2 domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiENOG410IJC4. Eukaryota.
ENOG410YD9K. LUCA.
GeneTreeiENSGT00530000063608.
HOVERGENiHBG081301.
InParanoidiO75128.
KOiK18623.
OMAiNGCLTTP.
OrthoDBiEOG091G01LF.
PhylomeDBiO75128.
TreeFamiTF333490.

Family and domain databases

InterProiIPR019025. Cordon-bleu_ubiquitin_domain.
IPR003124. WH2_dom.
[Graphical view]
PfamiPF09469. Cobl. 1 hit.
PF02205. WH2. 3 hits.
[Graphical view]
SMARTiSM00246. WH2. 3 hits.
[Graphical view]
PROSITEiPS51082. WH2. 3 hits.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O75128-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDAPRASAAK PPTGRKMKAR APPPPGKAAT LHVHSDQKPP HDGALGSQQN
60 70 80 90 100
LVRMKEALRA STMDVTVVLP SGLEKRSVLN GSHAMMDLLV ELCLQNHLNP
110 120 130 140 150
SHHALEIRSS ETQQPLSFKP NTLIGTLNVH TVFLKEKVPE EKVKPGPPKV
160 170 180 190 200
PEKSVRLVVN YLRTQKAVVR VSPEVPLQNI LPVICAKCEV SPEHVVLLRD
210 220 230 240 250
NIAGEELELS KSLNELGIKE LYAWDNRRET FRKSSLGNDE TDKEKKKFLG
260 270 280 290 300
FFKVNKRSNS KGCLTTPNSP SMHSRSLTLG PSLSLGSISG VSVKSEMKKR
310 320 330 340 350
RAPPPPGSGP PVQDKASEKV SLGSQIDLQK KKRRAPAPPP PQPPPPSPLI
360 370 380 390 400
PNRTEDKEEN RKSTMVSLPL GSGSHCSPDG APQVLSEAEE TVSVGSCFAS
410 420 430 440 450
EDTTEDSGVM SSPSDIVSLD SQQDSMKYKD KWATDQEDCS DQDLAGTPDL
460 470 480 490 500
GPQKSPLWEK NGSENSHLRT EKAVTASNDE EDLLIAGEFR KTLAELDEDL
510 520 530 540 550
EEMEDSYETD TSSLTSSIHG ASNHCPQDAM IPHGDTDAIP VTFIGEVSDD
560 570 580 590 600
PVDSGLFSNR NNNAGSFDSE GVASRRDSLA PLQAEHSQPH EKAREEVPAL
610 620 630 640 650
HPASHDVGKG IRVALSNISK DGNLMETAPR VTSFASNLHT DNLNAKVKDK
660 670 680 690 700
VYGCADGERT QATERVNSQP VNEKDSNDKN AALAPTSWHQ RGQNPGKSYR
710 720 730 740 750
LKHGLTTYKI IPPKSEMRCY DRDVSLSTGA IKIDELGNLV SPHATGIRII
760 770 780 790 800
SLSSSVPEAE SQPIGKVREF WRCNSVEKHL GRPSESSARG PPSTPVPTQT
810 820 830 840 850
QNPESRLQAD PKPISPQQKS AHHEGRNPLG EGRNQPPTMG MGHVRVPAAH
860 870 880 890 900
TTEVTFLKPQ RRTSSQYVAS AIAKRIGAPK VHADVVRPHG YAEKGYAGKA
910 920 930 940 950
PVLAAPPVTV KDDRTSSPHS ETQGWKDGAQ WPCVTPPNNH GEDLAVGAPP
960 970 980 990 1000
RGEVIGPHRK LSTQDRPAAI HRSSCFSLVQ SSQRDRVSVG QSCGFSGKQS
1010 1020 1030 1040 1050
TSSQEASSAS EPRRAPDGTD PPPPHTSDTQ ACSRELVNGS VRAPGHGEPS
1060 1070 1080 1090 1100
HPPGGSGTES HILLEREEKP SVFSTDGNET DSIWPPSIFG PKKKFKPVVQ
1110 1120 1130 1140 1150
RPVPKDTSLH SALMEAIHSA GGKDRLRKTA EHTGEGRPAK LSYTEAEGER
1160 1170 1180 1190 1200
SALLAAIRGH SGTCSLRKVA SSASEELQSF RDAALSAQGS ESPLLEDLGL
1210 1220 1230 1240 1250
LSPPAIPPPP PPPSQALSAP RTASRFSTGT LSNTADARQA LMDAIRSGTG
1260
AARLRKVPLL V
Length:1,261
Mass (Da):135,617
Last modified:November 28, 2006 - v2
Checksum:i2DA7113EFD343AB3
GO
Isoform 2 (identifier: O75128-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     261-261: K → KAEQLVLSGADSDEDTSRAAPGRGLN
     366-366: V → GGGRQVPQKPPRGTARGPPQLVLPPPPPYPPPDTDVVEPLSFPGEGAGSEASDPIPKL

Show »
Length:1,343
Mass (Da):143,928
Checksum:iF195588E26B3D060
GO
Isoform 3 (identifier: O75128-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1169-1215: Missing.

Show »
Length:1,214
Mass (Da):130,883
Checksum:i968E9E2FCC7DAF89
GO
Isoform 4 (identifier: O75128-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     367-469: SLPLGSGSHC...KNGSENSHLR → YGAAEAVIRL...LAFGRQSLIS
     470-1261: Missing.

Show »
Length:469
Mass (Da):51,195
Checksum:i22AC1B78CDA5253D
GO
Isoform 5 (identifier: O75128-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     367-379: SLPLGSGSHCSPD → YCCASFPTQAKRF
     380-1261: Missing.

Show »
Length:379
Mass (Da):41,620
Checksum:iB29154E217C991EE
GO
Isoform 6 (identifier: O75128-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-458: Missing.
     459-468: EKNGSENSHL → MSAPFSLVFP

Note: No experimental confirmation available.
Show »
Length:803
Mass (Da):85,849
Checksum:i07D623D2E4A621A3
GO
Isoform 7 (identifier: O75128-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     366-366: V → GGGRQVPQKPPRGTARGPPQLVLPPPPPYPPPDTDVVEPLSFPGEGAGSEASDPIPKL
     1169-1215: Missing.

Show »
Length:1,271
Mass (Da):136,682
Checksum:i4A54B47129EA87A8
GO

Sequence cautioni

The sequence BAA31608 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti481Missing in AAH29275 (PubMed:15489334).Curated1
Sequence conflicti601H → Y in AAH45771 (PubMed:15489334).Curated1
Sequence conflicti881V → A in AAI44100 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_050894526P → L.1 PublicationCorresponds to variant rs17656599dbSNPEnsembl.1
Natural variantiVAR_029043577D → A.Combined sources3 PublicationsCorresponds to variant rs10230120dbSNPEnsembl.1
Natural variantiVAR_029044607V → I.3 PublicationsCorresponds to variant rs2240090dbSNPEnsembl.1
Natural variantiVAR_050895919H → Q.1 PublicationCorresponds to variant rs2240089dbSNPEnsembl.1
Natural variantiVAR_029045927D → N.1 PublicationCorresponds to variant rs17134128dbSNPEnsembl.1
Natural variantiVAR_0290461015A → P.1 PublicationCorresponds to variant rs17134127dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0407111 – 458Missing in isoform 6. 1 PublicationAdd BLAST458
Alternative sequenceiVSP_021607261K → KAEQLVLSGADSDEDTSRAA PGRGLN in isoform 2. 1 Publication1
Alternative sequenceiVSP_021608366V → GGGRQVPQKPPRGTARGPPQ LVLPPPPPYPPPDTDVVEPL SFPGEGAGSEASDPIPKL in isoform 2 and isoform 7. 1 Publication1
Alternative sequenceiVSP_021609367 – 469SLPLG…NSHLR → YGAAEAVIRLLSLLLNTTAP GTAKPRTLWMSEGRSSLHNP EIKCSCFSSSSPFPQSLLSL LLGLSSICECMCTLRHTHAH THNPSCVLPTSEILAFGRQS LIS in isoform 4. 1 PublicationAdd BLAST103
Alternative sequenceiVSP_021610367 – 379SLPLG…HCSPD → YCCASFPTQAKRF in isoform 5. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_021611380 – 1261Missing in isoform 5. 1 PublicationAdd BLAST882
Alternative sequenceiVSP_040712459 – 468EKNGSENSHL → MSAPFSLVFP in isoform 6. 1 Publication10
Alternative sequenceiVSP_021612470 – 1261Missing in isoform 4. 1 PublicationAdd BLAST792
Alternative sequenceiVSP_0216131169 – 1215Missing in isoform 3 and isoform 7. 1 PublicationAdd BLAST47

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB014533 mRNA. Translation: BAA31608.1. Different initiation.
AL713786 mRNA. Translation: CAD28543.1.
AC005535 Genomic DNA. No translation available.
AC012372 Genomic DNA. No translation available.
AC004414 Genomic DNA. No translation available.
CH236955 Genomic DNA. Translation: EAL23896.1.
CH471128 Genomic DNA. Translation: EAW60962.1.
BC029275 mRNA. Translation: AAH29275.1.
BC045771 mRNA. Translation: AAH45771.1.
BC094695 mRNA. Translation: AAH94695.1.
BC111496 mRNA. Translation: AAI11497.1.
BC136441 mRNA. Translation: AAI36442.1.
BC144099 mRNA. Translation: AAI44100.1.
BC150263 mRNA. Translation: AAI50264.1.
CCDSiCCDS34637.1. [O75128-1]
CCDS75601.1. [O75128-5]
CCDS75602.1. [O75128-7]
PIRiT00381.
RefSeqiNP_001274365.1. NM_001287436.1. [O75128-7]
NP_001274367.1. NM_001287438.1. [O75128-5]
NP_056013.2. NM_015198.3. [O75128-1]
XP_005271813.1. XM_005271756.1. [O75128-3]
XP_011513537.1. XM_011515235.1. [O75128-2]
XP_016867390.1. XM_017011901.1. [O75128-4]
UniGeneiHs.99141.

Genome annotation databases

EnsembliENST00000265136; ENSP00000265136; ENSG00000106078. [O75128-1]
ENST00000395540; ENSP00000378910; ENSG00000106078. [O75128-4]
ENST00000395542; ENSP00000378912; ENSG00000106078. [O75128-7]
ENST00000441453; ENSP00000399500; ENSG00000106078. [O75128-5]
GeneIDi23242.
KEGGihsa:23242.
UCSCiuc003tpr.5. human. [O75128-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB014533 mRNA. Translation: BAA31608.1. Different initiation.
AL713786 mRNA. Translation: CAD28543.1.
AC005535 Genomic DNA. No translation available.
AC012372 Genomic DNA. No translation available.
AC004414 Genomic DNA. No translation available.
CH236955 Genomic DNA. Translation: EAL23896.1.
CH471128 Genomic DNA. Translation: EAW60962.1.
BC029275 mRNA. Translation: AAH29275.1.
BC045771 mRNA. Translation: AAH45771.1.
BC094695 mRNA. Translation: AAH94695.1.
BC111496 mRNA. Translation: AAI11497.1.
BC136441 mRNA. Translation: AAI36442.1.
BC144099 mRNA. Translation: AAI44100.1.
BC150263 mRNA. Translation: AAI50264.1.
CCDSiCCDS34637.1. [O75128-1]
CCDS75601.1. [O75128-5]
CCDS75602.1. [O75128-7]
PIRiT00381.
RefSeqiNP_001274365.1. NM_001287436.1. [O75128-7]
NP_001274367.1. NM_001287438.1. [O75128-5]
NP_056013.2. NM_015198.3. [O75128-1]
XP_005271813.1. XM_005271756.1. [O75128-3]
XP_011513537.1. XM_011515235.1. [O75128-2]
XP_016867390.1. XM_017011901.1. [O75128-4]
UniGeneiHs.99141.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4PL8X-ray2.00H1095-1106[»]
ProteinModelPortaliO75128.
SMRiO75128.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116846. 46 interactors.
IntActiO75128. 34 interactors.
STRINGi9606.ENSP00000265136.

PTM databases

iPTMnetiO75128.
PhosphoSitePlusiO75128.

Polymorphism and mutation databases

BioMutaiCOBL.

Proteomic databases

MaxQBiO75128.
PaxDbiO75128.
PeptideAtlasiO75128.
PRIDEiO75128.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000265136; ENSP00000265136; ENSG00000106078. [O75128-1]
ENST00000395540; ENSP00000378910; ENSG00000106078. [O75128-4]
ENST00000395542; ENSP00000378912; ENSG00000106078. [O75128-7]
ENST00000441453; ENSP00000399500; ENSG00000106078. [O75128-5]
GeneIDi23242.
KEGGihsa:23242.
UCSCiuc003tpr.5. human. [O75128-1]

Organism-specific databases

CTDi23242.
DisGeNETi23242.
GeneCardsiCOBL.
HGNCiHGNC:22199. COBL.
HPAiHPA019033.
HPA019167.
MIMi610317. gene.
neXtProtiNX_O75128.
OpenTargetsiENSG00000106078.
PharmGKBiPA134869580.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IJC4. Eukaryota.
ENOG410YD9K. LUCA.
GeneTreeiENSGT00530000063608.
HOVERGENiHBG081301.
InParanoidiO75128.
KOiK18623.
OMAiNGCLTTP.
OrthoDBiEOG091G01LF.
PhylomeDBiO75128.
TreeFamiTF333490.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000106078-MONOMER.

Miscellaneous databases

ChiTaRSiCOBL. human.
GenomeRNAii23242.
PROiO75128.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000106078.
CleanExiHS_COBL.
ExpressionAtlasiO75128. baseline and differential.
GenevisibleiO75128. HS.

Family and domain databases

InterProiIPR019025. Cordon-bleu_ubiquitin_domain.
IPR003124. WH2_dom.
[Graphical view]
PfamiPF09469. Cobl. 1 hit.
PF02205. WH2. 3 hits.
[Graphical view]
SMARTiSM00246. WH2. 3 hits.
[Graphical view]
PROSITEiPS51082. WH2. 3 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCOBL_HUMAN
AccessioniPrimary (citable) accession number: O75128
Secondary accession number(s): A4D257
, A7E2B0, B7ZLW9, B9EGF8, Q2T9J3, Q504Y4, Q86XA7, Q8N304, Q8TCM1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 28, 2006
Last sequence update: November 28, 2006
Last modified: November 30, 2016
This is version 114 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.