Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O75128

- COBL_HUMAN

UniProt

O75128 - COBL_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Protein cordon-bleu

Gene

COBL

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Plays an important role in the reorganization of the actin cytoskeleton. Regulates neuron morphogenesis and increases branching of axons and dendrites. Regulates dendrite branching in Purkinje cells By similarity. Binds to and sequesters actin monomers (G actin). Nucleates actin polymerization by assembling three actin monomers in cross-filament orientation and thereby promotes growth of actin filaments at the barbed end. Can also mediate actin depolymerization at barbed ends and severing of actin filaments. Promotes formation of cell ruffles.By similarity1 Publication

GO - Molecular functioni

  1. actin monomer binding Source: BHF-UCL

GO - Biological processi

  1. actin filament network formation Source: BHF-UCL
  2. actin filament polymerization Source: BHF-UCL
  3. collateral sprouting in absence of injury Source: BHF-UCL
  4. digestive tract development Source: BHF-UCL
  5. embryonic axis specification Source: BHF-UCL
  6. floor plate development Source: BHF-UCL
  7. liver development Source: BHF-UCL
  8. neural tube closure Source: BHF-UCL
  9. notochord development Source: BHF-UCL
  10. positive regulation of dendrite development Source: BHF-UCL
  11. somite specification Source: BHF-UCL
Complete GO annotation...

Keywords - Ligandi

Actin-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Protein cordon-bleu
Gene namesi
Name:COBL
Synonyms:KIAA0633
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 7

Organism-specific databases

HGNCiHGNC:22199. COBL.

Subcellular locationi

Cell membrane By similarity; Peripheral membrane protein By similarity; Cytoplasmic side By similarity. Cytoplasmcytoskeleton By similarity. Cell projectionruffle By similarity. Cytoplasm By similarity
Note: Recruited to the cell membrane via interaction with PACSIN1. Colocalizes with the actin cytoskeleton. Detected throughout the neuron cell body, as well as in axons and dendrites By similarity.By similarity

GO - Cellular componenti

  1. actin filament Source: Ensembl
  2. axon Source: BHF-UCL
  3. axonal growth cone Source: BHF-UCL
  4. cell cortex Source: BHF-UCL
  5. dendrite Source: BHF-UCL
  6. dendritic growth cone Source: BHF-UCL
  7. neuronal cell body Source: BHF-UCL
  8. perinuclear region of cytoplasm Source: BHF-UCL
  9. plasma membrane Source: BHF-UCL
  10. ruffle Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134869580.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 12611261Protein cordon-bleuPRO_0000260491Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei741 – 7411Phosphoserine2 Publications
Modified residuei815 – 8151Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiO75128.
PaxDbiO75128.
PRIDEiO75128.

PTM databases

PhosphoSiteiO75128.

Expressioni

Gene expression databases

BgeeiO75128.
CleanExiHS_COBL.
ExpressionAtlasiO75128. baseline and differential.
GenevestigatoriO75128.

Organism-specific databases

HPAiHPA019033.
HPA019167.

Interactioni

Subunit structurei

Identified in a complex composed of ACTA1, COBL, GSN AND TMSB4X. Interacts (via WH2 domains) with actin monomers. Interacts with both PACSIN1 and DBNL. Identified in a complex composed of COBL, PACSIN1 and WASL. Interacts with PACSIN1, PACSIN2 and PACSIN3 By similarity.By similarity

Protein-protein interaction databases

BioGridi116846. 8 interactions.
IntActiO75128. 1 interaction.
STRINGi9606.ENSP00000265136.

Structurei

3D structure databases

ProteinModelPortaliO75128.
SMRiO75128. Positions 152-230, 1108-1187.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1109 – 112921WH2 1PROSITE-ProRule annotationAdd
BLAST
Domaini1149 – 116921WH2 2PROSITE-ProRule annotationAdd
BLAST
Domaini1237 – 125721WH2 3PROSITE-ProRule annotationAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi298 – 3036KKRRAP 1
Motifi331 – 3366KKRRAP 2

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi22 – 254Poly-Pro
Compositional biasi303 – 35149Pro-richAdd
BLAST
Compositional biasi1021 – 10244Poly-Pro
Compositional biasi1207 – 12137Poly-Pro

Sequence similaritiesi

Contains 3 WH2 domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiNOG76967.
GeneTreeiENSGT00530000063608.
HOVERGENiHBG081301.
InParanoidiO75128.
OMAiQKPPRGT.
PhylomeDBiO75128.
TreeFamiTF333490.

Family and domain databases

InterProiIPR019025. Cordon-bleu_ubiquitin_domain.
IPR003124. WH2_dom.
[Graphical view]
PfamiPF09469. Cobl. 1 hit.
PF02205. WH2. 3 hits.
[Graphical view]
SMARTiSM00246. WH2. 3 hits.
[Graphical view]
PROSITEiPS51082. WH2. 3 hits.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O75128-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDAPRASAAK PPTGRKMKAR APPPPGKAAT LHVHSDQKPP HDGALGSQQN
60 70 80 90 100
LVRMKEALRA STMDVTVVLP SGLEKRSVLN GSHAMMDLLV ELCLQNHLNP
110 120 130 140 150
SHHALEIRSS ETQQPLSFKP NTLIGTLNVH TVFLKEKVPE EKVKPGPPKV
160 170 180 190 200
PEKSVRLVVN YLRTQKAVVR VSPEVPLQNI LPVICAKCEV SPEHVVLLRD
210 220 230 240 250
NIAGEELELS KSLNELGIKE LYAWDNRRET FRKSSLGNDE TDKEKKKFLG
260 270 280 290 300
FFKVNKRSNS KGCLTTPNSP SMHSRSLTLG PSLSLGSISG VSVKSEMKKR
310 320 330 340 350
RAPPPPGSGP PVQDKASEKV SLGSQIDLQK KKRRAPAPPP PQPPPPSPLI
360 370 380 390 400
PNRTEDKEEN RKSTMVSLPL GSGSHCSPDG APQVLSEAEE TVSVGSCFAS
410 420 430 440 450
EDTTEDSGVM SSPSDIVSLD SQQDSMKYKD KWATDQEDCS DQDLAGTPDL
460 470 480 490 500
GPQKSPLWEK NGSENSHLRT EKAVTASNDE EDLLIAGEFR KTLAELDEDL
510 520 530 540 550
EEMEDSYETD TSSLTSSIHG ASNHCPQDAM IPHGDTDAIP VTFIGEVSDD
560 570 580 590 600
PVDSGLFSNR NNNAGSFDSE GVASRRDSLA PLQAEHSQPH EKAREEVPAL
610 620 630 640 650
HPASHDVGKG IRVALSNISK DGNLMETAPR VTSFASNLHT DNLNAKVKDK
660 670 680 690 700
VYGCADGERT QATERVNSQP VNEKDSNDKN AALAPTSWHQ RGQNPGKSYR
710 720 730 740 750
LKHGLTTYKI IPPKSEMRCY DRDVSLSTGA IKIDELGNLV SPHATGIRII
760 770 780 790 800
SLSSSVPEAE SQPIGKVREF WRCNSVEKHL GRPSESSARG PPSTPVPTQT
810 820 830 840 850
QNPESRLQAD PKPISPQQKS AHHEGRNPLG EGRNQPPTMG MGHVRVPAAH
860 870 880 890 900
TTEVTFLKPQ RRTSSQYVAS AIAKRIGAPK VHADVVRPHG YAEKGYAGKA
910 920 930 940 950
PVLAAPPVTV KDDRTSSPHS ETQGWKDGAQ WPCVTPPNNH GEDLAVGAPP
960 970 980 990 1000
RGEVIGPHRK LSTQDRPAAI HRSSCFSLVQ SSQRDRVSVG QSCGFSGKQS
1010 1020 1030 1040 1050
TSSQEASSAS EPRRAPDGTD PPPPHTSDTQ ACSRELVNGS VRAPGHGEPS
1060 1070 1080 1090 1100
HPPGGSGTES HILLEREEKP SVFSTDGNET DSIWPPSIFG PKKKFKPVVQ
1110 1120 1130 1140 1150
RPVPKDTSLH SALMEAIHSA GGKDRLRKTA EHTGEGRPAK LSYTEAEGER
1160 1170 1180 1190 1200
SALLAAIRGH SGTCSLRKVA SSASEELQSF RDAALSAQGS ESPLLEDLGL
1210 1220 1230 1240 1250
LSPPAIPPPP PPPSQALSAP RTASRFSTGT LSNTADARQA LMDAIRSGTG
1260
AARLRKVPLL V
Length:1,261
Mass (Da):135,617
Last modified:November 28, 2006 - v2
Checksum:i2DA7113EFD343AB3
GO
Isoform 2 (identifier: O75128-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     261-261: K → KAEQLVLSGADSDEDTSRAAPGRGLN
     366-366: V → GGGRQVPQKPPRGTARGPPQLVLPPPPPYPPPDTDVVEPLSFPGEGAGSEASDPIPKL

Show »
Length:1,343
Mass (Da):143,928
Checksum:iF195588E26B3D060
GO
Isoform 3 (identifier: O75128-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1169-1215: Missing.

Show »
Length:1,214
Mass (Da):130,883
Checksum:i968E9E2FCC7DAF89
GO
Isoform 4 (identifier: O75128-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     367-469: SLPLGSGSHC...KNGSENSHLR → YGAAEAVIRL...LAFGRQSLIS
     470-1261: Missing.

Show »
Length:469
Mass (Da):51,195
Checksum:i22AC1B78CDA5253D
GO
Isoform 5 (identifier: O75128-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     367-379: SLPLGSGSHCSPD → YCCASFPTQAKRF
     380-1261: Missing.

Show »
Length:379
Mass (Da):41,620
Checksum:iB29154E217C991EE
GO
Isoform 6 (identifier: O75128-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-458: Missing.
     459-468: EKNGSENSHL → MSAPFSLVFP

Note: No experimental confirmation available.

Show »
Length:803
Mass (Da):85,849
Checksum:i07D623D2E4A621A3
GO
Isoform 7 (identifier: O75128-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     366-366: V → GGGRQVPQKPPRGTARGPPQLVLPPPPPYPPPDTDVVEPLSFPGEGAGSEASDPIPKL
     1169-1215: Missing.

Show »
Length:1,271
Mass (Da):136,682
Checksum:i4A54B47129EA87A8
GO

Sequence cautioni

The sequence BAA31608.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti481 – 4811Missing in AAH29275. (PubMed:15489334)Curated
Sequence conflicti601 – 6011H → Y in AAH45771. (PubMed:15489334)Curated
Sequence conflicti881 – 8811V → A in AAI44100. (PubMed:15489334)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti526 – 5261P → L.1 Publication
Corresponds to variant rs17656599 [ dbSNP | Ensembl ].
VAR_050894
Natural varianti577 – 5771D → A.3 Publications
Corresponds to variant rs10230120 [ dbSNP | Ensembl ].
VAR_029043
Natural varianti607 – 6071V → I.3 Publications
Corresponds to variant rs2240090 [ dbSNP | Ensembl ].
VAR_029044
Natural varianti919 – 9191H → Q.1 Publication
Corresponds to variant rs2240089 [ dbSNP | Ensembl ].
VAR_050895
Natural varianti927 – 9271D → N.1 Publication
Corresponds to variant rs17134128 [ dbSNP | Ensembl ].
VAR_029045
Natural varianti1015 – 10151A → P.1 Publication
Corresponds to variant rs17134127 [ dbSNP | Ensembl ].
VAR_029046

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 458458Missing in isoform 6. 1 PublicationVSP_040711Add
BLAST
Alternative sequencei261 – 2611K → KAEQLVLSGADSDEDTSRAA PGRGLN in isoform 2. 1 PublicationVSP_021607
Alternative sequencei366 – 3661V → GGGRQVPQKPPRGTARGPPQ LVLPPPPPYPPPDTDVVEPL SFPGEGAGSEASDPIPKL in isoform 2 and isoform 7. 1 PublicationVSP_021608
Alternative sequencei367 – 469103SLPLG…NSHLR → YGAAEAVIRLLSLLLNTTAP GTAKPRTLWMSEGRSSLHNP EIKCSCFSSSSPFPQSLLSL LLGLSSICECMCTLRHTHAH THNPSCVLPTSEILAFGRQS LIS in isoform 4. 1 PublicationVSP_021609Add
BLAST
Alternative sequencei367 – 37913SLPLG…HCSPD → YCCASFPTQAKRF in isoform 5. 1 PublicationVSP_021610Add
BLAST
Alternative sequencei380 – 1261882Missing in isoform 5. 1 PublicationVSP_021611Add
BLAST
Alternative sequencei459 – 46810EKNGSENSHL → MSAPFSLVFP in isoform 6. 1 PublicationVSP_040712
Alternative sequencei470 – 1261792Missing in isoform 4. 1 PublicationVSP_021612Add
BLAST
Alternative sequencei1169 – 121547Missing in isoform 3 and isoform 7. 1 PublicationVSP_021613Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB014533 mRNA. Translation: BAA31608.1. Different initiation.
AL713786 mRNA. Translation: CAD28543.1.
AC005535 Genomic DNA. No translation available.
AC012372 Genomic DNA. No translation available.
AC004414 Genomic DNA. No translation available.
CH236955 Genomic DNA. Translation: EAL23896.1.
CH471128 Genomic DNA. Translation: EAW60962.1.
BC029275 mRNA. Translation: AAH29275.1.
BC045771 mRNA. Translation: AAH45771.1.
BC094695 mRNA. Translation: AAH94695.1.
BC111496 mRNA. Translation: AAI11497.1.
BC136441 mRNA. Translation: AAI36442.1.
BC144099 mRNA. Translation: AAI44100.1.
BC150263 mRNA. Translation: AAI50264.1.
CCDSiCCDS34637.1. [O75128-1]
CCDS75601.1. [O75128-5]
CCDS75602.1. [O75128-7]
PIRiT00381.
RefSeqiNP_001274365.1. NM_001287436.1. [O75128-7]
NP_001274367.1. NM_001287438.1. [O75128-5]
NP_056013.2. NM_015198.3. [O75128-1]
XP_005271813.1. XM_005271756.1. [O75128-3]
UniGeneiHs.99141.

Genome annotation databases

EnsembliENST00000265136; ENSP00000265136; ENSG00000106078. [O75128-1]
ENST00000395540; ENSP00000378910; ENSG00000106078. [O75128-4]
ENST00000395542; ENSP00000378912; ENSG00000106078. [O75128-7]
ENST00000441453; ENSP00000399500; ENSG00000106078. [O75128-5]
GeneIDi23242.
KEGGihsa:23242.
UCSCiuc003tpo.4. human. [O75128-6]
uc003tpr.4. human. [O75128-1]
uc003tps.3. human. [O75128-7]
uc003tpt.3. human. [O75128-5]
uc011kcl.2. human. [O75128-3]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB014533 mRNA. Translation: BAA31608.1 . Different initiation.
AL713786 mRNA. Translation: CAD28543.1 .
AC005535 Genomic DNA. No translation available.
AC012372 Genomic DNA. No translation available.
AC004414 Genomic DNA. No translation available.
CH236955 Genomic DNA. Translation: EAL23896.1 .
CH471128 Genomic DNA. Translation: EAW60962.1 .
BC029275 mRNA. Translation: AAH29275.1 .
BC045771 mRNA. Translation: AAH45771.1 .
BC094695 mRNA. Translation: AAH94695.1 .
BC111496 mRNA. Translation: AAI11497.1 .
BC136441 mRNA. Translation: AAI36442.1 .
BC144099 mRNA. Translation: AAI44100.1 .
BC150263 mRNA. Translation: AAI50264.1 .
CCDSi CCDS34637.1. [O75128-1 ]
CCDS75601.1. [O75128-5 ]
CCDS75602.1. [O75128-7 ]
PIRi T00381.
RefSeqi NP_001274365.1. NM_001287436.1. [O75128-7 ]
NP_001274367.1. NM_001287438.1. [O75128-5 ]
NP_056013.2. NM_015198.3. [O75128-1 ]
XP_005271813.1. XM_005271756.1. [O75128-3 ]
UniGenei Hs.99141.

3D structure databases

ProteinModelPortali O75128.
SMRi O75128. Positions 152-230, 1108-1187.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 116846. 8 interactions.
IntActi O75128. 1 interaction.
STRINGi 9606.ENSP00000265136.

PTM databases

PhosphoSitei O75128.

Proteomic databases

MaxQBi O75128.
PaxDbi O75128.
PRIDEi O75128.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000265136 ; ENSP00000265136 ; ENSG00000106078 . [O75128-1 ]
ENST00000395540 ; ENSP00000378910 ; ENSG00000106078 . [O75128-4 ]
ENST00000395542 ; ENSP00000378912 ; ENSG00000106078 . [O75128-7 ]
ENST00000441453 ; ENSP00000399500 ; ENSG00000106078 . [O75128-5 ]
GeneIDi 23242.
KEGGi hsa:23242.
UCSCi uc003tpo.4. human. [O75128-6 ]
uc003tpr.4. human. [O75128-1 ]
uc003tps.3. human. [O75128-7 ]
uc003tpt.3. human. [O75128-5 ]
uc011kcl.2. human. [O75128-3 ]

Organism-specific databases

CTDi 23242.
GeneCardsi GC07M051051.
HGNCi HGNC:22199. COBL.
HPAi HPA019033.
HPA019167.
MIMi 610317. gene.
neXtProti NX_O75128.
PharmGKBi PA134869580.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG76967.
GeneTreei ENSGT00530000063608.
HOVERGENi HBG081301.
InParanoidi O75128.
OMAi QKPPRGT.
PhylomeDBi O75128.
TreeFami TF333490.

Miscellaneous databases

GenomeRNAii 23242.
NextBioi 44908.
PROi O75128.
SOURCEi Search...

Gene expression databases

Bgeei O75128.
CleanExi HS_COBL.
ExpressionAtlasi O75128. baseline and differential.
Genevestigatori O75128.

Family and domain databases

InterProi IPR019025. Cordon-bleu_ubiquitin_domain.
IPR003124. WH2_dom.
[Graphical view ]
Pfami PF09469. Cobl. 1 hit.
PF02205. WH2. 3 hits.
[Graphical view ]
SMARTi SM00246. WH2. 3 hits.
[Graphical view ]
PROSITEi PS51082. WH2. 3 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
    Ishikawa K., Nagase T., Suyama M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 5:169-176(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6), VARIANTS LEU-526; ALA-577; ILE-607 AND GLN-919.
    Tissue: Brain.
  3. "The DNA sequence of human chromosome 7."
    Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
    , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
    Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANTS ALA-577 AND ILE-607.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3; 4; 5 AND 7), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 198-1261 (ISOFORM 2), VARIANTS ALA-577; ILE-607; ASN-927 AND PRO-1015.
    Tissue: Brain, Cervix, Muscle, Placenta and Testis.
  6. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
    Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
    J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-741, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-741 AND SER-815, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. "Cordon-Bleu uses WH2 domains as multifunctional dynamizers of actin filament assembly."
    Husson C., Renault L., Didry D., Pantaloni D., Carlier M.F.
    Mol. Cell 43:464-477(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.

Entry informationi

Entry nameiCOBL_HUMAN
AccessioniPrimary (citable) accession number: O75128
Secondary accession number(s): A4D257
, A7E2B0, B7ZLW9, B9EGF8, Q2T9J3, Q504Y4, Q86XA7, Q8N304, Q8TCM1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 28, 2006
Last sequence update: November 28, 2006
Last modified: October 29, 2014
This is version 93 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3