Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O75128

- COBL_HUMAN

UniProt

O75128 - COBL_HUMAN

Protein

Protein cordon-bleu

Gene

COBL

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 92 (01 Oct 2014)
      Sequence version 2 (28 Nov 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Plays an important role in the reorganization of the actin cytoskeleton. Regulates neuron morphogenesis and increases branching of axons and dendrites. Regulates dendrite branching in Purkinje cells By similarity. Binds to and sequesters actin monomers (G actin). Nucleates actin polymerization by assembling three actin monomers in cross-filament orientation and thereby promotes growth of actin filaments at the barbed end. Can also mediate actin depolymerization at barbed ends and severing of actin filaments. Promotes formation of cell ruffles.By similarity1 Publication

    GO - Molecular functioni

    1. actin monomer binding Source: BHF-UCL

    GO - Biological processi

    1. actin filament network formation Source: BHF-UCL
    2. actin filament polymerization Source: BHF-UCL
    3. collateral sprouting in absence of injury Source: BHF-UCL
    4. digestive tract development Source: BHF-UCL
    5. embryonic axis specification Source: BHF-UCL
    6. floor plate development Source: BHF-UCL
    7. liver development Source: BHF-UCL
    8. neural tube closure Source: BHF-UCL
    9. notochord development Source: BHF-UCL
    10. positive regulation of dendrite development Source: BHF-UCL
    11. somite specification Source: BHF-UCL

    Keywords - Ligandi

    Actin-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protein cordon-bleu
    Gene namesi
    Name:COBL
    Synonyms:KIAA0633
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 7

    Organism-specific databases

    HGNCiHGNC:22199. COBL.

    Subcellular locationi

    Cell membrane By similarity; Peripheral membrane protein By similarity; Cytoplasmic side By similarity. Cytoplasmcytoskeleton By similarity. Cell projectionruffle By similarity. Cytoplasm By similarity
    Note: Recruited to the cell membrane via interaction with PACSIN1. Colocalizes with the actin cytoskeleton. Detected throughout the neuron cell body, as well as in axons and dendrites By similarity.By similarity

    GO - Cellular componenti

    1. actin filament Source: Ensembl
    2. axon Source: BHF-UCL
    3. axonal growth cone Source: BHF-UCL
    4. cell cortex Source: BHF-UCL
    5. dendrite Source: BHF-UCL
    6. dendritic growth cone Source: BHF-UCL
    7. neuronal cell body Source: BHF-UCL
    8. perinuclear region of cytoplasm Source: BHF-UCL
    9. plasma membrane Source: BHF-UCL
    10. ruffle Source: BHF-UCL

    Keywords - Cellular componenti

    Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134869580.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 12611261Protein cordon-bleuPRO_0000260491Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei741 – 7411Phosphoserine2 Publications
    Modified residuei815 – 8151Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiO75128.
    PaxDbiO75128.
    PRIDEiO75128.

    PTM databases

    PhosphoSiteiO75128.

    Expressioni

    Gene expression databases

    ArrayExpressiO75128.
    BgeeiO75128.
    CleanExiHS_COBL.
    GenevestigatoriO75128.

    Organism-specific databases

    HPAiHPA019033.
    HPA019167.

    Interactioni

    Subunit structurei

    Identified in a complex composed of ACTA1, COBL, GSN AND TMSB4X. Interacts (via WH2 domains) with actin monomers. Interacts with both PACSIN1 and DBNL. Identified in a complex composed of COBL, PACSIN1 and WASL. Interacts with PACSIN1, PACSIN2 and PACSIN3 By similarity.By similarity

    Protein-protein interaction databases

    BioGridi116846. 5 interactions.
    IntActiO75128. 1 interaction.
    STRINGi9606.ENSP00000265136.

    Structurei

    3D structure databases

    ProteinModelPortaliO75128.
    SMRiO75128. Positions 152-230, 1108-1187.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini1109 – 112921WH2 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini1149 – 116921WH2 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini1237 – 125721WH2 3PROSITE-ProRule annotationAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi298 – 3036KKRRAP 1
    Motifi331 – 3366KKRRAP 2

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi22 – 254Poly-Pro
    Compositional biasi303 – 35149Pro-richAdd
    BLAST
    Compositional biasi1021 – 10244Poly-Pro
    Compositional biasi1207 – 12137Poly-Pro

    Sequence similaritiesi

    Contains 3 WH2 domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat

    Phylogenomic databases

    eggNOGiNOG76967.
    HOVERGENiHBG081301.
    OMAiQKPPRGT.
    PhylomeDBiO75128.
    TreeFamiTF333490.

    Family and domain databases

    InterProiIPR019025. Cordon-bleu_ubiquitin_domain.
    IPR003124. WH2_dom.
    [Graphical view]
    PfamiPF09469. Cobl. 1 hit.
    PF02205. WH2. 3 hits.
    [Graphical view]
    SMARTiSM00246. WH2. 3 hits.
    [Graphical view]
    PROSITEiPS51082. WH2. 3 hits.
    [Graphical view]

    Sequences (7)i

    Sequence statusi: Complete.

    This entry describes 7 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O75128-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDAPRASAAK PPTGRKMKAR APPPPGKAAT LHVHSDQKPP HDGALGSQQN     50
    LVRMKEALRA STMDVTVVLP SGLEKRSVLN GSHAMMDLLV ELCLQNHLNP 100
    SHHALEIRSS ETQQPLSFKP NTLIGTLNVH TVFLKEKVPE EKVKPGPPKV 150
    PEKSVRLVVN YLRTQKAVVR VSPEVPLQNI LPVICAKCEV SPEHVVLLRD 200
    NIAGEELELS KSLNELGIKE LYAWDNRRET FRKSSLGNDE TDKEKKKFLG 250
    FFKVNKRSNS KGCLTTPNSP SMHSRSLTLG PSLSLGSISG VSVKSEMKKR 300
    RAPPPPGSGP PVQDKASEKV SLGSQIDLQK KKRRAPAPPP PQPPPPSPLI 350
    PNRTEDKEEN RKSTMVSLPL GSGSHCSPDG APQVLSEAEE TVSVGSCFAS 400
    EDTTEDSGVM SSPSDIVSLD SQQDSMKYKD KWATDQEDCS DQDLAGTPDL 450
    GPQKSPLWEK NGSENSHLRT EKAVTASNDE EDLLIAGEFR KTLAELDEDL 500
    EEMEDSYETD TSSLTSSIHG ASNHCPQDAM IPHGDTDAIP VTFIGEVSDD 550
    PVDSGLFSNR NNNAGSFDSE GVASRRDSLA PLQAEHSQPH EKAREEVPAL 600
    HPASHDVGKG IRVALSNISK DGNLMETAPR VTSFASNLHT DNLNAKVKDK 650
    VYGCADGERT QATERVNSQP VNEKDSNDKN AALAPTSWHQ RGQNPGKSYR 700
    LKHGLTTYKI IPPKSEMRCY DRDVSLSTGA IKIDELGNLV SPHATGIRII 750
    SLSSSVPEAE SQPIGKVREF WRCNSVEKHL GRPSESSARG PPSTPVPTQT 800
    QNPESRLQAD PKPISPQQKS AHHEGRNPLG EGRNQPPTMG MGHVRVPAAH 850
    TTEVTFLKPQ RRTSSQYVAS AIAKRIGAPK VHADVVRPHG YAEKGYAGKA 900
    PVLAAPPVTV KDDRTSSPHS ETQGWKDGAQ WPCVTPPNNH GEDLAVGAPP 950
    RGEVIGPHRK LSTQDRPAAI HRSSCFSLVQ SSQRDRVSVG QSCGFSGKQS 1000
    TSSQEASSAS EPRRAPDGTD PPPPHTSDTQ ACSRELVNGS VRAPGHGEPS 1050
    HPPGGSGTES HILLEREEKP SVFSTDGNET DSIWPPSIFG PKKKFKPVVQ 1100
    RPVPKDTSLH SALMEAIHSA GGKDRLRKTA EHTGEGRPAK LSYTEAEGER 1150
    SALLAAIRGH SGTCSLRKVA SSASEELQSF RDAALSAQGS ESPLLEDLGL 1200
    LSPPAIPPPP PPPSQALSAP RTASRFSTGT LSNTADARQA LMDAIRSGTG 1250
    AARLRKVPLL V 1261
    Length:1,261
    Mass (Da):135,617
    Last modified:November 28, 2006 - v2
    Checksum:i2DA7113EFD343AB3
    GO
    Isoform 2 (identifier: O75128-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         261-261: K → KAEQLVLSGADSDEDTSRAAPGRGLN
         366-366: V → GGGRQVPQKPPRGTARGPPQLVLPPPPPYPPPDTDVVEPLSFPGEGAGSEASDPIPKL

    Show »
    Length:1,343
    Mass (Da):143,928
    Checksum:iF195588E26B3D060
    GO
    Isoform 3 (identifier: O75128-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1169-1215: Missing.

    Show »
    Length:1,214
    Mass (Da):130,883
    Checksum:i968E9E2FCC7DAF89
    GO
    Isoform 4 (identifier: O75128-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         367-469: SLPLGSGSHC...KNGSENSHLR → YGAAEAVIRL...LAFGRQSLIS
         470-1261: Missing.

    Show »
    Length:469
    Mass (Da):51,195
    Checksum:i22AC1B78CDA5253D
    GO
    Isoform 5 (identifier: O75128-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         367-379: SLPLGSGSHCSPD → YCCASFPTQAKRF
         380-1261: Missing.

    Show »
    Length:379
    Mass (Da):41,620
    Checksum:iB29154E217C991EE
    GO
    Isoform 6 (identifier: O75128-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-458: Missing.
         459-468: EKNGSENSHL → MSAPFSLVFP

    Note: No experimental confirmation available.

    Show »
    Length:803
    Mass (Da):85,849
    Checksum:i07D623D2E4A621A3
    GO
    Isoform 7 (identifier: O75128-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         366-366: V → GGGRQVPQKPPRGTARGPPQLVLPPPPPYPPPDTDVVEPLSFPGEGAGSEASDPIPKL
         1169-1215: Missing.

    Show »
    Length:1,271
    Mass (Da):136,682
    Checksum:i4A54B47129EA87A8
    GO

    Sequence cautioni

    The sequence BAA31608.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti481 – 4811Missing in AAH29275. (PubMed:15489334)Curated
    Sequence conflicti601 – 6011H → Y in AAH45771. (PubMed:15489334)Curated
    Sequence conflicti881 – 8811V → A in AAI44100. (PubMed:15489334)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti526 – 5261P → L.1 Publication
    Corresponds to variant rs17656599 [ dbSNP | Ensembl ].
    VAR_050894
    Natural varianti577 – 5771D → A.3 Publications
    Corresponds to variant rs10230120 [ dbSNP | Ensembl ].
    VAR_029043
    Natural varianti607 – 6071V → I.3 Publications
    Corresponds to variant rs2240090 [ dbSNP | Ensembl ].
    VAR_029044
    Natural varianti919 – 9191H → Q.1 Publication
    Corresponds to variant rs2240089 [ dbSNP | Ensembl ].
    VAR_050895
    Natural varianti927 – 9271D → N.1 Publication
    Corresponds to variant rs17134128 [ dbSNP | Ensembl ].
    VAR_029045
    Natural varianti1015 – 10151A → P.1 Publication
    Corresponds to variant rs17134127 [ dbSNP | Ensembl ].
    VAR_029046

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 458458Missing in isoform 6. 1 PublicationVSP_040711Add
    BLAST
    Alternative sequencei261 – 2611K → KAEQLVLSGADSDEDTSRAA PGRGLN in isoform 2. 1 PublicationVSP_021607
    Alternative sequencei366 – 3661V → GGGRQVPQKPPRGTARGPPQ LVLPPPPPYPPPDTDVVEPL SFPGEGAGSEASDPIPKL in isoform 2 and isoform 7. 1 PublicationVSP_021608
    Alternative sequencei367 – 469103SLPLG…NSHLR → YGAAEAVIRLLSLLLNTTAP GTAKPRTLWMSEGRSSLHNP EIKCSCFSSSSPFPQSLLSL LLGLSSICECMCTLRHTHAH THNPSCVLPTSEILAFGRQS LIS in isoform 4. 1 PublicationVSP_021609Add
    BLAST
    Alternative sequencei367 – 37913SLPLG…HCSPD → YCCASFPTQAKRF in isoform 5. 1 PublicationVSP_021610Add
    BLAST
    Alternative sequencei380 – 1261882Missing in isoform 5. 1 PublicationVSP_021611Add
    BLAST
    Alternative sequencei459 – 46810EKNGSENSHL → MSAPFSLVFP in isoform 6. 1 PublicationVSP_040712
    Alternative sequencei470 – 1261792Missing in isoform 4. 1 PublicationVSP_021612Add
    BLAST
    Alternative sequencei1169 – 121547Missing in isoform 3 and isoform 7. 1 PublicationVSP_021613Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB014533 mRNA. Translation: BAA31608.1. Different initiation.
    AL713786 mRNA. Translation: CAD28543.1.
    AC005535 Genomic DNA. No translation available.
    AC012372 Genomic DNA. No translation available.
    AC004414 Genomic DNA. No translation available.
    CH236955 Genomic DNA. Translation: EAL23896.1.
    CH471128 Genomic DNA. Translation: EAW60962.1.
    BC029275 mRNA. Translation: AAH29275.1.
    BC045771 mRNA. Translation: AAH45771.1.
    BC094695 mRNA. Translation: AAH94695.1.
    BC111496 mRNA. Translation: AAI11497.1.
    BC136441 mRNA. Translation: AAI36442.1.
    BC144099 mRNA. Translation: AAI44100.1.
    BC150263 mRNA. Translation: AAI50264.1.
    CCDSiCCDS34637.1. [O75128-1]
    PIRiT00381.
    RefSeqiNP_001274365.1. NM_001287436.1. [O75128-7]
    NP_001274367.1. NM_001287438.1. [O75128-5]
    NP_056013.2. NM_015198.3. [O75128-1]
    XP_005271813.1. XM_005271756.1. [O75128-3]
    UniGeneiHs.99141.

    Genome annotation databases

    EnsembliENST00000265136; ENSP00000265136; ENSG00000106078. [O75128-1]
    ENST00000395540; ENSP00000378910; ENSG00000106078. [O75128-4]
    ENST00000395542; ENSP00000378912; ENSG00000106078. [O75128-2]
    ENST00000441453; ENSP00000399500; ENSG00000106078. [O75128-5]
    GeneIDi23242.
    KEGGihsa:23242.
    UCSCiuc003tpo.4. human. [O75128-6]
    uc003tpr.4. human. [O75128-1]
    uc003tps.3. human. [O75128-7]
    uc003tpt.3. human. [O75128-5]
    uc011kcl.2. human. [O75128-3]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB014533 mRNA. Translation: BAA31608.1 . Different initiation.
    AL713786 mRNA. Translation: CAD28543.1 .
    AC005535 Genomic DNA. No translation available.
    AC012372 Genomic DNA. No translation available.
    AC004414 Genomic DNA. No translation available.
    CH236955 Genomic DNA. Translation: EAL23896.1 .
    CH471128 Genomic DNA. Translation: EAW60962.1 .
    BC029275 mRNA. Translation: AAH29275.1 .
    BC045771 mRNA. Translation: AAH45771.1 .
    BC094695 mRNA. Translation: AAH94695.1 .
    BC111496 mRNA. Translation: AAI11497.1 .
    BC136441 mRNA. Translation: AAI36442.1 .
    BC144099 mRNA. Translation: AAI44100.1 .
    BC150263 mRNA. Translation: AAI50264.1 .
    CCDSi CCDS34637.1. [O75128-1 ]
    PIRi T00381.
    RefSeqi NP_001274365.1. NM_001287436.1. [O75128-7 ]
    NP_001274367.1. NM_001287438.1. [O75128-5 ]
    NP_056013.2. NM_015198.3. [O75128-1 ]
    XP_005271813.1. XM_005271756.1. [O75128-3 ]
    UniGenei Hs.99141.

    3D structure databases

    ProteinModelPortali O75128.
    SMRi O75128. Positions 152-230, 1108-1187.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 116846. 5 interactions.
    IntActi O75128. 1 interaction.
    STRINGi 9606.ENSP00000265136.

    PTM databases

    PhosphoSitei O75128.

    Proteomic databases

    MaxQBi O75128.
    PaxDbi O75128.
    PRIDEi O75128.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000265136 ; ENSP00000265136 ; ENSG00000106078 . [O75128-1 ]
    ENST00000395540 ; ENSP00000378910 ; ENSG00000106078 . [O75128-4 ]
    ENST00000395542 ; ENSP00000378912 ; ENSG00000106078 . [O75128-2 ]
    ENST00000441453 ; ENSP00000399500 ; ENSG00000106078 . [O75128-5 ]
    GeneIDi 23242.
    KEGGi hsa:23242.
    UCSCi uc003tpo.4. human. [O75128-6 ]
    uc003tpr.4. human. [O75128-1 ]
    uc003tps.3. human. [O75128-7 ]
    uc003tpt.3. human. [O75128-5 ]
    uc011kcl.2. human. [O75128-3 ]

    Organism-specific databases

    CTDi 23242.
    GeneCardsi GC07M051051.
    HGNCi HGNC:22199. COBL.
    HPAi HPA019033.
    HPA019167.
    MIMi 610317. gene.
    neXtProti NX_O75128.
    PharmGKBi PA134869580.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG76967.
    HOVERGENi HBG081301.
    OMAi QKPPRGT.
    PhylomeDBi O75128.
    TreeFami TF333490.

    Miscellaneous databases

    GenomeRNAii 23242.
    NextBioi 44908.
    PROi O75128.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O75128.
    Bgeei O75128.
    CleanExi HS_COBL.
    Genevestigatori O75128.

    Family and domain databases

    InterProi IPR019025. Cordon-bleu_ubiquitin_domain.
    IPR003124. WH2_dom.
    [Graphical view ]
    Pfami PF09469. Cobl. 1 hit.
    PF02205. WH2. 3 hits.
    [Graphical view ]
    SMARTi SM00246. WH2. 3 hits.
    [Graphical view ]
    PROSITEi PS51082. WH2. 3 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
      Ishikawa K., Nagase T., Suyama M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
      DNA Res. 5:169-176(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6), VARIANTS LEU-526; ALA-577; ILE-607 AND GLN-919.
      Tissue: Brain.
    3. "The DNA sequence of human chromosome 7."
      Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
      , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
      Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANTS ALA-577 AND ILE-607.
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3; 4; 5 AND 7), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 198-1261 (ISOFORM 2), VARIANTS ALA-577; ILE-607; ASN-927 AND PRO-1015.
      Tissue: Brain, Cervix, Muscle, Placenta and Testis.
    6. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
      Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
      J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-741, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    8. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-741 AND SER-815, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. "Cordon-Bleu uses WH2 domains as multifunctional dynamizers of actin filament assembly."
      Husson C., Renault L., Didry D., Pantaloni D., Carlier M.F.
      Mol. Cell 43:464-477(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.

    Entry informationi

    Entry nameiCOBL_HUMAN
    AccessioniPrimary (citable) accession number: O75128
    Secondary accession number(s): A4D257
    , A7E2B0, B7ZLW9, B9EGF8, Q2T9J3, Q504Y4, Q86XA7, Q8N304, Q8TCM1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 28, 2006
    Last sequence update: November 28, 2006
    Last modified: October 1, 2014
    This is version 92 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 7
      Human chromosome 7: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3