O75112 (LDB3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 107.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: LIM domain-binding protein 3 Alternative name(s): Protein cypher Z-band alternatively spliced PDZ-motif protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 727 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May function as an adapter in striated muscle to couple protein kinase C-mediated signaling via its LIM domains to the cytoskeleton. |
| Subunit structure | Interacts via its LIM domains with various PKC isoforms By similarity. Interacts via its PDZ domain with the ACTN2 C-terminal region. Interacts with MYOZ1, MYOZ2 and MYOZ3. Ref.1 Ref.7 UniProtKB Q9JKS4 |
| Subcellular location | Cytoplasm › perinuclear region. Cell projection › pseudopodium. Cytoplasm › cytoskeleton. Cytoplasm › myofibril › sarcomere › Z line. Note: Localized to the cytoplasm around nuclei and pseudopodia of undifferentiated cells and detected throughout the myotubes of differentiated cells. Colocalizes with ACTN2 at the Z-lines. Ref.1 |
| Tissue specificity | Expressed primarily in skeletal muscle and to a lesser extent in heart. Also detected in brain and placenta. Ref.1 |
| Involvement in disease | Defects in LDB3 are the cause of cardiomyopathy dilated type 1C (CMD1C) [MIM:601493]. Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death. Ref.9 Ref.10 Defects in LDB3 are the cause of left ventricular non-compaction type 3 (LVNC3) [MIM:601493]. Left ventricular non-compaction is characterized by numerous prominent trabeculations and deep intertrabecular recesses in hypertrophied and hypokinetic segments of the left ventricle. Defects in LDB3 are the cause of myopathy myofibrillar type 4 (MFM4) [MIM:609452]. A neuromuscular disorder characterized by distal and proximal muscle weakness with signs of cardiomyopathy and neuropathy. |
| Sequence similarities | Contains 3 LIM zinc-binding domains. Contains 1 PDZ (DHR) domain. |
| Sequence caution | The sequence BAA31588.1 differs from that shown. Reason: Erroneous initiation. Isoform 6: The sequence CAB46727.1 differs from that shown. Reason: Frameshift at positions 250 and 258. Isoform 6: The sequence AAQ14317.1 differs from that shown. Reason: Frameshift at positions 231 and 258. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell projection Cytoplasm Cytoskeleton |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Cardiomyopathy Disease mutation Myofibrillar myopathy |
| Domain | LIM domain Repeat |
| Ligand | Metal-binding Zinc |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | Z disc Inferred from electronic annotation. Source: UniProtKB-SubCell cytoskeletonInferred from direct assay Ref.1. Source: UniProtKB perinuclear region of cytoplasmInferred from electronic annotation. Source: UniProtKB-SubCell pseudopodiumInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | protein binding Inferred from physical interaction Ref.1. Source: UniProtKB zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | |||||||||
| Isoform 1 (identifier: O75112-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||||||
| Note: No experimental confirmation available. | |||||||||
| Isoform 2 Ref.1 (identifier: O75112-2) The sequence of this isoform differs from the canonical sequence as follows: 108-229: DPALDTNGSL...GKASGVGLPG → VVVNSPANAD...QAQAQGSDFS 299-361: Missing. | |||||||||
Sequence annotation (Features) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
| Natural variant | 117 | 1 | D → N in dilated cardiomyopathy with left ventricular non-compaction. | ||||||
| Natural variant | 136 | 1 | K → M in dilated cardiomyopathy with left ventricular non-compaction. | ||||||
| Natural variant | 147 | 1 | A → T in MFM4. | ||||||
| Natural variant | 165 | 1 | A → V in MFM4. | ||||||
| Isoform 3 Ref.1 (identifier: O75112-3) The sequence of this isoform differs from the canonical sequence as follows: 108-364: Missing. | |||||||||
| Isoform 4 Ref.2 (identifier: O75112-4) The sequence of this isoform differs from the canonical sequence as follows: 230-230: G → GADYQERFNPSALKDSALSTHKPIEVKGLGGKATIIHAQYNTPISMYSQDAIMDAIAGQAQAQGSDFSG 299-329: STPIEHAPVCTSQATTPLLPASAQPPAAASP → RERFETERNSPRFAKLRNWHHGLSAQILNVK 331-727: Missing. | |||||||||
Sequence annotation (Features) | |||||||||
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
| Natural variant | 232 | 1 | D → N in dilated cardiomyopathy with left ventricular non-compaction. | ||||||
| Natural variant | 251 | 1 | K → M in dilated cardiomyopathy with left ventricular non-compaction. | ||||||
| Natural variant | 262 | 1 | A → T in MFM4. | ||||||
| Natural variant | 280 | 1 | A → V in MFM4. | ||||||
| Natural variant | 383 | 1 | R → C in MFM4. | ||||||
| Isoform 5 Ref.2 (identifier: O75112-5) The sequence of this isoform differs from the canonical sequence as follows: 299-329: STPIEHAPVCTSQATTPLLPASAQPPAAASP → RERFETERNSPRFAKLRNWHHGLSAQILNVK 331-727: Missing. | |||||||||
Sequence annotation (Features) | |||||||||
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
| Natural variant | 315 | 1 | R → C in MFM-ZASP. | ||||||
| Isoform 6 Ref.1 Ref.2 (identifier: O75112-6) The sequence of this isoform differs from the canonical sequence as follows: 108-229: DPALDTNGSL...GKASGVGLPG → VVVNSPANAD...QAQAQGSDFS 299-329: STPIEHAPVCTSQATTPLLPASAQPPAAASP → RERFETERNSPRFAKLRNWHHGLSAQILNVK 331-727: Missing. | |||||||||
Sequence annotation (Features) | |||||||||
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
| Natural variant | 147 | 1 | A → T in MFM4. | ||||||
| Natural variant | 165 | 1 | A → V in MFM4. | ||||||
| Natural variant | 268 | 1 | R → C in MFM4. | ||||||
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 727 | 727 | LIM domain-binding protein 3 | PRO_0000075767 | |||||||||||||||||||||
Regions | |||||||||||||||||||||||||
| Domain | 1 – 84 | 84 | PDZ | ||||||||||||||||||||||
| Domain | 549 – 607 | 59 | LIM zinc-binding 1 | ||||||||||||||||||||||
| Domain | 608 – 667 | 60 | LIM zinc-binding 2 | ||||||||||||||||||||||
| Domain | 668 – 727 | 60 | LIM zinc-binding 3 | ||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||
| Alternative sequence | 108 – 364 | 257 | Missing in isoform 3. Ref.1 | VSP_051897 | |||||||||||||||||||||
| Alternative sequence | 108 – 229 | 122 | DPALD…VGLPG → VVVNSPANADYQERFNPSAL KDSALSTHKPIEVKGLGGKA TIIHAQYNTPISMYSQDAIM DAIAGQAQAQGSDFS in isoform 2 and isoform 6. Ref.1 Ref.2 | VSP_051898 | |||||||||||||||||||||
| Alternative sequence | 230 | 1 | G → GADYQERFNPSALKDSALST HKPIEVKGLGGKATIIHAQY NTPISMYSQDAIMDAIAGQA QAQGSDFSG in isoform 4. Ref.2 | VSP_051899 | |||||||||||||||||||||
| Alternative sequence | 299 – 361 | 63 | Missing in isoform 2. Ref.1 | VSP_051900 | |||||||||||||||||||||
| Alternative sequence | 299 – 329 | 31 | STPIE…AAASP → RERFETERNSPRFAKLRNWH HGLSAQILNVK in isoform 4, isoform 5 and isoform 6. Ref.1 Ref.2 | VSP_051901 | |||||||||||||||||||||
| Alternative sequence | 331 – 727 | 397 | Missing in isoform 4, isoform 5 and isoform 6. Ref.1 Ref.2 | VSP_051902 | |||||||||||||||||||||
| Natural variant | 55 | 1 | V → I. Ref.10 Corresponds to variant rs3740343 [ dbSNP | Ensembl ]. | VAR_024008 | |||||||||||||||||||||
| Natural variant | 101 | 1 | P → L. Corresponds to variant rs45592139 [ dbSNP | Ensembl ]. | VAR_050146 | |||||||||||||||||||||
| Natural variant | 189 | 1 | S → L in CMD1C. Ref.9 Corresponds to variant rs45487699 [ dbSNP | Ensembl ]. | VAR_024009 | |||||||||||||||||||||
| Natural variant | 206 | 1 | T → I in CMD1C. Ref.9 | VAR_024010 | |||||||||||||||||||||
| Natural variant | 345 | 1 | I → M in CMD1C. Ref.9 | VAR_024011 | |||||||||||||||||||||
| Natural variant | 635 | 1 | V → I. Ref.10 Corresponds to variant rs45618633 [ dbSNP | Ensembl ]. | VAR_024012 | |||||||||||||||||||||
| Natural variant | 673 | 1 | D → N in CMD1C. Ref.10 Corresponds to variant rs45514002 [ dbSNP | Ensembl ]. | VAR_024013 | |||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||
| Sequence conflict | 365 – 368 | 4 | ASSY → VVVN in CAB46729. Ref.1 | ||||||||||||||||||||||
| Sequence conflict | 372 | 1 | V → N in CAB46729. Ref.1 | ||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||
| Beta strand | 2 – 7 | 6 | |||||||||||||||||||||||
| Beta strand | 15 – 17 | 3 | |||||||||||||||||||||||
| Helix | 21 – 23 | 3 | |||||||||||||||||||||||
| Beta strand | 28 – 32 | 5 | |||||||||||||||||||||||
| Helix | 37 – 40 | 4 | |||||||||||||||||||||||
| Beta strand | 47 – 52 | 6 | |||||||||||||||||||||||
| Helix | 62 – 69 | 8 | |||||||||||||||||||||||
| Beta strand | 76 – 82 | 7 | |||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "ZASP: a new Z-band alternatively spliced PDZ-motif protein." Faulkner G., Pallavicini A., Formentin E., Comelli A., Ievolella C., Trevisan S., Bortoletto G., Scannapieco P., Salamon M., Mouly V., Valle G., Lanfranchi G. J. Cell Biol. 146:465-475(1999) [PubMed: 10427098] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3 AND 6), INTERACTION WITH ACTN2, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [2] | "ZASP: a new Z-band alternatively spliced PDZ-motif protein identified from a melanoma tumor line." Zeng G., Rosenberg S.A., Wang R.-F. Submitted (JAN-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 4; 5 AND 6). Tissue: Melanoma, Skeletal muscle and Uterus. |
| [3] | "Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro." Ishikawa K., Nagase T., Suyama M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:169-176(1998) [PubMed: 9734811] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [4] | NHLBI resequencing and genotyping service (RS&G) Submitted (DEC-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [5] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed: 15164054] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6). Tissue: Skeletal muscle. |
| [7] | "Calsarcin-3, a novel skeletal muscle-specific member of the calsarcin family, interacts with multiple Z-disc proteins." Frey N., Olson E.N. J. Biol. Chem. 277:13998-14004(2002) [PubMed: 11842093] [Abstract] Cited for: INTERACTION WITH MYOZ1; MYOZ2 AND MYOZ3. |
| [8] | "Solution structure of ZASP PDZ domain; implications for sarcomere ultrastructure and enigma family redundancy." Au Y., Atkinson R.A., Guerrini R., Kelly G., Joseph C., Martin S.R., Muskett F.W., Pallavicini A., Faulkner G., Pastore A. Structure 12:611-622(2004) [PubMed: 15062084] [Abstract] Cited for: STRUCTURE BY NMR OF 3-85. |
| [9] | "Mutations in Cypher/ZASP in patients with dilated cardiomyopathy and left ventricular non-compaction." Vatta M., Mohapatra B., Jimenez S., Sanchez X., Faulkner G., Perles Z., Sinagra G., Lin J.-H., Vu T.M., Zhou Q., Bowles K.R., Di Lenarda A., Schimmenti L., Fox M., Chrisco M.A., Murphy R.T., McKenna W., Elliott P. Towbin J.A.J. Am. Coll. Cardiol. 42:2014-2027(2003) [PubMed: 14662268] [Abstract] Cited for: VARIANTS DILATED CARDIOMYOPATHY WITH LEFT VENTRICULAR NON-COMPACTION, VARIANTS CMD1C LEU-189; ILE-206 AND MET-345. |
| [10] | "A Cypher/ZASP mutation associated with dilated cardiomyopathy alters the binding affinity to protein kinase C." Arimura T., Hayashi T., Terada H., Lee S.-Y., Zhou Q., Takahashi M., Ueda K., Nouchi T., Hohda S., Shibutani M., Hirose M., Chen J., Park J.-E., Yasunami M., Hayashi H., Kimura A. J. Biol. Chem. 279:6746-6752(2004) [PubMed: 14660611] [Abstract] Cited for: VARIANT CMD1C ASN-673, VARIANTS ILE-55 AND ILE-635. |
| [11] | "Mutations in ZASP define a novel form of muscular dystrophy in humans." Selcen D., Engel A.G. Ann. Neurol. 57:269-276(2005) [PubMed: 15668942] [Abstract] Cited for: VARIANTS MYOPATHY. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AJ133766 mRNA. Translation: CAB46727.1. Frameshift. AJ133767 mRNA. Translation: CAB46728.1. AJ133768 mRNA. Translation: CAB46729.1. AF276807 mRNA. Translation: AAQ14316.1. AF276808 mRNA. Translation: AAQ14317.1. Frameshift. AF276809 mRNA. Translation: AAQ14318.1. AB014513 mRNA. Translation: BAA31588.1. Different initiation. EF179181 Genomic DNA. Translation: ABN05284.1. AC067750 Genomic DNA. No translation available. BC010929 mRNA. Translation: AAH10929.1. | ||||||||||||
| IPI | IPI00165263. IPI00294958. IPI00294959. IPI00514458. IPI00552865. IPI00654766. | ||||||||||||
| RefSeq | NP_001073583.1. NM_001080114.1. NP_001073584.1. NM_001080115.1. NP_001073585.1. NM_001080116.1. NP_001165082.1. NM_001171611.1. NP_009009.1. NM_007078.2. | ||||||||||||
| UniGene | Hs.657271. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | O75112. | ||||||||||||
| SMR | O75112. Positions 5-83, 536-724. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | O75112. 1 interaction. | ||||||||||||
| STRING | O75112. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | O75112. | ||||||||||||
2D gel databases | |||||||||||||
| UCD-2DPAGE | O75112. Q9Y4Z5. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | O75112. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000361373; ENSP00000355296; ENSG00000122367. | ||||||||||||
| GeneID | 11155. | ||||||||||||
| KEGG | hsa:11155. | ||||||||||||
| UCSC | uc001kdr.1. human. uc001kds.1. human. uc001kdu.1. human. uc001kdv.1. human. uc009xsy.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 11155. | ||||||||||||
| GeneCards | GC10P088418. | ||||||||||||
| H-InvDB | HIX0008997. | ||||||||||||
| HGNC | HGNC:15710. LDB3. | ||||||||||||
| MIM | 601493. phenotype. 605906. gene+phenotype. 609452. phenotype. | ||||||||||||
| neXtProt | NX_O75112. | ||||||||||||
| Orphanet | 247. Arrhythmogenic right ventricular dysplasia. 154. Familial isolated dilated cardiomyopathy. 54260. Left ventricular noncompaction. 609. Tibial muscular dystrophy. 98912. ZASP-related myofibrillar myopathy. | ||||||||||||
| HUGE | Search... | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | prNOG14626. | ||||||||||||
| GeneTree | ENSGT00600000084390. | ||||||||||||
| HOVERGEN | HBG051478. | ||||||||||||
| InParanoid | O75112. | ||||||||||||
| OrthoDB | EOG4GTKDQ. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | O75112. | ||||||||||||
| Bgee | O75112. | ||||||||||||
| Genevestigator | O75112. | ||||||||||||
| GermOnline | ENSG00000122367. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR001478. PDZ/DHR/GLGF. IPR006643. ZASP. IPR001781. Znf_LIM. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:2.10.110.10. Znf_LIM. 3 hits. | ||||||||||||
| Pfam | PF00412. LIM. 3 hits. PF00595. PDZ. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00132. LIM. 3 hits. SM00228. PDZ. 1 hit. SM00735. ZM. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF50156. PDZ. 1 hit. | ||||||||||||
| PROSITE | PS00478. LIM_DOMAIN_1. 2 hits. PS50023. LIM_DOMAIN_2. 3 hits. PS50106. PDZ. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| NextBio | 42413. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | LDB3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O75112 Secondary accession number(s): A2TDB7 Q9Y4Z5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Recent format changes Overview of recent format changes |
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with