Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

LIM domain-binding protein 3

Gene

LDB3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May function as an adapter in striated muscle to couple protein kinase C-mediated signaling via its LIM domains to the cytoskeleton.Curated

GO - Molecular functioni

  • cytoskeletal protein binding Source: UniProtKB
  • zinc ion binding Source: InterPro

GO - Biological processi

Complete GO annotation...

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
LIM domain-binding protein 3
Alternative name(s):
Protein cypher
Z-band alternatively spliced PDZ-motif protein
Gene namesi
Name:LDB3Imported
Synonyms:KIAA0613Imported, ZASPImported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:15710. LDB3.

Subcellular locationi

GO - Cellular componenti

  • cytoskeleton Source: UniProtKB
  • perinuclear region of cytoplasm Source: UniProtKB-SubCell
  • pseudopodium Source: UniProtKB-SubCell
  • Z disc Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoskeleton

Pathology & Biotechi

Involvement in diseasei

Cardiomyopathy, dilated 1C, with or without left ventricular non-compaction (CMD1C)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death. Cardiomyopathy dilated type 1C is associated with left ventricular non-compaction in some patients. Left ventricular non-compaction is characterized by numerous prominent trabeculations and deep intertrabecular recesses in hypertrophied and hypokinetic segments of the left ventricle.
See also OMIM:601493
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_024009189S → L in CMD1C. 1 PublicationCorresponds to variant rs45487699dbSNPEnsembl.1
Natural variantiVAR_024010206T → I in CMD1C. 1 PublicationCorresponds to variant rs121908337dbSNPEnsembl.1
Natural variantiVAR_024011345I → M in CMD1C. 1 PublicationCorresponds to variant rs121908336dbSNPEnsembl.1
Natural variantiVAR_024013673D → N in CMD1C. 1 PublicationCorresponds to variant rs45514002dbSNPEnsembl.1
Left ventricular non-compaction 3 (LVNC3)
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disease due to an arrest of myocardial morphogenesis. It is characterized by a hypertrophic left ventricle with deep trabeculations and with poor systolic function, with or without associated left ventricular dilation. In some cases, it is associated with other congenital heart anomalies.
See also OMIM:601493
Myopathy, myofibrillar, 4 (MFM4)
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of myofibrillar myopathy, a group of chronic neuromuscular disorders characterized at ultrastructural level by disintegration of the sarcomeric Z disc and myofibrils, and replacement of the normal myofibrillar markings by small dense granules, or larger hyaline masses, or amorphous material. MFM4 is characterized by distal and proximal muscle weakness with signs of cardiomyopathy and neuropathy.
See also OMIM:609452
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 21 Publication (identifier: O75112-2)
Natural varianti147A → T in MFM4. 1
Natural varianti165A → V in MFM4. 1
Isoform 61 Publication (identifier: O75112-6)
Natural varianti147A → T in MFM4. Curated1 Publication1
Natural varianti165A → V in MFM4. Curated1 Publication1
Natural varianti268R → C in MFM4. Curated1 Publication1
Isoform 41 Publication (identifier: O75112-4)
Natural varianti262A → T in MFM4. 1
Natural varianti280A → V in MFM4. 1
Natural varianti383R → C in MFM4. 1

Keywords - Diseasei

Cardiomyopathy, Disease mutation, Myofibrillar myopathy

Organism-specific databases

DisGeNETi11155.
MalaCardsiLDB3.
MIMi601493. phenotype.
605906. gene+phenotype.
609452. phenotype.
OpenTargetsiENSG00000122367.
Orphaneti154. Familial isolated dilated cardiomyopathy.
98912. Late-onset distal myopathy, Markesbery-Griggs type.
54260. Left ventricular noncompaction.
PharmGKBiPA30318.

Polymorphism and mutation databases

BioMutaiLDB3.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000757671 – 727LIM domain-binding protein 3Add BLAST727

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei44PhosphoserineBy similarity1
Modified residuei121PhosphoserineBy similarity1
Modified residuei123PhosphoserineBy similarity1
Modified residuei217PhosphoserineBy similarity1
Modified residuei219Omega-N-methylarginineBy similarity1
Modified residuei223PhosphoserineBy similarity1
Modified residuei516Omega-N-methylarginineBy similarity1
Modified residuei533Omega-N-methylarginineBy similarity1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

MaxQBiO75112.
PeptideAtlasiO75112.
PRIDEiO75112.

2D gel databases

UCD-2DPAGEO75112.
Q9Y4Z5.

PTM databases

iPTMnetiO75112.
PhosphoSitePlusiO75112.

Expressioni

Tissue specificityi

Expressed primarily in skeletal muscle and to a lesser extent in heart. Also detected in brain and placenta.1 Publication

Gene expression databases

BgeeiENSG00000122367.
ExpressionAtlasiO75112. baseline and differential.
GenevisibleiO75112. HS.

Organism-specific databases

HPAiHPA048955.

Interactioni

Subunit structurei

Interacts via its LIM domains with various PKC isoforms (By similarity). Interacts via its PDZ domain with the ACTN2 C-terminal region. Interacts with MYOZ1, MYOZ2 and MYOZ3.By similarity2 Publications

GO - Molecular functioni

  • cytoskeletal protein binding Source: UniProtKB

Protein-protein interaction databases

BioGridi116326. 6 interactors.
IntActiO75112. 1 interactor.

Structurei

Secondary structure

1727
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi2 – 7Combined sources6
Beta strandi9 – 11Combined sources3
Beta strandi14 – 20Combined sources7
Helixi21 – 23Combined sources3
Beta strandi25 – 32Combined sources8
Helixi37 – 40Combined sources4
Beta strandi48 – 52Combined sources5
Helixi62 – 70Combined sources9
Beta strandi73 – 81Combined sources9

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1RGWNMR-A1-85[»]
4YDPX-ray1.40A/B1-84[»]
ProteinModelPortaliO75112.
SMRiO75112.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO75112.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1 – 84PDZPROSITE-ProRule annotationAdd BLAST84
Domaini549 – 607LIM zinc-binding 1PROSITE-ProRule annotationAdd BLAST59
Domaini608 – 667LIM zinc-binding 2PROSITE-ProRule annotationAdd BLAST60
Domaini668 – 727LIM zinc-binding 3PROSITE-ProRule annotationAdd BLAST60

Sequence similaritiesi

Contains 3 LIM zinc-binding domains.PROSITE-ProRule annotation
Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

GeneTreeiENSGT00760000118910.
HOGENOMiHOG000220936.
HOVERGENiHBG051478.
InParanoidiO75112.
KOiK19867.
OMAiREMAAMQ.
OrthoDBiEOG091G0A45.
PhylomeDBiO75112.
TreeFamiTF106408.

Family and domain databases

Gene3Di2.10.110.10. 3 hits.
2.30.42.10. 1 hit.
InterProiIPR031847. DUF4749.
IPR001478. PDZ.
IPR006643. Zasp-like_motif.
IPR001781. Znf_LIM.
[Graphical view]
PfamiPF15936. DUF4749. 1 hit.
PF00412. LIM. 3 hits.
PF00595. PDZ. 1 hit.
[Graphical view]
SMARTiSM00132. LIM. 3 hits.
SM00228. PDZ. 1 hit.
SM00735. ZM. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 1 hit.
PROSITEiPS00478. LIM_DOMAIN_1. 2 hits.
PS50023. LIM_DOMAIN_2. 3 hits.
PS50106. PDZ. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1Curated (identifier: O75112-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSYSVTLTGP GPWGFRLQGG KDFNMPLTIS RITPGSKAAQ SQLSQGDLVV
60 70 80 90 100
AIDGVNTDTM THLEAQNKIK SASYNLSLTL QKSKRPIPIS TTAPPVQTPL
110 120 130 140 150
PVIPHQKDPA LDTNGSLVAP SPSPEARASP GTPGTPELRP TFSPAFSRPS
160 170 180 190 200
AFSSLAEASD PGPPRASLRA KTSPEGARDL LGPKALPGSS QPRQYNNPIG
210 220 230 240 250
LYSAETLREM AQMYQMSLRG KASGVGLPGG SLPIKDLAVD SASPVYQAVI
260 270 280 290 300
KSQNKPEDEA DEWARRSSNL QSRSFRILAQ MTGTEFMQDP DEEALRRSST
310 320 330 340 350
PIEHAPVCTS QATTPLLPAS AQPPAAASPS AASPPLATAA AHTAIASAST
360 370 380 390 400
TAPASSPADS PRPQASSYSP AVAASSAPAT HTSYSEGPAA PAPKPRVVTT
410 420 430 440 450
ASIRPSVYQP VPASTYSPSP GANYSPTPYT PSPAPAYTPS PAPAYTPSPV
460 470 480 490 500
PTYTPSPAPA YTPSPAPNYN PAPSVAYSGG PAEPASRPPW VTDDSFSQKF
510 520 530 540 550
APGKSTTSIS KQTLPRGGPA YTPAGPQVPP LARGTVQRAE RFPASSRTPL
560 570 580 590 600
CGHCNNVIRG PFLVAMGRSW HPEEFTCAYC KTSLADVCFV EEQNNVYCER
610 620 630 640 650
CYEQFFAPLC AKCNTKIMGE VMHALRQTWH TTCFVCAACK KPFGNSLFHM
660 670 680 690 700
EDGEPYCEKD YINLFSTKCH GCDFPVEAGD KFIEALGHTW HDTCFICAVC
710 720
HVNLEGQPFY SKKDRPLCKK HAHTINL
Note: No experimental confirmation available.Curated
Length:727
Mass (Da):77,135
Last modified:December 6, 2005 - v2
Checksum:i67B5B699D2B2AB68
GO
Isoform 21 Publication (identifier: O75112-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     108-229: DPALDTNGSL...GKASGVGLPG → VVVNSPANAD...QAQAQGSDFS
     299-361: Missing.

Show »
Length:617
Mass (Da):66,671
Checksum:iF3F1EA54284E4271
GO
Isoform 31 Publication (identifier: O75112-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     108-364: Missing.

Show »
Length:470
Mass (Da):50,620
Checksum:iEEDF0FA566FF03D5
GO
Isoform 41 Publication (identifier: O75112-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     230-230: G → GADYQERFNPSALKDSALSTHKPIEVKGLGGKATIIHAQYNTPISMYSQDAIMDAIAGQAQAQGSDFSG
     299-329: STPIEHAPVCTSQATTPLLPASAQPPAAASP → RERFETERNSPRFAKLRNWHHGLSAQILNVK
     331-727: Missing.

Show »
Length:398
Mass (Da):42,832
Checksum:i9046ADEF699169BE
GO
Isoform 51 Publication (identifier: O75112-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     299-329: STPIEHAPVCTSQATTPLLPASAQPPAAASP → RERFETERNSPRFAKLRNWHHGLSAQILNVK
     331-727: Missing.

Show »
Length:330
Mass (Da):35,637
Checksum:iF6B8A00A6EF9B7E0
GO
Isoform 61 Publication (identifier: O75112-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     108-229: DPALDTNGSL...GKASGVGLPG → VVVNSPANAD...QAQAQGSDFS
     299-329: STPIEHAPVCTSQATTPLLPASAQPPAAASP → RERFETERNSPRFAKLRNWHHGLSAQILNVK
     331-727: Missing.

Show »
Length:283
Mass (Da):30,999
Checksum:i099A4472DB4D9258
GO
Isoform 7 (identifier: O75112-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     230-230: G → GADYQERFNPSALKDSALSTHKPIEVKGLGGKATIIHAQYNTPISMYSQDAIMDAIAGQAQAQGSDFSG
     299-361: Missing.

Note: No experimental confirmation available.
Show »
Length:732
Mass (Da):78,504
Checksum:i2820E6271E03DD4C
GO

Sequence cautioni

Isoform 6 : The sequence AAQ14317 differs from that shown. Reason: Frameshift at positions 231 and 258.Curated1 Publication
The sequence BAA31588 differs from that shown. Reason: Erroneous initiation.Curated
Isoform 6 : The sequence CAB46727 differs from that shown. Reason: Frameshift at positions 250 and 258.Curated1 Publication

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti365 – 368ASSY → VVVN in CAB46729 (PubMed:10427098).Curated4
Sequence conflicti372V → N in CAB46729 (PubMed:10427098).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02400855V → I.1 PublicationCorresponds to variant rs3740343dbSNPEnsembl.1
Natural variantiVAR_050146101P → L.Corresponds to variant rs45592139dbSNPEnsembl.1
Natural variantiVAR_024009189S → L in CMD1C. 1 PublicationCorresponds to variant rs45487699dbSNPEnsembl.1
Natural variantiVAR_024010206T → I in CMD1C. 1 PublicationCorresponds to variant rs121908337dbSNPEnsembl.1
Natural variantiVAR_024011345I → M in CMD1C. 1 PublicationCorresponds to variant rs121908336dbSNPEnsembl.1
Natural variantiVAR_024012635V → I.1 PublicationCorresponds to variant rs45618633dbSNPEnsembl.1
Natural variantiVAR_024013673D → N in CMD1C. 1 PublicationCorresponds to variant rs45514002dbSNPEnsembl.1
Isoform 21 Publication (identifier: O75112-2)
Natural varianti117D → N in dilated cardiomyopathy with left ventricular non-compaction. 1
Natural varianti136K → M in dilated cardiomyopathy with left ventricular non-compaction. 1
Natural varianti147A → T in MFM4. 1
Natural varianti165A → V in MFM4. 1
Isoform 61 Publication (identifier: O75112-6)
Natural varianti147A → T in MFM4. Curated1 Publication1
Natural varianti165A → V in MFM4. Curated1 Publication1
Natural varianti268R → C in MFM4. Curated1 Publication1
Isoform 41 Publication (identifier: O75112-4)
Natural varianti232D → N in dilated cardiomyopathy with left ventricular non-compaction. 1
Natural varianti251K → M in dilated cardiomyopathy with left ventricular non-compaction. 1
Natural varianti262A → T in MFM4. 1
Natural varianti280A → V in MFM4. 1
Natural varianti383R → C in MFM4. 1
Isoform 51 Publication (identifier: O75112-5)
Natural varianti315R → C in MFM-ZASP. 1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_051897108 – 364Missing in isoform 3. 1 PublicationAdd BLAST257
Alternative sequenceiVSP_051898108 – 229DPALD…VGLPG → VVVNSPANADYQERFNPSAL KDSALSTHKPIEVKGLGGKA TIIHAQYNTPISMYSQDAIM DAIAGQAQAQGSDFS in isoform 2 and isoform 6. 3 PublicationsAdd BLAST122
Alternative sequenceiVSP_051899230G → GADYQERFNPSALKDSALST HKPIEVKGLGGKATIIHAQY NTPISMYSQDAIMDAIAGQA QAQGSDFSG in isoform 4 and isoform 7. 2 Publications1
Alternative sequenceiVSP_051900299 – 361Missing in isoform 2 and isoform 7. 2 PublicationsAdd BLAST63
Alternative sequenceiVSP_051901299 – 329STPIE…AAASP → RERFETERNSPRFAKLRNWH HGLSAQILNVK in isoform 4, isoform 5 and isoform 6. 3 PublicationsAdd BLAST31
Alternative sequenceiVSP_051902331 – 727Missing in isoform 4, isoform 5 and isoform 6. 3 PublicationsAdd BLAST397

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ133766 mRNA. Translation: CAB46727.1. Frameshift.
AJ133767 mRNA. Translation: CAB46728.1.
AJ133768 mRNA. Translation: CAB46729.1.
AF276807 mRNA. Translation: AAQ14316.1.
AF276808 mRNA. Translation: AAQ14317.1. Frameshift.
AF276809 mRNA. Translation: AAQ14318.1.
AB014513 mRNA. Translation: BAA31588.1. Different initiation.
AK304760 mRNA. Translation: BAG65515.1.
EF179181 Genomic DNA. Translation: ABN05284.1.
AC067750 Genomic DNA. No translation available.
BC010929 mRNA. Translation: AAH10929.1.
CCDSiCCDS41544.1. [O75112-2]
CCDS41545.1. [O75112-6]
CCDS44450.1. [O75112-5]
CCDS53549.1. [O75112-4]
CCDS53550.1. [O75112-7]
CCDS7377.1. [O75112-1]
RefSeqiNP_001073583.1. NM_001080114.1. [O75112-2]
NP_001073584.1. NM_001080115.1. [O75112-5]
NP_001073585.1. NM_001080116.1. [O75112-6]
NP_001165081.1. NM_001171610.1. [O75112-7]
NP_001165082.1. NM_001171611.1. [O75112-4]
NP_009009.1. NM_007078.2. [O75112-1]
XP_005269521.1. XM_005269464.4. [O75112-1]
XP_005269525.1. XM_005269468.4. [O75112-5]
XP_011537497.1. XM_011539195.2. [O75112-4]
XP_016871097.1. XM_017015608.1. [O75112-5]
XP_016871098.1. XM_017015609.1. [O75112-6]
UniGeneiHs.657271.

Genome annotation databases

EnsembliENST00000263066; ENSP00000263066; ENSG00000122367. [O75112-2]
ENST00000361373; ENSP00000355296; ENSG00000122367. [O75112-1]
ENST00000372056; ENSP00000361126; ENSG00000122367. [O75112-4]
ENST00000372066; ENSP00000361136; ENSG00000122367. [O75112-6]
ENST00000429277; ENSP00000401437; ENSG00000122367. [O75112-7]
ENST00000623007; ENSP00000485389; ENSG00000122367. [O75112-5]
ENST00000623056; ENSP00000485500; ENSG00000122367. [O75112-7]
GeneIDi11155.
KEGGihsa:11155.
UCSCiuc001kdr.4. human. [O75112-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ133766 mRNA. Translation: CAB46727.1. Frameshift.
AJ133767 mRNA. Translation: CAB46728.1.
AJ133768 mRNA. Translation: CAB46729.1.
AF276807 mRNA. Translation: AAQ14316.1.
AF276808 mRNA. Translation: AAQ14317.1. Frameshift.
AF276809 mRNA. Translation: AAQ14318.1.
AB014513 mRNA. Translation: BAA31588.1. Different initiation.
AK304760 mRNA. Translation: BAG65515.1.
EF179181 Genomic DNA. Translation: ABN05284.1.
AC067750 Genomic DNA. No translation available.
BC010929 mRNA. Translation: AAH10929.1.
CCDSiCCDS41544.1. [O75112-2]
CCDS41545.1. [O75112-6]
CCDS44450.1. [O75112-5]
CCDS53549.1. [O75112-4]
CCDS53550.1. [O75112-7]
CCDS7377.1. [O75112-1]
RefSeqiNP_001073583.1. NM_001080114.1. [O75112-2]
NP_001073584.1. NM_001080115.1. [O75112-5]
NP_001073585.1. NM_001080116.1. [O75112-6]
NP_001165081.1. NM_001171610.1. [O75112-7]
NP_001165082.1. NM_001171611.1. [O75112-4]
NP_009009.1. NM_007078.2. [O75112-1]
XP_005269521.1. XM_005269464.4. [O75112-1]
XP_005269525.1. XM_005269468.4. [O75112-5]
XP_011537497.1. XM_011539195.2. [O75112-4]
XP_016871097.1. XM_017015608.1. [O75112-5]
XP_016871098.1. XM_017015609.1. [O75112-6]
UniGeneiHs.657271.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1RGWNMR-A1-85[»]
4YDPX-ray1.40A/B1-84[»]
ProteinModelPortaliO75112.
SMRiO75112.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116326. 6 interactors.
IntActiO75112. 1 interactor.

PTM databases

iPTMnetiO75112.
PhosphoSitePlusiO75112.

Polymorphism and mutation databases

BioMutaiLDB3.

2D gel databases

UCD-2DPAGEO75112.
Q9Y4Z5.

Proteomic databases

MaxQBiO75112.
PeptideAtlasiO75112.
PRIDEiO75112.

Protocols and materials databases

DNASUi11155.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000263066; ENSP00000263066; ENSG00000122367. [O75112-2]
ENST00000361373; ENSP00000355296; ENSG00000122367. [O75112-1]
ENST00000372056; ENSP00000361126; ENSG00000122367. [O75112-4]
ENST00000372066; ENSP00000361136; ENSG00000122367. [O75112-6]
ENST00000429277; ENSP00000401437; ENSG00000122367. [O75112-7]
ENST00000623007; ENSP00000485389; ENSG00000122367. [O75112-5]
ENST00000623056; ENSP00000485500; ENSG00000122367. [O75112-7]
GeneIDi11155.
KEGGihsa:11155.
UCSCiuc001kdr.4. human. [O75112-1]

Organism-specific databases

CTDi11155.
DisGeNETi11155.
GeneCardsiLDB3.
GeneReviewsiLDB3.
HGNCiHGNC:15710. LDB3.
HPAiHPA048955.
MalaCardsiLDB3.
MIMi601493. phenotype.
605906. gene+phenotype.
609452. phenotype.
neXtProtiNX_O75112.
OpenTargetsiENSG00000122367.
Orphaneti154. Familial isolated dilated cardiomyopathy.
98912. Late-onset distal myopathy, Markesbery-Griggs type.
54260. Left ventricular noncompaction.
PharmGKBiPA30318.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00760000118910.
HOGENOMiHOG000220936.
HOVERGENiHBG051478.
InParanoidiO75112.
KOiK19867.
OMAiREMAAMQ.
OrthoDBiEOG091G0A45.
PhylomeDBiO75112.
TreeFamiTF106408.

Miscellaneous databases

ChiTaRSiLDB3. human.
EvolutionaryTraceiO75112.
GeneWikiiLDB3.
GenomeRNAii11155.
PROiO75112.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000122367.
ExpressionAtlasiO75112. baseline and differential.
GenevisibleiO75112. HS.

Family and domain databases

Gene3Di2.10.110.10. 3 hits.
2.30.42.10. 1 hit.
InterProiIPR031847. DUF4749.
IPR001478. PDZ.
IPR006643. Zasp-like_motif.
IPR001781. Znf_LIM.
[Graphical view]
PfamiPF15936. DUF4749. 1 hit.
PF00412. LIM. 3 hits.
PF00595. PDZ. 1 hit.
[Graphical view]
SMARTiSM00132. LIM. 3 hits.
SM00228. PDZ. 1 hit.
SM00735. ZM. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 1 hit.
PROSITEiPS00478. LIM_DOMAIN_1. 2 hits.
PS50023. LIM_DOMAIN_2. 3 hits.
PS50106. PDZ. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiLDB3_HUMAN
AccessioniPrimary (citable) accession number: O75112
Secondary accession number(s): A2TDB7
, A6NIV4, B4E3K3, Q5K6N9, Q5K6P0, Q5K6P1, Q96FH2, Q9Y4Z3, Q9Y4Z4, Q9Y4Z5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 6, 2005
Last sequence update: December 6, 2005
Last modified: November 30, 2016
This is version 154 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.