Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O75095

- MEGF6_HUMAN

UniProt

O75095 - MEGF6_HUMAN

Protein

Multiple epidermal growth factor-like domains protein 6

Gene

MEGF6

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 113 (01 Oct 2014)
      Sequence version 4 (28 Jul 2009)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Molecular functioni

    1. calcium ion binding Source: InterPro
    2. protein binding Source: IntAct

    Keywords - Ligandi

    Calcium

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Multiple epidermal growth factor-like domains protein 6
    Short name:
    Multiple EGF-like domains protein 6
    Alternative name(s):
    Epidermal growth factor-like protein 3
    Short name:
    EGF-like protein 3
    Gene namesi
    Name:MEGF6
    Synonyms:EGFL3, KIAA0815
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:3232. MEGF6.

    Subcellular locationi

    Secreted Curated

    GO - Cellular componenti

    1. extracellular region Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Secreted

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA27665.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 3030Sequence AnalysisAdd
    BLAST
    Chaini31 – 15411511Multiple epidermal growth factor-like domains protein 6PRO_0000007524Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi48 ↔ 111Sequence Analysis
    Disulfide bondi77 ↔ 83Sequence Analysis
    Disulfide bondi110 ↔ 123Sequence Analysis
    Disulfide bondi128 ↔ 139By similarity
    Disulfide bondi133 ↔ 147By similarity
    Disulfide bondi149 ↔ 158By similarity
    Disulfide bondi165 ↔ 176By similarity
    Disulfide bondi172 ↔ 185By similarity
    Disulfide bondi187 ↔ 200By similarity
    Disulfide bondi242 ↔ 255By similarity
    Disulfide bondi248 ↔ 268By similarity
    Glycosylationi252 – 2521N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi270 ↔ 283By similarity
    Disulfide bondi289 ↔ 300By similarity
    Disulfide bondi296 ↔ 309By similarity
    Disulfide bondi311 ↔ 324By similarity
    Disulfide bondi416 ↔ 427By similarity
    Disulfide bondi423 ↔ 436By similarity
    Disulfide bondi438 ↔ 451By similarity
    Disulfide bondi520 ↔ 533By similarity
    Disulfide bondi527 ↔ 540By similarity
    Disulfide bondi542 ↔ 551By similarity
    Disulfide bondi564 ↔ 576By similarity
    Disulfide bondi570 ↔ 583By similarity
    Disulfide bondi585 ↔ 594By similarity
    Disulfide bondi607 ↔ 619By similarity
    Disulfide bondi613 ↔ 626By similarity
    Disulfide bondi628 ↔ 637By similarity
    Glycosylationi739 – 7391N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi740 ↔ 751By similarity
    Disulfide bondi744 ↔ 758By similarity
    Disulfide bondi760 ↔ 769By similarity
    Disulfide bondi786 ↔ 795By similarity
    Disulfide bondi789 ↔ 802By similarity
    Disulfide bondi804 ↔ 813By similarity
    Disulfide bondi826 ↔ 838By similarity
    Disulfide bondi832 ↔ 845By similarity
    Disulfide bondi847 ↔ 856By similarity
    Disulfide bondi869 ↔ 882By similarity
    Disulfide bondi873 ↔ 889By similarity
    Disulfide bondi891 ↔ 900By similarity
    Disulfide bondi913 ↔ 925By similarity
    Disulfide bondi919 ↔ 932By similarity
    Disulfide bondi934 ↔ 943By similarity
    Disulfide bondi999 ↔ 1011By similarity
    Disulfide bondi1005 ↔ 1018By similarity
    Disulfide bondi1020 ↔ 1029By similarity
    Disulfide bondi1042 ↔ 1054By similarity
    Disulfide bondi1048 ↔ 1061By similarity
    Disulfide bondi1063 ↔ 1072By similarity
    Disulfide bondi1085 ↔ 1097By similarity
    Disulfide bondi1091 ↔ 1104By similarity
    Disulfide bondi1106 ↔ 1115By similarity
    Disulfide bondi1128 ↔ 1140By similarity
    Disulfide bondi1134 ↔ 1147By similarity
    Disulfide bondi1149 ↔ 1158By similarity
    Disulfide bondi1215 ↔ 1227By similarity
    Disulfide bondi1221 ↔ 1234By similarity
    Disulfide bondi1236 ↔ 1245By similarity
    Disulfide bondi1258 ↔ 1270By similarity
    Disulfide bondi1264 ↔ 1277By similarity
    Disulfide bondi1279 ↔ 1288By similarity
    Disulfide bondi1301 ↔ 1313By similarity
    Disulfide bondi1307 ↔ 1320By similarity
    Disulfide bondi1322 ↔ 1331By similarity
    Disulfide bondi1348 ↔ 1356By similarity
    Disulfide bondi1350 ↔ 1363By similarity
    Disulfide bondi1365 ↔ 1374By similarity
    Disulfide bondi1387 ↔ 1399By similarity
    Disulfide bondi1393 ↔ 1406By similarity
    Disulfide bondi1408 ↔ 1417By similarity
    Disulfide bondi1473 ↔ 1485By similarity
    Disulfide bondi1479 ↔ 1492By similarity
    Disulfide bondi1494 ↔ 1503By similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiO75095.
    PRIDEiO75095.

    PTM databases

    PhosphoSiteiO75095.

    Expressioni

    Gene expression databases

    BgeeiO75095.
    CleanExiHS_MEGF6.
    GenevestigatoriO75095.

    Organism-specific databases

    HPAiHPA052129.

    Interactioni

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    ATXN7O152652EBI-947597,EBI-708350
    CACNA1AO005552EBI-947597,EBI-766279

    Protein-protein interaction databases

    BioGridi108273. 6 interactions.
    IntActiO75095. 7 interactions.
    MINTiMINT-2797336.
    STRINGi9606.ENSP00000348982.

    Structurei

    3D structure databases

    ProteinModelPortaliO75095.
    SMRiO75095. Positions 119-473, 511-1513.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini44 – 12582EMIPROSITE-ProRule annotationAdd
    BLAST
    Domaini124 – 15936EGF-like 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini161 – 20141EGF-like 2; calcium-bindingPROSITE-ProRule annotationAdd
    BLAST
    Domaini206 – 24237EGF-like 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini238 – 28447EGF-like 4PROSITE-ProRule annotationAdd
    BLAST
    Domaini285 – 32541EGF-like 5; calcium-bindingPROSITE-ProRule annotationAdd
    BLAST
    Domaini335 – 37036EGF-like 6PROSITE-ProRule annotationAdd
    BLAST
    Domaini375 – 41137EGF-like 7PROSITE-ProRule annotationAdd
    BLAST
    Domaini412 – 45241EGF-like 8; calcium-bindingPROSITE-ProRule annotationAdd
    BLAST
    Domaini516 – 55237EGF-like 9PROSITE-ProRule annotationAdd
    BLAST
    Domaini560 – 59536EGF-like 10PROSITE-ProRule annotationAdd
    BLAST
    Domaini603 – 63836EGF-like 11PROSITE-ProRule annotationAdd
    BLAST
    Domaini736 – 77035EGF-like 12PROSITE-ProRule annotationAdd
    BLAST
    Domaini783 – 81432EGF-like 13PROSITE-ProRule annotationAdd
    BLAST
    Domaini822 – 85736EGF-like 14PROSITE-ProRule annotationAdd
    BLAST
    Domaini865 – 90137EGF-like 15PROSITE-ProRule annotationAdd
    BLAST
    Domaini909 – 94436EGF-like 16PROSITE-ProRule annotationAdd
    BLAST
    Domaini955 – 98733EGF-like 17PROSITE-ProRule annotationAdd
    BLAST
    Domaini995 – 103036EGF-like 18PROSITE-ProRule annotationAdd
    BLAST
    Domaini1038 – 107336EGF-like 19PROSITE-ProRule annotationAdd
    BLAST
    Domaini1081 – 111636EGF-like 20PROSITE-ProRule annotationAdd
    BLAST
    Domaini1124 – 115936EGF-like 21PROSITE-ProRule annotationAdd
    BLAST
    Domaini1211 – 124636EGF-like 22PROSITE-ProRule annotationAdd
    BLAST
    Domaini1254 – 128936EGF-like 23PROSITE-ProRule annotationAdd
    BLAST
    Domaini1297 – 133236EGF-like 24PROSITE-ProRule annotationAdd
    BLAST
    Domaini1345 – 137531EGF-like 25PROSITE-ProRule annotationAdd
    BLAST
    Domaini1383 – 141836EGF-like 26PROSITE-ProRule annotationAdd
    BLAST
    Domaini1469 – 150436EGF-like 27PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 27 EGF-like domains.PROSITE-ProRule annotation
    Contains 1 EMI domain.PROSITE-ProRule annotation

    Keywords - Domaini

    EGF-like domain, Repeat, Signal

    Phylogenomic databases

    eggNOGiNOG12793.
    HOGENOMiHOG000097840.
    HOVERGENiHBG079790.
    OMAiCRKKCHC.
    OrthoDBiEOG72C50D.
    PhylomeDBiO75095.
    TreeFamiTF332598.

    Family and domain databases

    InterProiIPR000742. EG-like_dom.
    IPR001881. EGF-like_Ca-bd_dom.
    IPR013032. EGF-like_CS.
    IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
    IPR018097. EGF_Ca-bd_CS.
    IPR002049. EGF_laminin.
    IPR011489. EMI_domain.
    IPR009030. Growth_fac_rcpt_N_dom.
    [Graphical view]
    PfamiPF07645. EGF_CA. 1 hit.
    PF00053. Laminin_EGF. 5 hits.
    [Graphical view]
    SMARTiSM00181. EGF. 15 hits.
    SM00179. EGF_CA. 3 hits.
    SM00180. EGF_Lam. 10 hits.
    [Graphical view]
    SUPFAMiSSF57184. SSF57184. 4 hits.
    PROSITEiPS00010. ASX_HYDROXYL. 4 hits.
    PS00022. EGF_1. 23 hits.
    PS01186. EGF_2. 24 hits.
    PS50026. EGF_3. 23 hits.
    PS01187. EGF_CA. 4 hits.
    PS51041. EMI. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O75095-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSFLEEARAA GRAVVLALVL LLLPAVPVGA SVPPRPLLPL QPGMPHVCAE     50
    QELTLVGRRQ PCVQALSHTV PVWKAGCGWQ AWCVGHERRT VYYMGYRQVY 100
    TTEARTVLRC CRGWMQQPDE EGCLSAECSA SLCFHGGRCV PGSAQPCHCP 150
    PGFQGPRCQY DVDECRTHNG GCQHRCVNTP GSYLCECKPG FRLHTDSRTC 200
    LAINSCALGN GGCQHHCVQL TITRHRCQCR PGFQLQEDGR HCVRRSPCAN 250
    RNGSCMHRCQ VVRGLARCEC HVGYQLAADG KACEDVDECA AGLAQCAHGC 300
    LNTQGSFKCV CHAGYELGAD GRQCYRIEME IVNSCEANNG GCSHGCSHTS 350
    AGPLCTCPRG YELDTDQRTC IDVDDCADSP CCQQVCTNNP GGYECGCYAG 400
    YRLSADGCGC EDVDECASSR GGCEHHCTNL AGSFQCSCEA GYRLHEDRRG 450
    CSPLEEPMVD LDGELPFVRP LPHIAVLQDE LPQLFQDDDV GADEEEAELR 500
    GEHTLTEKFV CLDDSFGHDC SLTCDDCRNG GTCLLGLDGC DCPEGWTGLI 550
    CNETCPPDTF GKNCSFSCSC QNGGTCDSVT GACRCPPGVS GTNCEDGCPK 600
    GYYGKHCRKK CNCANRGRCH RLYGACLCDP GLYGRFCHLT CPPWAFGPGC 650
    SEECQCVQPH TQSCDKRDGS CSCKAGFRGE RCQAECELGY FGPGCWQACT 700
    CPVGVACDSV SGECGKRCPA GFQGEDCGQE CPVGTFGVNC SSSCSCGGAP 750
    CHGVTGQCRC PPGRTGEDCE ADCPEGRWGL GCQEICPACQ HAARCDPETG 800
    ACLCLPGFVG SRCQDVCPAG WYGPSCQTRC SCANDGHCHP ATGHCSCAPG 850
    WTGFSCQRAC DTGHWGPDCS HPCNCSAGHG SCDAISGLCL CEAGYVGPRC 900
    EQQCPQGHFG PGCEQRCQCQ HGAACDHVSG ACTCPAGWRG TFCEHACPAG 950
    FFGLDCRSAC NCTAGAACDA VNGSCLCPAG RRGPRCAETC PAHTYGHNCS 1000
    QACACFNGAS CDPVHGQCHC APGWMGPSCL QACPAGLYGD NCRHSCLCQN 1050
    GGTCDPVSGH CACPEGWAGL ACEKECLPRD VRAGCRHSGG CLNGGLCDPH 1100
    TGRCLCPAGW TGDKCQSPCL RGWFGEACAQ RCSCPPGAAC HHVTGACRCP 1150
    PGFTGSGCEQ ACPPGSFGED CAQMCQCPGE NPACHPATGT CSCAAGYHGP 1200
    SCQQRCPPGR YGPGCEQLCG CLNGGSCDAA TGACRCPTGF LGTDCNLTCP 1250
    QGRFGPNCTH VCGCGQGAAC DPVTGTCLCP PGRAGVRCER GCPQNRFGVG 1300
    CEHTCSCRNG GLCHASNGSC SCGLGWTGRH CELACPPGRY GAACHLECSC 1350
    HNNSTCEPAT GTCRCGPGFY GQACEHPCPP GFHGAGCQGL CWCQHGAPCD 1400
    PISGRCLCPA GFHGHFCERG CEPGSFGEGC HQRCDCDGGA PCDPVTGLCL 1450
    CPPGRSGATC NLDCRRGQFG PSCTLHCDCG GGADCDPVSG QCHCVDGYMG 1500
    PTCREGGPLR LPENPSLAQG SAGTLPASSR PTSRSGGPAR H 1541
    Length:1,541
    Mass (Da):161,185
    Last modified:July 28, 2009 - v4
    Checksum:iEF2A7CB65140A7BB
    GO
    Isoform 2 (identifier: O75095-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-159: Missing.
         160-160: Y → MGASRDRGLAALWCLGLLGGLARVAGTHYRYLWRGCYPCHLGQAGYPVSAGDQRP
         989-1075: TCPAHTYGHN...GWAGLACEKE → K
         1161-1205: ACPPGSFGEDCAQMCQCPGENPACHPATGTCSCAAGYHGPSCQQR → G
         1377-1454: PCPPGFHGAG...VTGLCLCPPG → R

    Note: No experimental confirmation available.

    Show »
    Length:1,229
    Mass (Da):128,614
    Checksum:iC01A97596FFC0A8F
    GO

    Sequence cautioni

    The sequence BAE19678.1 differs from that shown. Reason: Frameshift at position 1522.
    The sequence BAA32467.2 differs from that shown. Reason: Erroneous initiation.
    The sequence BAE19678.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti115 – 1151M → T.
    Corresponds to variant rs7513275 [ dbSNP | Ensembl ].
    VAR_059258
    Natural varianti131 – 1311S → G.1 Publication
    Corresponds to variant rs2794340 [ dbSNP | Ensembl ].
    VAR_058361
    Natural varianti313 – 3131A → V.
    Corresponds to variant rs11585362 [ dbSNP | Ensembl ].
    VAR_059259
    Natural varianti587 – 5871P → L.
    Corresponds to variant rs947345 [ dbSNP | Ensembl ].
    VAR_061155
    Natural varianti688 – 6881L → P.
    Corresponds to variant rs2821008 [ dbSNP | Ensembl ].
    VAR_059260
    Natural varianti916 – 9161R → L.1 Publication
    Corresponds to variant rs7553399 [ dbSNP | Ensembl ].
    VAR_058362
    Natural varianti1137 – 11371G → A.1 Publication
    Corresponds to variant rs4648506 [ dbSNP | Ensembl ].
    VAR_058363
    Natural varianti1287 – 12871R → H.
    Corresponds to variant rs57804877 [ dbSNP | Ensembl ].
    VAR_061156
    Natural varianti1536 – 15361G → S.
    Corresponds to variant rs57484147 [ dbSNP | Ensembl ].
    VAR_061157

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 159159Missing in isoform 2. 1 PublicationVSP_037740Add
    BLAST
    Alternative sequencei160 – 1601Y → MGASRDRGLAALWCLGLLGG LARVAGTHYRYLWRGCYPCH LGQAGYPVSAGDQRP in isoform 2. 1 PublicationVSP_037741
    Alternative sequencei989 – 107587TCPAH…ACEKE → K in isoform 2. 1 PublicationVSP_037742Add
    BLAST
    Alternative sequencei1161 – 120545ACPPG…SCQQR → G in isoform 2. 1 PublicationVSP_037743Add
    BLAST
    Alternative sequencei1377 – 145478PCPPG…LCPPG → R in isoform 2. 1 PublicationVSP_037744Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB011539 mRNA. Translation: BAA32467.2. Different initiation.
    AB231860 mRNA. Translation: BAE19678.1. Sequence problems.
    AL512413, AL513320 Genomic DNA. Translation: CAH70834.1.
    AL513320, AL512413 Genomic DNA. Translation: CAI14334.1.
    CCDSiCCDS41237.1. [O75095-1]
    RefSeqiNP_001400.3. NM_001409.3. [O75095-1]
    UniGeneiHs.593645.

    Genome annotation databases

    EnsembliENST00000294599; ENSP00000294599; ENSG00000162591. [O75095-2]
    ENST00000356575; ENSP00000348982; ENSG00000162591. [O75095-1]
    GeneIDi1953.
    KEGGihsa:1953.
    UCSCiuc001akk.3. human. [O75095-2]
    uc001akl.3. human. [O75095-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB011539 mRNA. Translation: BAA32467.2 . Different initiation.
    AB231860 mRNA. Translation: BAE19678.1 . Sequence problems.
    AL512413 , AL513320 Genomic DNA. Translation: CAH70834.1 .
    AL513320 , AL512413 Genomic DNA. Translation: CAI14334.1 .
    CCDSi CCDS41237.1. [O75095-1 ]
    RefSeqi NP_001400.3. NM_001409.3. [O75095-1 ]
    UniGenei Hs.593645.

    3D structure databases

    ProteinModelPortali O75095.
    SMRi O75095. Positions 119-473, 511-1513.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 108273. 6 interactions.
    IntActi O75095. 7 interactions.
    MINTi MINT-2797336.
    STRINGi 9606.ENSP00000348982.

    PTM databases

    PhosphoSitei O75095.

    Proteomic databases

    PaxDbi O75095.
    PRIDEi O75095.

    Protocols and materials databases

    DNASUi 1953.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000294599 ; ENSP00000294599 ; ENSG00000162591 . [O75095-2 ]
    ENST00000356575 ; ENSP00000348982 ; ENSG00000162591 . [O75095-1 ]
    GeneIDi 1953.
    KEGGi hsa:1953.
    UCSCi uc001akk.3. human. [O75095-2 ]
    uc001akl.3. human. [O75095-1 ]

    Organism-specific databases

    CTDi 1953.
    GeneCardsi GC01M003396.
    H-InvDB HIX0000066.
    HGNCi HGNC:3232. MEGF6.
    HPAi HPA052129.
    MIMi 604266. gene.
    neXtProti NX_O75095.
    PharmGKBi PA27665.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG12793.
    HOGENOMi HOG000097840.
    HOVERGENi HBG079790.
    OMAi CRKKCHC.
    OrthoDBi EOG72C50D.
    PhylomeDBi O75095.
    TreeFami TF332598.

    Miscellaneous databases

    GenomeRNAii 1953.
    NextBioi 7915.
    PROi O75095.
    SOURCEi Search...

    Gene expression databases

    Bgeei O75095.
    CleanExi HS_MEGF6.
    Genevestigatori O75095.

    Family and domain databases

    InterProi IPR000742. EG-like_dom.
    IPR001881. EGF-like_Ca-bd_dom.
    IPR013032. EGF-like_CS.
    IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
    IPR018097. EGF_Ca-bd_CS.
    IPR002049. EGF_laminin.
    IPR011489. EMI_domain.
    IPR009030. Growth_fac_rcpt_N_dom.
    [Graphical view ]
    Pfami PF07645. EGF_CA. 1 hit.
    PF00053. Laminin_EGF. 5 hits.
    [Graphical view ]
    SMARTi SM00181. EGF. 15 hits.
    SM00179. EGF_CA. 3 hits.
    SM00180. EGF_Lam. 10 hits.
    [Graphical view ]
    SUPFAMi SSF57184. SSF57184. 4 hits.
    PROSITEi PS00010. ASX_HYDROXYL. 4 hits.
    PS00022. EGF_1. 23 hits.
    PS01186. EGF_2. 24 hits.
    PS50026. EGF_3. 23 hits.
    PS01187. EGF_CA. 4 hits.
    PS51041. EMI. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identification of high-molecular-weight proteins with multiple EGF-like motifs by motif-trap screening."
      Nakayama M., Nakajima D., Nagase T., Nomura N., Seki N., Ohara O.
      Genomics 51:27-34(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), VARIANTS GLY-131; LEU-916 AND ALA-1137.
      Tissue: Brain and Spleen.
    2. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
      Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
      DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: SEQUENCE REVISION.
    3. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

    Entry informationi

    Entry nameiMEGF6_HUMAN
    AccessioniPrimary (citable) accession number: O75095
    Secondary accession number(s): Q4AC86, Q5VV39
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 13, 2004
    Last sequence update: July 28, 2009
    Last modified: October 1, 2014
    This is version 113 of the entry and version 4 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3