SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O75095

- MEGF6_HUMAN

UniProt

O75095 - MEGF6_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Multiple epidermal growth factor-like domains protein 6
Gene
MEGF6, EGFL3, KIAA0815
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  1. calcium ion binding Source: InterPro
  2. protein binding Source: IntAct
Complete GO annotation...

Keywords - Ligandi

Calcium

Names & Taxonomyi

Protein namesi
Recommended name:
Multiple epidermal growth factor-like domains protein 6
Short name:
Multiple EGF-like domains protein 6
Alternative name(s):
Epidermal growth factor-like protein 3
Short name:
EGF-like protein 3
Gene namesi
Name:MEGF6
Synonyms:EGFL3, KIAA0815
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:3232. MEGF6.

Subcellular locationi

Secreted Reviewed prediction

GO - Cellular componenti

  1. extracellular region Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA27665.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3030 Reviewed prediction
Add
BLAST
Chaini31 – 15411511Multiple epidermal growth factor-like domains protein 6
PRO_0000007524Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi48 ↔ 111 Reviewed prediction
Disulfide bondi77 ↔ 83 Reviewed prediction
Disulfide bondi110 ↔ 123 Reviewed prediction
Disulfide bondi128 ↔ 139 By similarity
Disulfide bondi133 ↔ 147 By similarity
Disulfide bondi149 ↔ 158 By similarity
Disulfide bondi165 ↔ 176 By similarity
Disulfide bondi172 ↔ 185 By similarity
Disulfide bondi187 ↔ 200 By similarity
Disulfide bondi242 ↔ 255 By similarity
Disulfide bondi248 ↔ 268 By similarity
Glycosylationi252 – 2521N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi270 ↔ 283 By similarity
Disulfide bondi289 ↔ 300 By similarity
Disulfide bondi296 ↔ 309 By similarity
Disulfide bondi311 ↔ 324 By similarity
Disulfide bondi416 ↔ 427 By similarity
Disulfide bondi423 ↔ 436 By similarity
Disulfide bondi438 ↔ 451 By similarity
Disulfide bondi520 ↔ 533 By similarity
Disulfide bondi527 ↔ 540 By similarity
Disulfide bondi542 ↔ 551 By similarity
Disulfide bondi564 ↔ 576 By similarity
Disulfide bondi570 ↔ 583 By similarity
Disulfide bondi585 ↔ 594 By similarity
Disulfide bondi607 ↔ 619 By similarity
Disulfide bondi613 ↔ 626 By similarity
Disulfide bondi628 ↔ 637 By similarity
Glycosylationi739 – 7391N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi740 ↔ 751 By similarity
Disulfide bondi744 ↔ 758 By similarity
Disulfide bondi760 ↔ 769 By similarity
Disulfide bondi786 ↔ 795 By similarity
Disulfide bondi789 ↔ 802 By similarity
Disulfide bondi804 ↔ 813 By similarity
Disulfide bondi826 ↔ 838 By similarity
Disulfide bondi832 ↔ 845 By similarity
Disulfide bondi847 ↔ 856 By similarity
Disulfide bondi869 ↔ 882 By similarity
Disulfide bondi873 ↔ 889 By similarity
Disulfide bondi891 ↔ 900 By similarity
Disulfide bondi913 ↔ 925 By similarity
Disulfide bondi919 ↔ 932 By similarity
Disulfide bondi934 ↔ 943 By similarity
Disulfide bondi999 ↔ 1011 By similarity
Disulfide bondi1005 ↔ 1018 By similarity
Disulfide bondi1020 ↔ 1029 By similarity
Disulfide bondi1042 ↔ 1054 By similarity
Disulfide bondi1048 ↔ 1061 By similarity
Disulfide bondi1063 ↔ 1072 By similarity
Disulfide bondi1085 ↔ 1097 By similarity
Disulfide bondi1091 ↔ 1104 By similarity
Disulfide bondi1106 ↔ 1115 By similarity
Disulfide bondi1128 ↔ 1140 By similarity
Disulfide bondi1134 ↔ 1147 By similarity
Disulfide bondi1149 ↔ 1158 By similarity
Disulfide bondi1215 ↔ 1227 By similarity
Disulfide bondi1221 ↔ 1234 By similarity
Disulfide bondi1236 ↔ 1245 By similarity
Disulfide bondi1258 ↔ 1270 By similarity
Disulfide bondi1264 ↔ 1277 By similarity
Disulfide bondi1279 ↔ 1288 By similarity
Disulfide bondi1301 ↔ 1313 By similarity
Disulfide bondi1307 ↔ 1320 By similarity
Disulfide bondi1322 ↔ 1331 By similarity
Disulfide bondi1348 ↔ 1356 By similarity
Disulfide bondi1350 ↔ 1363 By similarity
Disulfide bondi1365 ↔ 1374 By similarity
Disulfide bondi1387 ↔ 1399 By similarity
Disulfide bondi1393 ↔ 1406 By similarity
Disulfide bondi1408 ↔ 1417 By similarity
Disulfide bondi1473 ↔ 1485 By similarity
Disulfide bondi1479 ↔ 1492 By similarity
Disulfide bondi1494 ↔ 1503 By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiO75095.
PRIDEiO75095.

PTM databases

PhosphoSiteiO75095.

Expressioni

Gene expression databases

BgeeiO75095.
CleanExiHS_MEGF6.
GenevestigatoriO75095.

Organism-specific databases

HPAiHPA052129.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
ATXN7O152652EBI-947597,EBI-708350
CACNA1AO005552EBI-947597,EBI-766279

Protein-protein interaction databases

BioGridi108273. 6 interactions.
IntActiO75095. 7 interactions.
MINTiMINT-2797336.
STRINGi9606.ENSP00000348982.

Structurei

3D structure databases

ProteinModelPortaliO75095.
SMRiO75095. Positions 119-473, 511-1513.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini44 – 12582EMI
Add
BLAST
Domaini124 – 15936EGF-like 1
Add
BLAST
Domaini161 – 20141EGF-like 2; calcium-binding Reviewed prediction
Add
BLAST
Domaini206 – 24237EGF-like 3
Add
BLAST
Domaini238 – 28447EGF-like 4
Add
BLAST
Domaini285 – 32541EGF-like 5; calcium-binding Reviewed prediction
Add
BLAST
Domaini335 – 37036EGF-like 6
Add
BLAST
Domaini375 – 41137EGF-like 7
Add
BLAST
Domaini412 – 45241EGF-like 8; calcium-binding Reviewed prediction
Add
BLAST
Domaini516 – 55237EGF-like 9
Add
BLAST
Domaini560 – 59536EGF-like 10
Add
BLAST
Domaini603 – 63836EGF-like 11
Add
BLAST
Domaini736 – 77035EGF-like 12
Add
BLAST
Domaini783 – 81432EGF-like 13
Add
BLAST
Domaini822 – 85736EGF-like 14
Add
BLAST
Domaini865 – 90137EGF-like 15
Add
BLAST
Domaini909 – 94436EGF-like 16
Add
BLAST
Domaini955 – 98733EGF-like 17
Add
BLAST
Domaini995 – 103036EGF-like 18
Add
BLAST
Domaini1038 – 107336EGF-like 19
Add
BLAST
Domaini1081 – 111636EGF-like 20
Add
BLAST
Domaini1124 – 115936EGF-like 21
Add
BLAST
Domaini1211 – 124636EGF-like 22
Add
BLAST
Domaini1254 – 128936EGF-like 23
Add
BLAST
Domaini1297 – 133236EGF-like 24
Add
BLAST
Domaini1345 – 137531EGF-like 25
Add
BLAST
Domaini1383 – 141836EGF-like 26
Add
BLAST
Domaini1469 – 150436EGF-like 27
Add
BLAST

Sequence similaritiesi

Contains 27 EGF-like domains.
Contains 1 EMI domain.

Keywords - Domaini

EGF-like domain, Repeat, Signal

Phylogenomic databases

eggNOGiNOG12793.
HOGENOMiHOG000097840.
HOVERGENiHBG079790.
OMAiCRKKCHC.
OrthoDBiEOG72C50D.
PhylomeDBiO75095.
TreeFamiTF332598.

Family and domain databases

InterProiIPR000742. EG-like_dom.
IPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR002049. EGF_laminin.
IPR011489. EMI_domain.
IPR009030. Growth_fac_rcpt_N_dom.
[Graphical view]
PfamiPF07645. EGF_CA. 1 hit.
PF00053. Laminin_EGF. 5 hits.
[Graphical view]
SMARTiSM00181. EGF. 15 hits.
SM00179. EGF_CA. 3 hits.
SM00180. EGF_Lam. 10 hits.
[Graphical view]
SUPFAMiSSF57184. SSF57184. 4 hits.
PROSITEiPS00010. ASX_HYDROXYL. 4 hits.
PS00022. EGF_1. 23 hits.
PS01186. EGF_2. 24 hits.
PS50026. EGF_3. 23 hits.
PS01187. EGF_CA. 4 hits.
PS51041. EMI. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O75095-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSFLEEARAA GRAVVLALVL LLLPAVPVGA SVPPRPLLPL QPGMPHVCAE     50
QELTLVGRRQ PCVQALSHTV PVWKAGCGWQ AWCVGHERRT VYYMGYRQVY 100
TTEARTVLRC CRGWMQQPDE EGCLSAECSA SLCFHGGRCV PGSAQPCHCP 150
PGFQGPRCQY DVDECRTHNG GCQHRCVNTP GSYLCECKPG FRLHTDSRTC 200
LAINSCALGN GGCQHHCVQL TITRHRCQCR PGFQLQEDGR HCVRRSPCAN 250
RNGSCMHRCQ VVRGLARCEC HVGYQLAADG KACEDVDECA AGLAQCAHGC 300
LNTQGSFKCV CHAGYELGAD GRQCYRIEME IVNSCEANNG GCSHGCSHTS 350
AGPLCTCPRG YELDTDQRTC IDVDDCADSP CCQQVCTNNP GGYECGCYAG 400
YRLSADGCGC EDVDECASSR GGCEHHCTNL AGSFQCSCEA GYRLHEDRRG 450
CSPLEEPMVD LDGELPFVRP LPHIAVLQDE LPQLFQDDDV GADEEEAELR 500
GEHTLTEKFV CLDDSFGHDC SLTCDDCRNG GTCLLGLDGC DCPEGWTGLI 550
CNETCPPDTF GKNCSFSCSC QNGGTCDSVT GACRCPPGVS GTNCEDGCPK 600
GYYGKHCRKK CNCANRGRCH RLYGACLCDP GLYGRFCHLT CPPWAFGPGC 650
SEECQCVQPH TQSCDKRDGS CSCKAGFRGE RCQAECELGY FGPGCWQACT 700
CPVGVACDSV SGECGKRCPA GFQGEDCGQE CPVGTFGVNC SSSCSCGGAP 750
CHGVTGQCRC PPGRTGEDCE ADCPEGRWGL GCQEICPACQ HAARCDPETG 800
ACLCLPGFVG SRCQDVCPAG WYGPSCQTRC SCANDGHCHP ATGHCSCAPG 850
WTGFSCQRAC DTGHWGPDCS HPCNCSAGHG SCDAISGLCL CEAGYVGPRC 900
EQQCPQGHFG PGCEQRCQCQ HGAACDHVSG ACTCPAGWRG TFCEHACPAG 950
FFGLDCRSAC NCTAGAACDA VNGSCLCPAG RRGPRCAETC PAHTYGHNCS 1000
QACACFNGAS CDPVHGQCHC APGWMGPSCL QACPAGLYGD NCRHSCLCQN 1050
GGTCDPVSGH CACPEGWAGL ACEKECLPRD VRAGCRHSGG CLNGGLCDPH 1100
TGRCLCPAGW TGDKCQSPCL RGWFGEACAQ RCSCPPGAAC HHVTGACRCP 1150
PGFTGSGCEQ ACPPGSFGED CAQMCQCPGE NPACHPATGT CSCAAGYHGP 1200
SCQQRCPPGR YGPGCEQLCG CLNGGSCDAA TGACRCPTGF LGTDCNLTCP 1250
QGRFGPNCTH VCGCGQGAAC DPVTGTCLCP PGRAGVRCER GCPQNRFGVG 1300
CEHTCSCRNG GLCHASNGSC SCGLGWTGRH CELACPPGRY GAACHLECSC 1350
HNNSTCEPAT GTCRCGPGFY GQACEHPCPP GFHGAGCQGL CWCQHGAPCD 1400
PISGRCLCPA GFHGHFCERG CEPGSFGEGC HQRCDCDGGA PCDPVTGLCL 1450
CPPGRSGATC NLDCRRGQFG PSCTLHCDCG GGADCDPVSG QCHCVDGYMG 1500
PTCREGGPLR LPENPSLAQG SAGTLPASSR PTSRSGGPAR H 1541
Length:1,541
Mass (Da):161,185
Last modified:July 28, 2009 - v4
Checksum:iEF2A7CB65140A7BB
GO
Isoform 2 (identifier: O75095-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-159: Missing.
     160-160: Y → MGASRDRGLAALWCLGLLGGLARVAGTHYRYLWRGCYPCHLGQAGYPVSAGDQRP
     989-1075: TCPAHTYGHN...GWAGLACEKE → K
     1161-1205: ACPPGSFGEDCAQMCQCPGENPACHPATGTCSCAAGYHGPSCQQR → G
     1377-1454: PCPPGFHGAG...VTGLCLCPPG → R

Note: No experimental confirmation available.

Show »
Length:1,229
Mass (Da):128,614
Checksum:iC01A97596FFC0A8F
GO

Sequence cautioni

The sequence BAE19678.1 differs from that shown. Reason: Frameshift at position 1522.
The sequence BAA32467.2 differs from that shown. Reason: Erroneous initiation.
The sequence BAE19678.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti115 – 1151M → T.
Corresponds to variant rs7513275 [ dbSNP | Ensembl ].
VAR_059258
Natural varianti131 – 1311S → G.1 Publication
Corresponds to variant rs2794340 [ dbSNP | Ensembl ].
VAR_058361
Natural varianti313 – 3131A → V.
Corresponds to variant rs11585362 [ dbSNP | Ensembl ].
VAR_059259
Natural varianti587 – 5871P → L.
Corresponds to variant rs947345 [ dbSNP | Ensembl ].
VAR_061155
Natural varianti688 – 6881L → P.
Corresponds to variant rs2821008 [ dbSNP | Ensembl ].
VAR_059260
Natural varianti916 – 9161R → L.1 Publication
Corresponds to variant rs7553399 [ dbSNP | Ensembl ].
VAR_058362
Natural varianti1137 – 11371G → A.1 Publication
Corresponds to variant rs4648506 [ dbSNP | Ensembl ].
VAR_058363
Natural varianti1287 – 12871R → H.
Corresponds to variant rs57804877 [ dbSNP | Ensembl ].
VAR_061156
Natural varianti1536 – 15361G → S.
Corresponds to variant rs57484147 [ dbSNP | Ensembl ].
VAR_061157

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 159159Missing in isoform 2.
VSP_037740Add
BLAST
Alternative sequencei160 – 1601Y → MGASRDRGLAALWCLGLLGG LARVAGTHYRYLWRGCYPCH LGQAGYPVSAGDQRP in isoform 2.
VSP_037741
Alternative sequencei989 – 107587TCPAH…ACEKE → K in isoform 2.
VSP_037742Add
BLAST
Alternative sequencei1161 – 120545ACPPG…SCQQR → G in isoform 2.
VSP_037743Add
BLAST
Alternative sequencei1377 – 145478PCPPG…LCPPG → R in isoform 2.
VSP_037744Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB011539 mRNA. Translation: BAA32467.2. Different initiation.
AB231860 mRNA. Translation: BAE19678.1. Sequence problems.
AL512413, AL513320 Genomic DNA. Translation: CAH70834.1.
AL513320, AL512413 Genomic DNA. Translation: CAI14334.1.
CCDSiCCDS41237.1. [O75095-1]
RefSeqiNP_001400.3. NM_001409.3. [O75095-1]
UniGeneiHs.593645.

Genome annotation databases

EnsembliENST00000294599; ENSP00000294599; ENSG00000162591. [O75095-2]
ENST00000356575; ENSP00000348982; ENSG00000162591. [O75095-1]
GeneIDi1953.
KEGGihsa:1953.
UCSCiuc001akk.3. human. [O75095-2]
uc001akl.3. human. [O75095-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB011539 mRNA. Translation: BAA32467.2 . Different initiation.
AB231860 mRNA. Translation: BAE19678.1 . Sequence problems.
AL512413 , AL513320 Genomic DNA. Translation: CAH70834.1 .
AL513320 , AL512413 Genomic DNA. Translation: CAI14334.1 .
CCDSi CCDS41237.1. [O75095-1 ]
RefSeqi NP_001400.3. NM_001409.3. [O75095-1 ]
UniGenei Hs.593645.

3D structure databases

ProteinModelPortali O75095.
SMRi O75095. Positions 119-473, 511-1513.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 108273. 6 interactions.
IntActi O75095. 7 interactions.
MINTi MINT-2797336.
STRINGi 9606.ENSP00000348982.

PTM databases

PhosphoSitei O75095.

Proteomic databases

PaxDbi O75095.
PRIDEi O75095.

Protocols and materials databases

DNASUi 1953.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000294599 ; ENSP00000294599 ; ENSG00000162591 . [O75095-2 ]
ENST00000356575 ; ENSP00000348982 ; ENSG00000162591 . [O75095-1 ]
GeneIDi 1953.
KEGGi hsa:1953.
UCSCi uc001akk.3. human. [O75095-2 ]
uc001akl.3. human. [O75095-1 ]

Organism-specific databases

CTDi 1953.
GeneCardsi GC01M003396.
H-InvDB HIX0000066.
HGNCi HGNC:3232. MEGF6.
HPAi HPA052129.
MIMi 604266. gene.
neXtProti NX_O75095.
PharmGKBi PA27665.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG12793.
HOGENOMi HOG000097840.
HOVERGENi HBG079790.
OMAi CRKKCHC.
OrthoDBi EOG72C50D.
PhylomeDBi O75095.
TreeFami TF332598.

Miscellaneous databases

GenomeRNAii 1953.
NextBioi 7915.
PROi O75095.
SOURCEi Search...

Gene expression databases

Bgeei O75095.
CleanExi HS_MEGF6.
Genevestigatori O75095.

Family and domain databases

InterProi IPR000742. EG-like_dom.
IPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR002049. EGF_laminin.
IPR011489. EMI_domain.
IPR009030. Growth_fac_rcpt_N_dom.
[Graphical view ]
Pfami PF07645. EGF_CA. 1 hit.
PF00053. Laminin_EGF. 5 hits.
[Graphical view ]
SMARTi SM00181. EGF. 15 hits.
SM00179. EGF_CA. 3 hits.
SM00180. EGF_Lam. 10 hits.
[Graphical view ]
SUPFAMi SSF57184. SSF57184. 4 hits.
PROSITEi PS00010. ASX_HYDROXYL. 4 hits.
PS00022. EGF_1. 23 hits.
PS01186. EGF_2. 24 hits.
PS50026. EGF_3. 23 hits.
PS01187. EGF_CA. 4 hits.
PS51041. EMI. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of high-molecular-weight proteins with multiple EGF-like motifs by motif-trap screening."
    Nakayama M., Nakajima D., Nagase T., Nomura N., Seki N., Ohara O.
    Genomics 51:27-34(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), VARIANTS GLY-131; LEU-916 AND ALA-1137.
    Tissue: Brain and Spleen.
  2. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
    Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
    DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: SEQUENCE REVISION.
  3. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

Entry informationi

Entry nameiMEGF6_HUMAN
AccessioniPrimary (citable) accession number: O75095
Secondary accession number(s): Q4AC86, Q5VV39
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 13, 2004
Last sequence update: July 28, 2009
Last modified: July 9, 2014
This is version 112 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi