Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O75095

- MEGF6_HUMAN

UniProt

O75095 - MEGF6_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Multiple epidermal growth factor-like domains protein 6

Gene

MEGF6

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  1. calcium ion binding Source: InterPro
Complete GO annotation...

Keywords - Ligandi

Calcium

Names & Taxonomyi

Protein namesi
Recommended name:
Multiple epidermal growth factor-like domains protein 6
Short name:
Multiple EGF-like domains protein 6
Alternative name(s):
Epidermal growth factor-like protein 3
Short name:
EGF-like protein 3
Gene namesi
Name:MEGF6
Synonyms:EGFL3, KIAA0815
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:3232. MEGF6.

Subcellular locationi

Secreted Curated

GO - Cellular componenti

  1. extracellular region Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA27665.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3030Sequence AnalysisAdd
BLAST
Chaini31 – 15411511Multiple epidermal growth factor-like domains protein 6PRO_0000007524Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi48 ↔ 111Sequence Analysis
Disulfide bondi77 ↔ 83Sequence Analysis
Disulfide bondi110 ↔ 123Sequence Analysis
Disulfide bondi128 ↔ 139By similarity
Disulfide bondi133 ↔ 147By similarity
Disulfide bondi149 ↔ 158By similarity
Disulfide bondi165 ↔ 176By similarity
Disulfide bondi172 ↔ 185By similarity
Disulfide bondi187 ↔ 200By similarity
Disulfide bondi242 ↔ 255By similarity
Disulfide bondi248 ↔ 268By similarity
Glycosylationi252 – 2521N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi270 ↔ 283By similarity
Disulfide bondi289 ↔ 300By similarity
Disulfide bondi296 ↔ 309By similarity
Disulfide bondi311 ↔ 324By similarity
Disulfide bondi416 ↔ 427By similarity
Disulfide bondi423 ↔ 436By similarity
Disulfide bondi438 ↔ 451By similarity
Disulfide bondi520 ↔ 533By similarity
Disulfide bondi527 ↔ 540By similarity
Disulfide bondi542 ↔ 551By similarity
Disulfide bondi564 ↔ 576By similarity
Disulfide bondi570 ↔ 583By similarity
Disulfide bondi585 ↔ 594By similarity
Disulfide bondi607 ↔ 619By similarity
Disulfide bondi613 ↔ 626By similarity
Disulfide bondi628 ↔ 637By similarity
Glycosylationi739 – 7391N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi740 ↔ 751By similarity
Disulfide bondi744 ↔ 758By similarity
Disulfide bondi760 ↔ 769By similarity
Disulfide bondi786 ↔ 795By similarity
Disulfide bondi789 ↔ 802By similarity
Disulfide bondi804 ↔ 813By similarity
Disulfide bondi826 ↔ 838By similarity
Disulfide bondi832 ↔ 845By similarity
Disulfide bondi847 ↔ 856By similarity
Disulfide bondi869 ↔ 882By similarity
Disulfide bondi873 ↔ 889By similarity
Disulfide bondi891 ↔ 900By similarity
Disulfide bondi913 ↔ 925By similarity
Disulfide bondi919 ↔ 932By similarity
Disulfide bondi934 ↔ 943By similarity
Disulfide bondi999 ↔ 1011By similarity
Disulfide bondi1005 ↔ 1018By similarity
Disulfide bondi1020 ↔ 1029By similarity
Disulfide bondi1042 ↔ 1054By similarity
Disulfide bondi1048 ↔ 1061By similarity
Disulfide bondi1063 ↔ 1072By similarity
Disulfide bondi1085 ↔ 1097By similarity
Disulfide bondi1091 ↔ 1104By similarity
Disulfide bondi1106 ↔ 1115By similarity
Disulfide bondi1128 ↔ 1140By similarity
Disulfide bondi1134 ↔ 1147By similarity
Disulfide bondi1149 ↔ 1158By similarity
Disulfide bondi1215 ↔ 1227By similarity
Disulfide bondi1221 ↔ 1234By similarity
Disulfide bondi1236 ↔ 1245By similarity
Disulfide bondi1258 ↔ 1270By similarity
Disulfide bondi1264 ↔ 1277By similarity
Disulfide bondi1279 ↔ 1288By similarity
Disulfide bondi1301 ↔ 1313By similarity
Disulfide bondi1307 ↔ 1320By similarity
Disulfide bondi1322 ↔ 1331By similarity
Disulfide bondi1348 ↔ 1356By similarity
Disulfide bondi1350 ↔ 1363By similarity
Disulfide bondi1365 ↔ 1374By similarity
Disulfide bondi1387 ↔ 1399By similarity
Disulfide bondi1393 ↔ 1406By similarity
Disulfide bondi1408 ↔ 1417By similarity
Disulfide bondi1473 ↔ 1485By similarity
Disulfide bondi1479 ↔ 1492By similarity
Disulfide bondi1494 ↔ 1503By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiO75095.
PRIDEiO75095.

PTM databases

PhosphoSiteiO75095.

Expressioni

Gene expression databases

BgeeiO75095.
CleanExiHS_MEGF6.
ExpressionAtlasiO75095. baseline and differential.
GenevestigatoriO75095.

Organism-specific databases

HPAiHPA052129.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
ATXN7O152652EBI-947597,EBI-708350
CACNA1AO005552EBI-947597,EBI-766279

Protein-protein interaction databases

BioGridi108273. 6 interactions.
IntActiO75095. 7 interactions.
MINTiMINT-2797336.
STRINGi9606.ENSP00000348982.

Structurei

3D structure databases

ProteinModelPortaliO75095.
SMRiO75095. Positions 119-473, 511-1513.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini44 – 12582EMIPROSITE-ProRule annotationAdd
BLAST
Domaini124 – 15936EGF-like 1PROSITE-ProRule annotationAdd
BLAST
Domaini161 – 20141EGF-like 2; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini206 – 24237EGF-like 3PROSITE-ProRule annotationAdd
BLAST
Domaini238 – 28447EGF-like 4PROSITE-ProRule annotationAdd
BLAST
Domaini285 – 32541EGF-like 5; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini335 – 37036EGF-like 6PROSITE-ProRule annotationAdd
BLAST
Domaini375 – 41137EGF-like 7PROSITE-ProRule annotationAdd
BLAST
Domaini412 – 45241EGF-like 8; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini516 – 55237EGF-like 9PROSITE-ProRule annotationAdd
BLAST
Domaini560 – 59536EGF-like 10PROSITE-ProRule annotationAdd
BLAST
Domaini603 – 63836EGF-like 11PROSITE-ProRule annotationAdd
BLAST
Domaini736 – 77035EGF-like 12PROSITE-ProRule annotationAdd
BLAST
Domaini783 – 81432EGF-like 13PROSITE-ProRule annotationAdd
BLAST
Domaini822 – 85736EGF-like 14PROSITE-ProRule annotationAdd
BLAST
Domaini865 – 90137EGF-like 15PROSITE-ProRule annotationAdd
BLAST
Domaini909 – 94436EGF-like 16PROSITE-ProRule annotationAdd
BLAST
Domaini955 – 98733EGF-like 17PROSITE-ProRule annotationAdd
BLAST
Domaini995 – 103036EGF-like 18PROSITE-ProRule annotationAdd
BLAST
Domaini1038 – 107336EGF-like 19PROSITE-ProRule annotationAdd
BLAST
Domaini1081 – 111636EGF-like 20PROSITE-ProRule annotationAdd
BLAST
Domaini1124 – 115936EGF-like 21PROSITE-ProRule annotationAdd
BLAST
Domaini1211 – 124636EGF-like 22PROSITE-ProRule annotationAdd
BLAST
Domaini1254 – 128936EGF-like 23PROSITE-ProRule annotationAdd
BLAST
Domaini1297 – 133236EGF-like 24PROSITE-ProRule annotationAdd
BLAST
Domaini1345 – 137531EGF-like 25PROSITE-ProRule annotationAdd
BLAST
Domaini1383 – 141836EGF-like 26PROSITE-ProRule annotationAdd
BLAST
Domaini1469 – 150436EGF-like 27PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 27 EGF-like domains.PROSITE-ProRule annotation
Contains 1 EMI domain.PROSITE-ProRule annotation

Keywords - Domaini

EGF-like domain, Repeat, Signal

Phylogenomic databases

eggNOGiNOG12793.
GeneTreeiENSGT00770000120465.
HOGENOMiHOG000097840.
HOVERGENiHBG079790.
InParanoidiO75095.
OMAiCRKKCHC.
OrthoDBiEOG72C50D.
PhylomeDBiO75095.
TreeFamiTF332598.

Family and domain databases

InterProiIPR000742. EG-like_dom.
IPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR002049. EGF_laminin.
IPR011489. EMI_domain.
IPR009030. Growth_fac_rcpt_N_dom.
[Graphical view]
PfamiPF07645. EGF_CA. 1 hit.
PF00053. Laminin_EGF. 5 hits.
[Graphical view]
SMARTiSM00181. EGF. 15 hits.
SM00179. EGF_CA. 3 hits.
SM00180. EGF_Lam. 10 hits.
[Graphical view]
SUPFAMiSSF57184. SSF57184. 4 hits.
PROSITEiPS00010. ASX_HYDROXYL. 4 hits.
PS00022. EGF_1. 23 hits.
PS01186. EGF_2. 24 hits.
PS50026. EGF_3. 23 hits.
PS01187. EGF_CA. 4 hits.
PS51041. EMI. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O75095-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSFLEEARAA GRAVVLALVL LLLPAVPVGA SVPPRPLLPL QPGMPHVCAE
60 70 80 90 100
QELTLVGRRQ PCVQALSHTV PVWKAGCGWQ AWCVGHERRT VYYMGYRQVY
110 120 130 140 150
TTEARTVLRC CRGWMQQPDE EGCLSAECSA SLCFHGGRCV PGSAQPCHCP
160 170 180 190 200
PGFQGPRCQY DVDECRTHNG GCQHRCVNTP GSYLCECKPG FRLHTDSRTC
210 220 230 240 250
LAINSCALGN GGCQHHCVQL TITRHRCQCR PGFQLQEDGR HCVRRSPCAN
260 270 280 290 300
RNGSCMHRCQ VVRGLARCEC HVGYQLAADG KACEDVDECA AGLAQCAHGC
310 320 330 340 350
LNTQGSFKCV CHAGYELGAD GRQCYRIEME IVNSCEANNG GCSHGCSHTS
360 370 380 390 400
AGPLCTCPRG YELDTDQRTC IDVDDCADSP CCQQVCTNNP GGYECGCYAG
410 420 430 440 450
YRLSADGCGC EDVDECASSR GGCEHHCTNL AGSFQCSCEA GYRLHEDRRG
460 470 480 490 500
CSPLEEPMVD LDGELPFVRP LPHIAVLQDE LPQLFQDDDV GADEEEAELR
510 520 530 540 550
GEHTLTEKFV CLDDSFGHDC SLTCDDCRNG GTCLLGLDGC DCPEGWTGLI
560 570 580 590 600
CNETCPPDTF GKNCSFSCSC QNGGTCDSVT GACRCPPGVS GTNCEDGCPK
610 620 630 640 650
GYYGKHCRKK CNCANRGRCH RLYGACLCDP GLYGRFCHLT CPPWAFGPGC
660 670 680 690 700
SEECQCVQPH TQSCDKRDGS CSCKAGFRGE RCQAECELGY FGPGCWQACT
710 720 730 740 750
CPVGVACDSV SGECGKRCPA GFQGEDCGQE CPVGTFGVNC SSSCSCGGAP
760 770 780 790 800
CHGVTGQCRC PPGRTGEDCE ADCPEGRWGL GCQEICPACQ HAARCDPETG
810 820 830 840 850
ACLCLPGFVG SRCQDVCPAG WYGPSCQTRC SCANDGHCHP ATGHCSCAPG
860 870 880 890 900
WTGFSCQRAC DTGHWGPDCS HPCNCSAGHG SCDAISGLCL CEAGYVGPRC
910 920 930 940 950
EQQCPQGHFG PGCEQRCQCQ HGAACDHVSG ACTCPAGWRG TFCEHACPAG
960 970 980 990 1000
FFGLDCRSAC NCTAGAACDA VNGSCLCPAG RRGPRCAETC PAHTYGHNCS
1010 1020 1030 1040 1050
QACACFNGAS CDPVHGQCHC APGWMGPSCL QACPAGLYGD NCRHSCLCQN
1060 1070 1080 1090 1100
GGTCDPVSGH CACPEGWAGL ACEKECLPRD VRAGCRHSGG CLNGGLCDPH
1110 1120 1130 1140 1150
TGRCLCPAGW TGDKCQSPCL RGWFGEACAQ RCSCPPGAAC HHVTGACRCP
1160 1170 1180 1190 1200
PGFTGSGCEQ ACPPGSFGED CAQMCQCPGE NPACHPATGT CSCAAGYHGP
1210 1220 1230 1240 1250
SCQQRCPPGR YGPGCEQLCG CLNGGSCDAA TGACRCPTGF LGTDCNLTCP
1260 1270 1280 1290 1300
QGRFGPNCTH VCGCGQGAAC DPVTGTCLCP PGRAGVRCER GCPQNRFGVG
1310 1320 1330 1340 1350
CEHTCSCRNG GLCHASNGSC SCGLGWTGRH CELACPPGRY GAACHLECSC
1360 1370 1380 1390 1400
HNNSTCEPAT GTCRCGPGFY GQACEHPCPP GFHGAGCQGL CWCQHGAPCD
1410 1420 1430 1440 1450
PISGRCLCPA GFHGHFCERG CEPGSFGEGC HQRCDCDGGA PCDPVTGLCL
1460 1470 1480 1490 1500
CPPGRSGATC NLDCRRGQFG PSCTLHCDCG GGADCDPVSG QCHCVDGYMG
1510 1520 1530 1540
PTCREGGPLR LPENPSLAQG SAGTLPASSR PTSRSGGPAR H
Length:1,541
Mass (Da):161,185
Last modified:July 28, 2009 - v4
Checksum:iEF2A7CB65140A7BB
GO
Isoform 2 (identifier: O75095-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-159: Missing.
     160-160: Y → MGASRDRGLAALWCLGLLGGLARVAGTHYRYLWRGCYPCHLGQAGYPVSAGDQRP
     989-1075: TCPAHTYGHN...GWAGLACEKE → K
     1161-1205: ACPPGSFGEDCAQMCQCPGENPACHPATGTCSCAAGYHGPSCQQR → G
     1377-1454: PCPPGFHGAG...VTGLCLCPPG → R

Note: No experimental confirmation available.

Show »
Length:1,229
Mass (Da):128,614
Checksum:iC01A97596FFC0A8F
GO

Sequence cautioni

The sequence BAA32467.2 differs from that shown. Reason: Erroneous initiation. Curated
The sequence BAE19678.1 differs from that shown. Reason: Frameshift at position 1522. Curated
The sequence BAE19678.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti115 – 1151M → T.
Corresponds to variant rs7513275 [ dbSNP | Ensembl ].
VAR_059258
Natural varianti131 – 1311S → G.1 Publication
Corresponds to variant rs2794340 [ dbSNP | Ensembl ].
VAR_058361
Natural varianti313 – 3131A → V.
Corresponds to variant rs11585362 [ dbSNP | Ensembl ].
VAR_059259
Natural varianti587 – 5871P → L.
Corresponds to variant rs947345 [ dbSNP | Ensembl ].
VAR_061155
Natural varianti688 – 6881L → P.
Corresponds to variant rs2821008 [ dbSNP | Ensembl ].
VAR_059260
Natural varianti916 – 9161R → L.1 Publication
Corresponds to variant rs7553399 [ dbSNP | Ensembl ].
VAR_058362
Natural varianti1137 – 11371G → A.1 Publication
Corresponds to variant rs4648506 [ dbSNP | Ensembl ].
VAR_058363
Natural varianti1287 – 12871R → H.
Corresponds to variant rs57804877 [ dbSNP | Ensembl ].
VAR_061156
Natural varianti1536 – 15361G → S.
Corresponds to variant rs57484147 [ dbSNP | Ensembl ].
VAR_061157

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 159159Missing in isoform 2. 1 PublicationVSP_037740Add
BLAST
Alternative sequencei160 – 1601Y → MGASRDRGLAALWCLGLLGG LARVAGTHYRYLWRGCYPCH LGQAGYPVSAGDQRP in isoform 2. 1 PublicationVSP_037741
Alternative sequencei989 – 107587TCPAH…ACEKE → K in isoform 2. 1 PublicationVSP_037742Add
BLAST
Alternative sequencei1161 – 120545ACPPG…SCQQR → G in isoform 2. 1 PublicationVSP_037743Add
BLAST
Alternative sequencei1377 – 145478PCPPG…LCPPG → R in isoform 2. 1 PublicationVSP_037744Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB011539 mRNA. Translation: BAA32467.2. Different initiation.
AB231860 mRNA. Translation: BAE19678.1. Sequence problems.
AL512413, AL513320 Genomic DNA. Translation: CAH70834.1.
AL513320, AL512413 Genomic DNA. Translation: CAI14334.1.
CCDSiCCDS41237.1. [O75095-1]
RefSeqiNP_001400.3. NM_001409.3. [O75095-1]
UniGeneiHs.593645.

Genome annotation databases

EnsembliENST00000294599; ENSP00000294599; ENSG00000162591. [O75095-2]
ENST00000356575; ENSP00000348982; ENSG00000162591. [O75095-1]
GeneIDi1953.
KEGGihsa:1953.
UCSCiuc001akk.3. human. [O75095-2]
uc001akl.3. human. [O75095-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB011539 mRNA. Translation: BAA32467.2 . Different initiation.
AB231860 mRNA. Translation: BAE19678.1 . Sequence problems.
AL512413 , AL513320 Genomic DNA. Translation: CAH70834.1 .
AL513320 , AL512413 Genomic DNA. Translation: CAI14334.1 .
CCDSi CCDS41237.1. [O75095-1 ]
RefSeqi NP_001400.3. NM_001409.3. [O75095-1 ]
UniGenei Hs.593645.

3D structure databases

ProteinModelPortali O75095.
SMRi O75095. Positions 119-473, 511-1513.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 108273. 6 interactions.
IntActi O75095. 7 interactions.
MINTi MINT-2797336.
STRINGi 9606.ENSP00000348982.

PTM databases

PhosphoSitei O75095.

Proteomic databases

PaxDbi O75095.
PRIDEi O75095.

Protocols and materials databases

DNASUi 1953.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000294599 ; ENSP00000294599 ; ENSG00000162591 . [O75095-2 ]
ENST00000356575 ; ENSP00000348982 ; ENSG00000162591 . [O75095-1 ]
GeneIDi 1953.
KEGGi hsa:1953.
UCSCi uc001akk.3. human. [O75095-2 ]
uc001akl.3. human. [O75095-1 ]

Organism-specific databases

CTDi 1953.
GeneCardsi GC01M003396.
H-InvDB HIX0000066.
HGNCi HGNC:3232. MEGF6.
HPAi HPA052129.
MIMi 604266. gene.
neXtProti NX_O75095.
PharmGKBi PA27665.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG12793.
GeneTreei ENSGT00770000120465.
HOGENOMi HOG000097840.
HOVERGENi HBG079790.
InParanoidi O75095.
OMAi CRKKCHC.
OrthoDBi EOG72C50D.
PhylomeDBi O75095.
TreeFami TF332598.

Miscellaneous databases

ChiTaRSi MEGF6. human.
GenomeRNAii 1953.
NextBioi 7915.
PROi O75095.
SOURCEi Search...

Gene expression databases

Bgeei O75095.
CleanExi HS_MEGF6.
ExpressionAtlasi O75095. baseline and differential.
Genevestigatori O75095.

Family and domain databases

InterProi IPR000742. EG-like_dom.
IPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR002049. EGF_laminin.
IPR011489. EMI_domain.
IPR009030. Growth_fac_rcpt_N_dom.
[Graphical view ]
Pfami PF07645. EGF_CA. 1 hit.
PF00053. Laminin_EGF. 5 hits.
[Graphical view ]
SMARTi SM00181. EGF. 15 hits.
SM00179. EGF_CA. 3 hits.
SM00180. EGF_Lam. 10 hits.
[Graphical view ]
SUPFAMi SSF57184. SSF57184. 4 hits.
PROSITEi PS00010. ASX_HYDROXYL. 4 hits.
PS00022. EGF_1. 23 hits.
PS01186. EGF_2. 24 hits.
PS50026. EGF_3. 23 hits.
PS01187. EGF_CA. 4 hits.
PS51041. EMI. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of high-molecular-weight proteins with multiple EGF-like motifs by motif-trap screening."
    Nakayama M., Nakajima D., Nagase T., Nomura N., Seki N., Ohara O.
    Genomics 51:27-34(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), VARIANTS GLY-131; LEU-916 AND ALA-1137.
    Tissue: Brain and Spleen.
  2. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
    Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
    DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: SEQUENCE REVISION.
  3. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

Entry informationi

Entry nameiMEGF6_HUMAN
AccessioniPrimary (citable) accession number: O75095
Secondary accession number(s): Q4AC86, Q5VV39
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 13, 2004
Last sequence update: July 28, 2009
Last modified: November 26, 2014
This is version 115 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3