SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O75077

- ADA23_HUMAN

UniProt

O75077 - ADA23_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Disintegrin and metalloproteinase domain-containing protein 23
Gene
ADAM23, MDC3
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

May play a role in cell-cell and cell-matrix interactions. This is a non-catalytic metalloprotease-like protein.

GO - Molecular functioni

  1. integrin binding Source: ProtInc
  2. metalloendopeptidase activity Source: InterPro
  3. metallopeptidase activity Source: ProtInc
  4. protein binding Source: DFLAT
  5. zinc ion binding Source: InterPro
Complete GO annotation...

GO - Biological processi

  1. cell adhesion Source: UniProtKB-KW
  2. central nervous system development Source: ProtInc
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Protein family/group databases

MEROPSiM12.979.

Names & Taxonomyi

Protein namesi
Recommended name:
Disintegrin and metalloproteinase domain-containing protein 23
Short name:
ADAM 23
Alternative name(s):
Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3
Short name:
MDC-3
Gene namesi
Name:ADAM23
Synonyms:MDC3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:202. ADAM23.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini287 – 792506Extracellular Reviewed prediction
Add
BLAST
Transmembranei793 – 81321Helical; Reviewed prediction
Add
BLAST
Topological domaini814 – 83219Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. extracellular region Source: UniProtKB-SubCell
  2. integral component of plasma membrane Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi566 – 5661E → A: Significantly lower of adhesion-promoting activity. 1 Publication

Organism-specific databases

PharmGKBiPA24519.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 5959 Reviewed prediction
Add
BLAST
Propeptidei60 – 286227 Reviewed prediction
PRO_0000029118Add
BLAST
Chaini287 – 832546Disintegrin and metalloproteinase domain-containing protein 23
PRO_0000029119Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi76 – 761N-linked (GlcNAc...) Reviewed prediction
Glycosylationi96 – 961N-linked (GlcNAc...) Reviewed prediction
Glycosylationi100 – 1001N-linked (GlcNAc...) Reviewed prediction
Glycosylationi263 – 2631N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi408 ↔ 491 By similarity
Disulfide bondi450 ↔ 475 By similarity
Disulfide bondi452 ↔ 459 By similarity
Glycosylationi547 – 5471N-linked (GlcNAc...) Reviewed prediction
Glycosylationi548 – 5481N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi560 ↔ 580 By similarity
Glycosylationi664 – 6641N-linked (GlcNAc...) Reviewed prediction
Glycosylationi732 – 7321N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi736 ↔ 751 By similarity
Disulfide bondi745 ↔ 757 By similarity
Disulfide bondi759 ↔ 768 By similarity

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiO75077.
PRIDEiO75077.

PTM databases

PhosphoSiteiO75077.

Expressioni

Tissue specificityi

Highly expressed in the brain and weakly expressed in the heart. In the brain, expressed prominently in the amygdala, caudate nucleus, hypothalamus, thalamus, cerebral cortex and occipital pole.1 Publication

Developmental stagei

Highly expressed in the fetal brain.

Gene expression databases

ArrayExpressiO75077.
BgeeiO75077.
CleanExiHS_ADAM23.
GenevestigatoriO75077.

Organism-specific databases

HPAiCAB033276.
HPA012130.

Interactioni

Subunit structurei

Can bind to LGI1 and LGI4 By similarity. Ligand for integrin alpha-V/beta-3.

Protein-protein interaction databases

BioGridi114282. 1 interaction.
IntActiO75077. 1 interaction.
MINTiMINT-257697.
STRINGi9606.ENSP00000264377.

Structurei

3D structure databases

ProteinModelPortaliO75077.
SMRiO75077. Positions 296-773.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini299 – 496198Peptidase M12B
Add
BLAST
Domaini502 – 58887Disintegrin
Add
BLAST
Domaini732 – 76938EGF-like
Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni563 – 5686May bind the integrin receptor

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi589 – 61123Cys-rich
Add
BLAST

Domaini

A conserved motif AVN[ED]CD within the disintegrin-like domain could be involved in the binding to the integrin receptor.

Sequence similaritiesi

Contains 1 disintegrin domain.
Contains 1 EGF-like domain.

Keywords - Domaini

EGF-like domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG256419.
HOGENOMiHOG000231962.
HOVERGENiHBG050456.
KOiK06837.
OMAiHGMFEDN.
OrthoDBiEOG7B31M6.
PhylomeDBiO75077.
TreeFamiTF314733.

Family and domain databases

Gene3Di3.40.390.10. 1 hit.
4.10.70.10. 1 hit.
InterProiIPR006586. ADAM_Cys-rich.
IPR001762. Blood-coag_inhib_Disintegrin.
IPR000742. EG-like_dom.
IPR013032. EGF-like_CS.
IPR024079. MetalloPept_cat_dom.
IPR001590. Peptidase_M12B.
IPR002870. Peptidase_M12B_N.
[Graphical view]
PfamiPF08516. ADAM_CR. 1 hit.
PF00200. Disintegrin. 1 hit.
PF01562. Pep_M12B_propep. 1 hit.
PF01421. Reprolysin. 1 hit.
[Graphical view]
SMARTiSM00608. ACR. 1 hit.
SM00050. DISIN. 1 hit.
SM00181. EGF. 1 hit.
[Graphical view]
SUPFAMiSSF57552. SSF57552. 1 hit.
PROSITEiPS50215. ADAM_MEPRO. 1 hit.
PS50214. DISINTEGRIN_2. 1 hit.
PS00022. EGF_1. 1 hit.
PS50026. EGF_3. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform Alpha (identifier: O75077-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MKPPGSSSRQ PPLAGCSLAG ASCGPQRGPA GSVPASAPAR TPPCRLLLVL    50
LLLPPLAASS RPRAWGAAAP SAPHWNETAE KNLGVLADED NTLQQNSSSN 100
ISYSNAMQKE ITLPSRLIYY INQDSESPYH VLDTKARHQQ KHNKAVHLAQ 150
ASFQIEAFGS KFILDLILNN GLLSSDYVEI HYENGKPQYS KGGEHCYYHG 200
SIRGVKDSKV ALSTCNGLHG MFEDDTFVYM IEPLELVHDE KSTGRPHIIQ 250
KTLAGQYSKQ MKNLTMERGD QWPFLSELQW LKRRKRAVNP SRGIFEEMKY 300
LELMIVNDHK TYKKHRSSHA HTNNFAKSVV NLVDSIYKEQ LNTRVVLVAV 350
ETWTEKDQID ITTNPVQMLH EFSKYRQRIK QHADAVHLIS RVTFHYKRSS 400
LSYFGGVCSR TRGVGVNEYG LPMAVAQVLS QSLAQNLGIQ WEPSSRKPKC 450
DCTESWGGCI MEETGVSHSR KFSKCSILEY RDFLQRGGGA CLFNRPTKLF 500
EPTECGNGYV EAGEECDCGF HVECYGLCCK KCSLSNGAHC SDGPCCNNTS 550
CLFQPRGYEC RDAVNECDIT EYCTGDSGQC PPNLHKQDGY ACNQNQGRCY 600
NGECKTRDNQ CQYIWGTKAA GSDKFCYEKL NTEGTEKGNC GKDGDRWIQC 650
SKHDVFCGFL LCTNLTRAPR IGQLQGEIIP TSFYHQGRVI DCSGAHVVLD 700
DDTDVGYVED GTPCGPSMMC LDRKCLQIQA LNMSSCPLDS KGKVCSGHGV 750
CSNEATCICD FTWAGTDCSI RDPVRNLHPP KDEGPKGPSA TNLIIGSIAG 800
AILVAAIVLG GTGWGFKNVK KRRFDPTQQG PI 832
Length:832
Mass (Da):91,926
Last modified:November 1, 1998 - v1
Checksum:i7841A9670E1C24EF
GO
Isoform Beta (identifier: O75077-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     787-817: GPSATNLIIGSIAGAILVAAIVLGGTGWGFK → VNMATSRLIGAVAGTLLALGVIFGGTGWGIE

Show »
Length:832
Mass (Da):92,046
Checksum:iE388ACE51334052C
GO
Isoform Gamma (identifier: O75077-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     787-832: GPSATNLIIG...RFDPTQQGPI → EMSRREGSIL...AAVLLELLSL

Show »
Length:832
Mass (Da):92,130
Checksum:i7F54A1805FA2EC58
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei787 – 83246GPSAT…QQGPI → EMSRREGSILLSKAPSESAA LDGHRLALLDSGYDILAAVL LELLSL in isoform Gamma.
VSP_012045Add
BLAST
Alternative sequencei787 – 81731GPSAT…GWGFK → VNMATSRLIGAVAGTLLALG VIFGGTGWGIE in isoform Beta.
VSP_012046Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB009672 mRNA. Translation: BAA32351.1.
AJ005580 mRNA. Translation: CAC20565.1.
CH471063 Genomic DNA. Translation: EAW70386.1.
BC132763 mRNA. Translation: AAI32764.1.
BC132765 mRNA. Translation: AAI32766.1.
CCDSiCCDS2369.1. [O75077-1]
RefSeqiNP_003803.1. NM_003812.3. [O75077-1]
XP_005246989.1. XM_005246932.2. [O75077-3]
UniGeneiHs.370287.
Hs.591643.

Genome annotation databases

EnsembliENST00000264377; ENSP00000264377; ENSG00000114948. [O75077-1]
ENST00000374416; ENSP00000363537; ENSG00000114948. [O75077-3]
GeneIDi8745.
KEGGihsa:8745.
UCSCiuc002vbq.4. human. [O75077-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB009672 mRNA. Translation: BAA32351.1 .
AJ005580 mRNA. Translation: CAC20565.1 .
CH471063 Genomic DNA. Translation: EAW70386.1 .
BC132763 mRNA. Translation: AAI32764.1 .
BC132765 mRNA. Translation: AAI32766.1 .
CCDSi CCDS2369.1. [O75077-1 ]
RefSeqi NP_003803.1. NM_003812.3. [O75077-1 ]
XP_005246989.1. XM_005246932.2. [O75077-3 ]
UniGenei Hs.370287.
Hs.591643.

3D structure databases

ProteinModelPortali O75077.
SMRi O75077. Positions 296-773.
ModBasei Search...

Protein-protein interaction databases

BioGridi 114282. 1 interaction.
IntActi O75077. 1 interaction.
MINTi MINT-257697.
STRINGi 9606.ENSP00000264377.

Protein family/group databases

MEROPSi M12.979.

PTM databases

PhosphoSitei O75077.

Proteomic databases

PaxDbi O75077.
PRIDEi O75077.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000264377 ; ENSP00000264377 ; ENSG00000114948 . [O75077-1 ]
ENST00000374416 ; ENSP00000363537 ; ENSG00000114948 . [O75077-3 ]
GeneIDi 8745.
KEGGi hsa:8745.
UCSCi uc002vbq.4. human. [O75077-1 ]

Organism-specific databases

CTDi 8745.
GeneCardsi GC02P207272.
HGNCi HGNC:202. ADAM23.
HPAi CAB033276.
HPA012130.
MIMi 603710. gene.
neXtProti NX_O75077.
PharmGKBi PA24519.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG256419.
HOGENOMi HOG000231962.
HOVERGENi HBG050456.
KOi K06837.
OMAi HGMFEDN.
OrthoDBi EOG7B31M6.
PhylomeDBi O75077.
TreeFami TF314733.

Miscellaneous databases

GeneWikii ADAM23.
GenomeRNAii 8745.
NextBioi 32813.
PROi O75077.
SOURCEi Search...

Gene expression databases

ArrayExpressi O75077.
Bgeei O75077.
CleanExi HS_ADAM23.
Genevestigatori O75077.

Family and domain databases

Gene3Di 3.40.390.10. 1 hit.
4.10.70.10. 1 hit.
InterProi IPR006586. ADAM_Cys-rich.
IPR001762. Blood-coag_inhib_Disintegrin.
IPR000742. EG-like_dom.
IPR013032. EGF-like_CS.
IPR024079. MetalloPept_cat_dom.
IPR001590. Peptidase_M12B.
IPR002870. Peptidase_M12B_N.
[Graphical view ]
Pfami PF08516. ADAM_CR. 1 hit.
PF00200. Disintegrin. 1 hit.
PF01562. Pep_M12B_propep. 1 hit.
PF01421. Reprolysin. 1 hit.
[Graphical view ]
SMARTi SM00608. ACR. 1 hit.
SM00050. DISIN. 1 hit.
SM00181. EGF. 1 hit.
[Graphical view ]
SUPFAMi SSF57552. SSF57552. 1 hit.
PROSITEi PS50215. ADAM_MEPRO. 1 hit.
PS50214. DISINTEGRIN_2. 1 hit.
PS00022. EGF_1. 1 hit.
PS50026. EGF_3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Metalloproteinase-like, disintegrin-like, cysteine-rich proteins MDC2 and MDC3: novel human cellular disintegrins highly expressed in the brain."
    Sagane K., Ohya Y., Hasegawa Y., Tanaka I.
    Biochem. J. 334:93-98(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA).
    Tissue: Brain.
  2. "ADAM 23/MDC3, a human disintegrin that promotes cell adhesion via interaction with the alpha v beta 3 integrin through an RGD-independent mechanism."
    Cal S., Freije J.M.P., Lopez J.M., Takada Y., Lopez-Otin C.
    Mol. Biol. Cell 11:1457-1469(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA), INTERACTION WITH INTEGRIN ALPHA-V/BETA-3, MUTAGENESIS OF GLU-566.
    Tissue: Brain.
  3. "Two novel isoforms of Adam23 expressed in the developmental process of mouse and human brains."
    Sun Y.P., Deng K.J., Wang F., Zhang J., Huang X., Qiao S., Zhao S.
    Gene 325:171-178(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA; BETA AND GAMMA), TISSUE SPECIFICITY.
    Tissue: Fetal brain.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM ALPHA).
    Tissue: Brain.

Entry informationi

Entry nameiADA23_HUMAN
AccessioniPrimary (citable) accession number: O75077
Secondary accession number(s): A2RU59
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 7, 2004
Last sequence update: November 1, 1998
Last modified: July 9, 2014
This is version 112 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Peptidase families
    Classification of peptidase families and list of entries
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi