Reviewed,
UniProtKB/Swiss-Prot O75077 (ADA23_HUMAN)
Last modified
June 16, 2009.
Version 66.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Disintegrin and metalloproteinase domain-containing protein 23 Short name=ADAM 23 Alternative name(s): Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3 Short name=MDC-3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 832 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | May play a role in cell-cell and cell-matrix interactions. This is a non-catalytic metalloprotease-like protein. |
| Subunit structure | Ligand for integrin alpha-V/beta-3. |
| Subcellular location | Cell membrane; Single-pass type I membrane protein Potential. Isoform Gamma: Secreted. |
| Tissue specificity | Highly expressed in the brain and weakly expressed in the heart. In the brain, expressed prominently in the amygdala, caudate nucleus, hypothalamus, thalamus, cerebral cortex and occipital pole. Ref.3 |
| Developmental stage | Highly expressed in the fetal brain. |
| Domain | A conserved motif AVN[ED]CD within the disintegrin-like domain could be involved in the binding to the integrin receptor. |
| Sequence similarities | Contains 1 disintegrin domain. Contains 1 EGF-like domain. Contains 1 peptidase M12B domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell adhesion |
| Cellular component | Cell membrane Membrane Secreted |
| Coding sequence diversity | Alternative splicing |
| Domain | EGF-like domain Signal Transmembrane |
| PTM | Cleavage on pair of basic residues Disulfide bond Glycoprotein Phosphoprotein |
| Gene Ontology (GO) | |
| Biological process | cell adhesion Inferred from electronic annotation. Source: UniProtKB-KW central nervous system development Ref.1Traceable author statement. Source: ProtInc proteolysisInferred from electronic annotation. Source: InterPro |
| Cellular component | extracellular region Inferred from electronic annotation. Source: UniProtKB-KW integral to plasma membrane Ref.1Traceable author statement. Source: ProtInc |
| Molecular function | integrin binding Ref.1 Traceable author statement. Source: ProtInc metalloendopeptidase activityInferred from electronic annotation. Source: InterPro zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Alpha (identifier: O75077-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Beta (identifier: O75077-2) The sequence of this isoform differs from the canonical sequence as follows: 787-817: GPSATNLIIGSIAGAILVAAIVLGGTGWGFK → VNMATSRLIGAVAGTLLALGVIFGGTGWGIE | ||||||
| Isoform Gamma (identifier: O75077-3) The sequence of this isoform differs from the canonical sequence as follows: 787-832: GPSATNLIIG...RFDPTQQGPI → EMSRREGSIL...AAVLLELLSL |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 59 | 59 | Potential | ||||||||
| Propeptide | 60 – 286 | 227 | Potential | PRO_0000029118 | |||||||
| Chain | 287 – 832 | 546 | Disintegrin and metalloproteinase domain-containing protein 23 | PRO_0000029119 | |||||||
Regions | |||||||||||
| Topological domain | 287 – 792 | 506 | Extracellular Potential | ||||||||
| Transmembrane | 793 – 813 | 21 | Potential | ||||||||
| Topological domain | 814 – 832 | 19 | Cytoplasmic Potential | ||||||||
| Domain | 299 – 496 | 198 | Peptidase M12B | ||||||||
| Domain | 502 – 588 | 87 | Disintegrin | ||||||||
| Domain | 732 – 769 | 38 | EGF-like | ||||||||
| Region | 563 – 568 | 6 | May bind the integrin receptor | ||||||||
| Compositional bias | 589 – 611 | 23 | Cys-rich | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 707 | 1 | Phosphotyrosine Ref.4 | ||||||||
| Glycosylation | 76 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 96 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 100 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 263 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 547 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 548 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 664 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 732 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 408 ↔ 491 | By similarity | |||||||||
| Disulfide bond | 450 ↔ 475 | By similarity | |||||||||
| Disulfide bond | 452 ↔ 459 | By similarity | |||||||||
| Disulfide bond | 560 ↔ 580 | By similarity | |||||||||
| Disulfide bond | 736 ↔ 751 | By similarity | |||||||||
| Disulfide bond | 745 ↔ 757 | By similarity | |||||||||
| Disulfide bond | 759 ↔ 768 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 787 – 832 | 46 | GPSAT…QQGPI → EMSRREGSILLSKAPSESAA LDGHRLALLDSGYDILAAVL LELLSL in isoform Gamma. | VSP_012045 | |||||||
| Alternative sequence | 787 – 817 | 31 | GPSAT…GWGFK → VNMATSRLIGAVAGTLLALG VIFGGTGWGIE in isoform Beta. | VSP_012046 | |||||||
Experimental info | |||||||||||
| Mutagenesis | 566 | 1 | E → A: Significantly lower of adhesion-promoting activity. Ref.2 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Metalloproteinase-like, disintegrin-like, cysteine-rich proteins MDC2 and MDC3: novel human cellular disintegrins highly expressed in the brain." Sagane K., Ohya Y., Hasegawa Y., Tanaka I. Biochem. J. 334:93-98(1998) [PubMed: 9693107] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA). Tissue: Brain. |
| [2] | "ADAM 23/MDC3, a human disintegrin that promotes cell adhesion via interaction with the alpha v beta 3 integrin through an RGD-independent mechanism." Cal S., Freije J.M.P., Lopez J.M., Takada Y., Lopez-Otin C. Mol. Biol. Cell 11:1457-1469(2000) [PubMed: 10749942] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA), INTERACTION WITH INTEGRIN ALPHA-V/BETA-3, MUTAGENESIS OF GLU-566. Tissue: Brain. |
| [3] | "Two novel isoforms of Adam23 expressed in the developmental process of mouse and human brains." Sun Y.P., Deng K.J., Wang F., Zhang J., Huang X., Qiao S., Zhao S. Gene 325:171-178(2004) [PubMed: 14697522] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA; BETA AND GAMMA), TISSUE SPECIFICITY. Tissue: Fetal brain. |
| [4] | "Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry." Tao W.A., Wollscheid B., O'Brien R., Eng J.K., Li X.-J., Bodenmiller B., Watts J.D., Hood L., Aebersold R. Nat. Methods 2:591-598(2005) [PubMed: 16094384] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-707, MASS SPECTROMETRY. Tissue: T-cell. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AB009672 mRNA. Translation: BAA32351.1. AJ005580 mRNA. Translation: CAC20565.1. | |
| IPI | IPI00021903. IPI00477723. IPI00478084. |
| RefSeq | NP_003803.1. |
| UniGene | Hs.591643 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1FVL based on UniProtKB P18619. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | O75077. |
Proteomic databases | |
| PRIDE | O75077. |
Genome annotation databases | |
| Ensembl | ENSG00000114948. Homo sapiens. [Contig view] |
| GeneID | 8745. |
| KEGG | hsa:8745. |
Organism-specific databases | |
| GeneCards | GC02P207018. |
| H-InvDB | HIX0002773. HIX0030166. |
| HGNC | HGNC:202. ADAM23. |
| MIM | 603710. gene. |
| PharmGKB | PA24519. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | O75077. |
| HOVERGEN | O75077. |
| OMA | O75077. NTSCLFQ. |
Gene expression databases | |
| ArrayExpress | O75077. |
| Bgee | O75077. |
| CleanEx | HS_ADAM23. |
| GermOnline | ENSG00000114948. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR006586. ADAM_Cys-rich. IPR001762. Blood-coag_inhib_Disintegrin. IPR018358. Disintegrin_CS. IPR006210. EGF-like. IPR013032. EGF-like_reg_CS. IPR000742. EGF_3. IPR013111. EGF_extracell. IPR001590. Peptidase_M12B. IPR002870. Peptidase_M12B_N. [Graphical view] |
| Gene3D | G3DSA:4.10.70.10. Blood-coag_inhib_Disintegrin. 1 hit. |
| Pfam | PF08516. ADAM_CR. 1 hit. PF00200. Disintegrin. 1 hit. PF07974. EGF_2. 1 hit. PF01562. Pep_M12B_propep. 1 hit. PF01421. Reprolysin. 1 hit. [Graphical view] |
| ProDom | PD000664. Disintegrin. 1 hit. [Graphical view] [Entries sharing at least one domain] |
| SMART | SM00608. ACR. 1 hit. SM00050. DISIN. 1 hit. SM00181. EGF. 1 hit. [Graphical view] |
| PROSITE | PS50215. ADAM_MEPRO. 1 hit. PS00427. DISINTEGRIN_1. False negative. PS50214. DISINTEGRIN_2. 1 hit. PS00022. EGF_1. 1 hit. PS01186. EGF_2. False negative. PS50026. EGF_3. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 32813. |
| SOURCE | Search... |
Entry information
| Entry name | ADA23_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O75077 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| Peptidase families Classification of peptidase families and list of entries |
| SIMILARITY comments Index of protein domains and families |

Clusters with


