Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O75077

- ADA23_HUMAN

UniProt

O75077 - ADA23_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Disintegrin and metalloproteinase domain-containing protein 23

Gene

ADAM23

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

May play a role in cell-cell and cell-matrix interactions. This is a non-catalytic metalloprotease-like protein.

GO - Molecular functioni

  1. integrin binding Source: ProtInc
  2. metalloendopeptidase activity Source: InterPro
  3. metallopeptidase activity Source: ProtInc
  4. zinc ion binding Source: InterPro

GO - Biological processi

  1. cell adhesion Source: UniProtKB-KW
  2. central nervous system development Source: ProtInc
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Protein family/group databases

MEROPSiM12.979.

Names & Taxonomyi

Protein namesi
Recommended name:
Disintegrin and metalloproteinase domain-containing protein 23
Short name:
ADAM 23
Alternative name(s):
Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3
Short name:
MDC-3
Gene namesi
Name:ADAM23
Synonyms:MDC3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:202. ADAM23.

Subcellular locationi

GO - Cellular componenti

  1. extracellular region Source: UniProtKB-KW
  2. integral component of plasma membrane Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi566 – 5661E → A: Significantly lower of adhesion-promoting activity. 1 Publication

Organism-specific databases

PharmGKBiPA24519.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 5959Sequence AnalysisAdd
BLAST
Propeptidei60 – 286227Sequence AnalysisPRO_0000029118Add
BLAST
Chaini287 – 832546Disintegrin and metalloproteinase domain-containing protein 23PRO_0000029119Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi76 – 761N-linked (GlcNAc...)Sequence Analysis
Glycosylationi96 – 961N-linked (GlcNAc...)Sequence Analysis
Glycosylationi100 – 1001N-linked (GlcNAc...)Sequence Analysis
Glycosylationi263 – 2631N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi408 ↔ 491By similarity
Disulfide bondi450 ↔ 475By similarity
Disulfide bondi452 ↔ 459By similarity
Glycosylationi547 – 5471N-linked (GlcNAc...)Sequence Analysis
Glycosylationi548 – 5481N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi560 ↔ 580By similarity
Glycosylationi664 – 6641N-linked (GlcNAc...)Sequence Analysis
Glycosylationi732 – 7321N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi736 ↔ 751By similarity
Disulfide bondi745 ↔ 757By similarity
Disulfide bondi759 ↔ 768By similarity

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiO75077.
PRIDEiO75077.

PTM databases

PhosphoSiteiO75077.

Expressioni

Tissue specificityi

Highly expressed in the brain and weakly expressed in the heart. In the brain, expressed prominently in the amygdala, caudate nucleus, hypothalamus, thalamus, cerebral cortex and occipital pole.1 Publication

Developmental stagei

Highly expressed in the fetal brain.

Gene expression databases

BgeeiO75077.
CleanExiHS_ADAM23.
ExpressionAtlasiO75077. baseline and differential.
GenevestigatoriO75077.

Organism-specific databases

HPAiCAB033276.
HPA012130.

Interactioni

Subunit structurei

Can bind to LGI1 and LGI4 By similarity. Ligand for integrin alpha-V/beta-3.By similarity

Protein-protein interaction databases

BioGridi114282. 1 interaction.
IntActiO75077. 1 interaction.
MINTiMINT-257697.
STRINGi9606.ENSP00000264377.

Structurei

3D structure databases

ProteinModelPortaliO75077.
SMRiO75077. Positions 296-773.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini287 – 792506ExtracellularSequence AnalysisAdd
BLAST
Topological domaini814 – 83219CytoplasmicSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei793 – 81321HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini299 – 496198Peptidase M12BPROSITE-ProRule annotationAdd
BLAST
Domaini502 – 58887DisintegrinPROSITE-ProRule annotationAdd
BLAST
Domaini732 – 76938EGF-likePROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni563 – 5686May bind the integrin receptor

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi589 – 61123Cys-richAdd
BLAST

Domaini

A conserved motif AVN[ED]CD within the disintegrin-like domain could be involved in the binding to the integrin receptor.

Sequence similaritiesi

Contains 1 disintegrin domain.PROSITE-ProRule annotation
Contains 1 EGF-like domain.PROSITE-ProRule annotation
Contains 1 peptidase M12B domain.PROSITE-ProRule annotation

Keywords - Domaini

EGF-like domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG256419.
GeneTreeiENSGT00760000119181.
HOGENOMiHOG000231962.
HOVERGENiHBG050456.
InParanoidiO75077.
KOiK06837.
OMAiHGMFEDN.
OrthoDBiEOG7B31M6.
PhylomeDBiO75077.
TreeFamiTF314733.

Family and domain databases

Gene3Di3.40.390.10. 1 hit.
4.10.70.10. 1 hit.
InterProiIPR006586. ADAM_Cys-rich.
IPR001762. Blood-coag_inhib_Disintegrin.
IPR000742. EG-like_dom.
IPR013032. EGF-like_CS.
IPR024079. MetalloPept_cat_dom.
IPR001590. Peptidase_M12B.
IPR002870. Peptidase_M12B_N.
[Graphical view]
PfamiPF08516. ADAM_CR. 1 hit.
PF00200. Disintegrin. 1 hit.
PF01562. Pep_M12B_propep. 1 hit.
PF01421. Reprolysin. 1 hit.
[Graphical view]
SMARTiSM00608. ACR. 1 hit.
SM00050. DISIN. 1 hit.
SM00181. EGF. 1 hit.
[Graphical view]
SUPFAMiSSF57552. SSF57552. 1 hit.
PROSITEiPS50215. ADAM_MEPRO. 1 hit.
PS50214. DISINTEGRIN_2. 1 hit.
PS00022. EGF_1. 1 hit.
PS50026. EGF_3. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform Alpha (identifier: O75077-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKPPGSSSRQ PPLAGCSLAG ASCGPQRGPA GSVPASAPAR TPPCRLLLVL
60 70 80 90 100
LLLPPLAASS RPRAWGAAAP SAPHWNETAE KNLGVLADED NTLQQNSSSN
110 120 130 140 150
ISYSNAMQKE ITLPSRLIYY INQDSESPYH VLDTKARHQQ KHNKAVHLAQ
160 170 180 190 200
ASFQIEAFGS KFILDLILNN GLLSSDYVEI HYENGKPQYS KGGEHCYYHG
210 220 230 240 250
SIRGVKDSKV ALSTCNGLHG MFEDDTFVYM IEPLELVHDE KSTGRPHIIQ
260 270 280 290 300
KTLAGQYSKQ MKNLTMERGD QWPFLSELQW LKRRKRAVNP SRGIFEEMKY
310 320 330 340 350
LELMIVNDHK TYKKHRSSHA HTNNFAKSVV NLVDSIYKEQ LNTRVVLVAV
360 370 380 390 400
ETWTEKDQID ITTNPVQMLH EFSKYRQRIK QHADAVHLIS RVTFHYKRSS
410 420 430 440 450
LSYFGGVCSR TRGVGVNEYG LPMAVAQVLS QSLAQNLGIQ WEPSSRKPKC
460 470 480 490 500
DCTESWGGCI MEETGVSHSR KFSKCSILEY RDFLQRGGGA CLFNRPTKLF
510 520 530 540 550
EPTECGNGYV EAGEECDCGF HVECYGLCCK KCSLSNGAHC SDGPCCNNTS
560 570 580 590 600
CLFQPRGYEC RDAVNECDIT EYCTGDSGQC PPNLHKQDGY ACNQNQGRCY
610 620 630 640 650
NGECKTRDNQ CQYIWGTKAA GSDKFCYEKL NTEGTEKGNC GKDGDRWIQC
660 670 680 690 700
SKHDVFCGFL LCTNLTRAPR IGQLQGEIIP TSFYHQGRVI DCSGAHVVLD
710 720 730 740 750
DDTDVGYVED GTPCGPSMMC LDRKCLQIQA LNMSSCPLDS KGKVCSGHGV
760 770 780 790 800
CSNEATCICD FTWAGTDCSI RDPVRNLHPP KDEGPKGPSA TNLIIGSIAG
810 820 830
AILVAAIVLG GTGWGFKNVK KRRFDPTQQG PI
Length:832
Mass (Da):91,926
Last modified:November 1, 1998 - v1
Checksum:i7841A9670E1C24EF
GO
Isoform Beta (identifier: O75077-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     787-817: GPSATNLIIGSIAGAILVAAIVLGGTGWGFK → VNMATSRLIGAVAGTLLALGVIFGGTGWGIE

Show »
Length:832
Mass (Da):92,046
Checksum:iE388ACE51334052C
GO
Isoform Gamma (identifier: O75077-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     787-832: GPSATNLIIG...RFDPTQQGPI → EMSRREGSIL...AAVLLELLSL

Show »
Length:832
Mass (Da):92,130
Checksum:i7F54A1805FA2EC58
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei787 – 83246GPSAT…QQGPI → EMSRREGSILLSKAPSESAA LDGHRLALLDSGYDILAAVL LELLSL in isoform Gamma. 1 PublicationVSP_012045Add
BLAST
Alternative sequencei787 – 81731GPSAT…GWGFK → VNMATSRLIGAVAGTLLALG VIFGGTGWGIE in isoform Beta. 1 PublicationVSP_012046Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB009672 mRNA. Translation: BAA32351.1.
AJ005580 mRNA. Translation: CAC20565.1.
CH471063 Genomic DNA. Translation: EAW70386.1.
BC132763 mRNA. Translation: AAI32764.1.
BC132765 mRNA. Translation: AAI32766.1.
CCDSiCCDS2369.1. [O75077-1]
RefSeqiNP_003803.1. NM_003812.3. [O75077-1]
XP_005246989.1. XM_005246932.2. [O75077-3]
UniGeneiHs.370287.
Hs.591643.

Genome annotation databases

EnsembliENST00000264377; ENSP00000264377; ENSG00000114948. [O75077-1]
GeneIDi8745.
KEGGihsa:8745.
UCSCiuc002vbq.4. human. [O75077-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB009672 mRNA. Translation: BAA32351.1 .
AJ005580 mRNA. Translation: CAC20565.1 .
CH471063 Genomic DNA. Translation: EAW70386.1 .
BC132763 mRNA. Translation: AAI32764.1 .
BC132765 mRNA. Translation: AAI32766.1 .
CCDSi CCDS2369.1. [O75077-1 ]
RefSeqi NP_003803.1. NM_003812.3. [O75077-1 ]
XP_005246989.1. XM_005246932.2. [O75077-3 ]
UniGenei Hs.370287.
Hs.591643.

3D structure databases

ProteinModelPortali O75077.
SMRi O75077. Positions 296-773.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 114282. 1 interaction.
IntActi O75077. 1 interaction.
MINTi MINT-257697.
STRINGi 9606.ENSP00000264377.

Protein family/group databases

MEROPSi M12.979.

PTM databases

PhosphoSitei O75077.

Proteomic databases

PaxDbi O75077.
PRIDEi O75077.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000264377 ; ENSP00000264377 ; ENSG00000114948 . [O75077-1 ]
GeneIDi 8745.
KEGGi hsa:8745.
UCSCi uc002vbq.4. human. [O75077-1 ]

Organism-specific databases

CTDi 8745.
GeneCardsi GC02P207272.
HGNCi HGNC:202. ADAM23.
HPAi CAB033276.
HPA012130.
MIMi 603710. gene.
neXtProti NX_O75077.
PharmGKBi PA24519.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG256419.
GeneTreei ENSGT00760000119181.
HOGENOMi HOG000231962.
HOVERGENi HBG050456.
InParanoidi O75077.
KOi K06837.
OMAi HGMFEDN.
OrthoDBi EOG7B31M6.
PhylomeDBi O75077.
TreeFami TF314733.

Miscellaneous databases

GeneWikii ADAM23.
GenomeRNAii 8745.
NextBioi 32813.
PROi O75077.
SOURCEi Search...

Gene expression databases

Bgeei O75077.
CleanExi HS_ADAM23.
ExpressionAtlasi O75077. baseline and differential.
Genevestigatori O75077.

Family and domain databases

Gene3Di 3.40.390.10. 1 hit.
4.10.70.10. 1 hit.
InterProi IPR006586. ADAM_Cys-rich.
IPR001762. Blood-coag_inhib_Disintegrin.
IPR000742. EG-like_dom.
IPR013032. EGF-like_CS.
IPR024079. MetalloPept_cat_dom.
IPR001590. Peptidase_M12B.
IPR002870. Peptidase_M12B_N.
[Graphical view ]
Pfami PF08516. ADAM_CR. 1 hit.
PF00200. Disintegrin. 1 hit.
PF01562. Pep_M12B_propep. 1 hit.
PF01421. Reprolysin. 1 hit.
[Graphical view ]
SMARTi SM00608. ACR. 1 hit.
SM00050. DISIN. 1 hit.
SM00181. EGF. 1 hit.
[Graphical view ]
SUPFAMi SSF57552. SSF57552. 1 hit.
PROSITEi PS50215. ADAM_MEPRO. 1 hit.
PS50214. DISINTEGRIN_2. 1 hit.
PS00022. EGF_1. 1 hit.
PS50026. EGF_3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Metalloproteinase-like, disintegrin-like, cysteine-rich proteins MDC2 and MDC3: novel human cellular disintegrins highly expressed in the brain."
    Sagane K., Ohya Y., Hasegawa Y., Tanaka I.
    Biochem. J. 334:93-98(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA).
    Tissue: Brain.
  2. "ADAM 23/MDC3, a human disintegrin that promotes cell adhesion via interaction with the alpha v beta 3 integrin through an RGD-independent mechanism."
    Cal S., Freije J.M.P., Lopez J.M., Takada Y., Lopez-Otin C.
    Mol. Biol. Cell 11:1457-1469(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA), INTERACTION WITH INTEGRIN ALPHA-V/BETA-3, MUTAGENESIS OF GLU-566.
    Tissue: Brain.
  3. "Two novel isoforms of Adam23 expressed in the developmental process of mouse and human brains."
    Sun Y.P., Deng K.J., Wang F., Zhang J., Huang X., Qiao S., Zhao S.
    Gene 325:171-178(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA; BETA AND GAMMA), TISSUE SPECIFICITY.
    Tissue: Fetal brain.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM ALPHA).
    Tissue: Brain.

Entry informationi

Entry nameiADA23_HUMAN
AccessioniPrimary (citable) accession number: O75077
Secondary accession number(s): A2RU59
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 7, 2004
Last sequence update: November 1, 1998
Last modified: October 29, 2014
This is version 114 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Peptidase families
    Classification of peptidase families and list of entries
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3