Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O75077 (ADA23_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 109. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Disintegrin and metalloproteinase domain-containing protein 23

Short name=ADAM 23
Alternative name(s):
Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3
Short name=MDC-3
Gene names
Name:ADAM23
Synonyms:MDC3
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length832 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May play a role in cell-cell and cell-matrix interactions. This is a non-catalytic metalloprotease-like protein.

Subunit structure

Can bind to LGI1 and LGI4 By similarity. Ligand for integrin alpha-V/beta-3.

Subcellular location

Cell membrane; Single-pass type I membrane protein Potential.

Isoform Gamma: Secreted.

Tissue specificity

Highly expressed in the brain and weakly expressed in the heart. In the brain, expressed prominently in the amygdala, caudate nucleus, hypothalamus, thalamus, cerebral cortex and occipital pole. Ref.3

Developmental stage

Highly expressed in the fetal brain.

Domain

A conserved motif AVN[ED]CD within the disintegrin-like domain could be involved in the binding to the integrin receptor.

Sequence similarities

Contains 1 disintegrin domain.

Contains 1 EGF-like domain.

Contains 1 peptidase M12B domain.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform Alpha (identifier: O75077-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform Beta (identifier: O75077-2)

The sequence of this isoform differs from the canonical sequence as follows:
     787-817: GPSATNLIIGSIAGAILVAAIVLGGTGWGFK → VNMATSRLIGAVAGTLLALGVIFGGTGWGIE
Isoform Gamma (identifier: O75077-3)

The sequence of this isoform differs from the canonical sequence as follows:
     787-832: GPSATNLIIG...RFDPTQQGPI → EMSRREGSIL...AAVLLELLSL

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 5959 Potential
Propeptide60 – 286227 Potential
PRO_0000029118
Chain287 – 832546Disintegrin and metalloproteinase domain-containing protein 23
PRO_0000029119

Regions

Topological domain287 – 792506Extracellular Potential
Transmembrane793 – 81321Helical; Potential
Topological domain814 – 83219Cytoplasmic Potential
Domain299 – 496198Peptidase M12B
Domain502 – 58887Disintegrin
Domain732 – 76938EGF-like
Region563 – 5686May bind the integrin receptor
Compositional bias589 – 61123Cys-rich

Amino acid modifications

Glycosylation761N-linked (GlcNAc...) Potential
Glycosylation961N-linked (GlcNAc...) Potential
Glycosylation1001N-linked (GlcNAc...) Potential
Glycosylation2631N-linked (GlcNAc...) Potential
Glycosylation5471N-linked (GlcNAc...) Potential
Glycosylation5481N-linked (GlcNAc...) Potential
Glycosylation6641N-linked (GlcNAc...) Potential
Glycosylation7321N-linked (GlcNAc...) Potential
Disulfide bond408 ↔ 491 By similarity
Disulfide bond450 ↔ 475 By similarity
Disulfide bond452 ↔ 459 By similarity
Disulfide bond560 ↔ 580 By similarity
Disulfide bond736 ↔ 751 By similarity
Disulfide bond745 ↔ 757 By similarity
Disulfide bond759 ↔ 768 By similarity

Natural variations

Alternative sequence787 – 83246GPSAT…QQGPI → EMSRREGSILLSKAPSESAA LDGHRLALLDSGYDILAAVL LELLSL in isoform Gamma.
VSP_012045
Alternative sequence787 – 81731GPSAT…GWGFK → VNMATSRLIGAVAGTLLALG VIFGGTGWGIE in isoform Beta.
VSP_012046

Experimental info

Mutagenesis5661E → A: Significantly lower of adhesion-promoting activity. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform Alpha [UniParc].

Last modified November 1, 1998. Version 1.
Checksum: 7841A9670E1C24EF

FASTA83291,926
        10         20         30         40         50         60 
MKPPGSSSRQ PPLAGCSLAG ASCGPQRGPA GSVPASAPAR TPPCRLLLVL LLLPPLAASS 

        70         80         90        100        110        120 
RPRAWGAAAP SAPHWNETAE KNLGVLADED NTLQQNSSSN ISYSNAMQKE ITLPSRLIYY 

       130        140        150        160        170        180 
INQDSESPYH VLDTKARHQQ KHNKAVHLAQ ASFQIEAFGS KFILDLILNN GLLSSDYVEI 

       190        200        210        220        230        240 
HYENGKPQYS KGGEHCYYHG SIRGVKDSKV ALSTCNGLHG MFEDDTFVYM IEPLELVHDE 

       250        260        270        280        290        300 
KSTGRPHIIQ KTLAGQYSKQ MKNLTMERGD QWPFLSELQW LKRRKRAVNP SRGIFEEMKY 

       310        320        330        340        350        360 
LELMIVNDHK TYKKHRSSHA HTNNFAKSVV NLVDSIYKEQ LNTRVVLVAV ETWTEKDQID 

       370        380        390        400        410        420 
ITTNPVQMLH EFSKYRQRIK QHADAVHLIS RVTFHYKRSS LSYFGGVCSR TRGVGVNEYG 

       430        440        450        460        470        480 
LPMAVAQVLS QSLAQNLGIQ WEPSSRKPKC DCTESWGGCI MEETGVSHSR KFSKCSILEY 

       490        500        510        520        530        540 
RDFLQRGGGA CLFNRPTKLF EPTECGNGYV EAGEECDCGF HVECYGLCCK KCSLSNGAHC 

       550        560        570        580        590        600 
SDGPCCNNTS CLFQPRGYEC RDAVNECDIT EYCTGDSGQC PPNLHKQDGY ACNQNQGRCY 

       610        620        630        640        650        660 
NGECKTRDNQ CQYIWGTKAA GSDKFCYEKL NTEGTEKGNC GKDGDRWIQC SKHDVFCGFL 

       670        680        690        700        710        720 
LCTNLTRAPR IGQLQGEIIP TSFYHQGRVI DCSGAHVVLD DDTDVGYVED GTPCGPSMMC 

       730        740        750        760        770        780 
LDRKCLQIQA LNMSSCPLDS KGKVCSGHGV CSNEATCICD FTWAGTDCSI RDPVRNLHPP 

       790        800        810        820        830 
KDEGPKGPSA TNLIIGSIAG AILVAAIVLG GTGWGFKNVK KRRFDPTQQG PI 

« Hide

Isoform Beta [UniParc].

Checksum: E388ACE51334052C
Show »

FASTA83292,046
Isoform Gamma [UniParc].

Checksum: 7F54A1805FA2EC58
Show »

FASTA83292,130

References

« Hide 'large scale' references
[1]"Metalloproteinase-like, disintegrin-like, cysteine-rich proteins MDC2 and MDC3: novel human cellular disintegrins highly expressed in the brain."
Sagane K., Ohya Y., Hasegawa Y., Tanaka I.
Biochem. J. 334:93-98(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA).
Tissue: Brain.
[2]"ADAM 23/MDC3, a human disintegrin that promotes cell adhesion via interaction with the alpha v beta 3 integrin through an RGD-independent mechanism."
Cal S., Freije J.M.P., Lopez J.M., Takada Y., Lopez-Otin C.
Mol. Biol. Cell 11:1457-1469(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA), INTERACTION WITH INTEGRIN ALPHA-V/BETA-3, MUTAGENESIS OF GLU-566.
Tissue: Brain.
[3]"Two novel isoforms of Adam23 expressed in the developmental process of mouse and human brains."
Sun Y.P., Deng K.J., Wang F., Zhang J., Huang X., Qiao S., Zhao S.
Gene 325:171-178(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA; BETA AND GAMMA), TISSUE SPECIFICITY.
Tissue: Fetal brain.
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM ALPHA).
Tissue: Brain.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB009672 mRNA. Translation: BAA32351.1.
AJ005580 mRNA. Translation: CAC20565.1.
CH471063 Genomic DNA. Translation: EAW70386.1.
BC132763 mRNA. Translation: AAI32764.1.
BC132765 mRNA. Translation: AAI32766.1.
RefSeqNP_003803.1. NM_003812.3.
XP_005246989.1. XM_005246932.2.
UniGeneHs.370287.
Hs.591643.

3D structure databases

ProteinModelPortalO75077.
SMRO75077. Positions 296-773.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid114282. 1 interaction.
IntActO75077. 1 interaction.
MINTMINT-257697.
STRING9606.ENSP00000264377.

Protein family/group databases

MEROPSM12.979.

PTM databases

PhosphoSiteO75077.

Proteomic databases

PaxDbO75077.
PRIDEO75077.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000264377; ENSP00000264377; ENSG00000114948. [O75077-1]
ENST00000374416; ENSP00000363537; ENSG00000114948. [O75077-3]
GeneID8745.
KEGGhsa:8745.
UCSCuc002vbq.4. human. [O75077-1]

Organism-specific databases

CTD8745.
GeneCardsGC02P207272.
HGNCHGNC:202. ADAM23.
HPACAB033276.
HPA012130.
MIM603710. gene.
neXtProtNX_O75077.
PharmGKBPA24519.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG256419.
HOGENOMHOG000231962.
HOVERGENHBG050456.
KOK06837.
OMAHGMFEDN.
OrthoDBEOG7B31M6.
PhylomeDBO75077.
TreeFamTF314733.

Gene expression databases

ArrayExpressO75077.
BgeeO75077.
CleanExHS_ADAM23.
GenevestigatorO75077.

Family and domain databases

Gene3D3.40.390.10. 1 hit.
4.10.70.10. 1 hit.
InterProIPR006586. ADAM_Cys-rich.
IPR001762. Blood-coag_inhib_Disintegrin.
IPR000742. EG-like_dom.
IPR013032. EGF-like_CS.
IPR024079. MetalloPept_cat_dom.
IPR001590. Peptidase_M12B.
IPR002870. Peptidase_M12B_N.
[Graphical view]
PfamPF08516. ADAM_CR. 1 hit.
PF00200. Disintegrin. 1 hit.
PF01562. Pep_M12B_propep. 1 hit.
PF01421. Reprolysin. 1 hit.
[Graphical view]
SMARTSM00608. ACR. 1 hit.
SM00050. DISIN. 1 hit.
SM00181. EGF. 1 hit.
[Graphical view]
SUPFAMSSF57552. SSF57552. 1 hit.
PROSITEPS50215. ADAM_MEPRO. 1 hit.
PS50214. DISINTEGRIN_2. 1 hit.
PS00022. EGF_1. 1 hit.
PS50026. EGF_3. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiADAM23.
GenomeRNAi8745.
NextBio32813.
PROO75077.
SOURCESearch...

Entry information

Entry nameADA23_HUMAN
AccessionPrimary (citable) accession number: O75077
Secondary accession number(s): A2RU59
Entry history
Integrated into UniProtKB/Swiss-Prot: December 7, 2004
Last sequence update: November 1, 1998
Last modified: April 16, 2014
This is version 109 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Peptidase families

Classification of peptidase families and list of entries

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 2

Human chromosome 2: entries, gene names and cross-references to MIM