Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O75077

- ADA23_HUMAN

UniProt

O75077 - ADA23_HUMAN

Protein

Disintegrin and metalloproteinase domain-containing protein 23

Gene

ADAM23

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 113 (01 Oct 2014)
      Sequence version 1 (01 Nov 1998)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May play a role in cell-cell and cell-matrix interactions. This is a non-catalytic metalloprotease-like protein.

    GO - Molecular functioni

    1. integrin binding Source: ProtInc
    2. metalloendopeptidase activity Source: InterPro
    3. metallopeptidase activity Source: ProtInc
    4. protein binding Source: DFLAT
    5. zinc ion binding Source: InterPro

    GO - Biological processi

    1. cell adhesion Source: UniProtKB-KW
    2. central nervous system development Source: ProtInc

    Keywords - Biological processi

    Cell adhesion

    Protein family/group databases

    MEROPSiM12.979.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Disintegrin and metalloproteinase domain-containing protein 23
    Short name:
    ADAM 23
    Alternative name(s):
    Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3
    Short name:
    MDC-3
    Gene namesi
    Name:ADAM23
    Synonyms:MDC3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:202. ADAM23.

    Subcellular locationi

    GO - Cellular componenti

    1. extracellular region Source: UniProtKB-SubCell
    2. integral component of plasma membrane Source: ProtInc

    Keywords - Cellular componenti

    Cell membrane, Membrane, Secreted

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi566 – 5661E → A: Significantly lower of adhesion-promoting activity. 1 Publication

    Organism-specific databases

    PharmGKBiPA24519.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 5959Sequence AnalysisAdd
    BLAST
    Propeptidei60 – 286227Sequence AnalysisPRO_0000029118Add
    BLAST
    Chaini287 – 832546Disintegrin and metalloproteinase domain-containing protein 23PRO_0000029119Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi76 – 761N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi96 – 961N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi100 – 1001N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi263 – 2631N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi408 ↔ 491By similarity
    Disulfide bondi450 ↔ 475By similarity
    Disulfide bondi452 ↔ 459By similarity
    Glycosylationi547 – 5471N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi548 – 5481N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi560 ↔ 580By similarity
    Glycosylationi664 – 6641N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi732 – 7321N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi736 ↔ 751By similarity
    Disulfide bondi745 ↔ 757By similarity
    Disulfide bondi759 ↔ 768By similarity

    Keywords - PTMi

    Cleavage on pair of basic residues, Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiO75077.
    PRIDEiO75077.

    PTM databases

    PhosphoSiteiO75077.

    Expressioni

    Tissue specificityi

    Highly expressed in the brain and weakly expressed in the heart. In the brain, expressed prominently in the amygdala, caudate nucleus, hypothalamus, thalamus, cerebral cortex and occipital pole.1 Publication

    Developmental stagei

    Highly expressed in the fetal brain.

    Gene expression databases

    ArrayExpressiO75077.
    BgeeiO75077.
    CleanExiHS_ADAM23.
    GenevestigatoriO75077.

    Organism-specific databases

    HPAiCAB033276.
    HPA012130.

    Interactioni

    Subunit structurei

    Can bind to LGI1 and LGI4 By similarity. Ligand for integrin alpha-V/beta-3.By similarity

    Protein-protein interaction databases

    BioGridi114282. 1 interaction.
    IntActiO75077. 1 interaction.
    MINTiMINT-257697.
    STRINGi9606.ENSP00000264377.

    Structurei

    3D structure databases

    ProteinModelPortaliO75077.
    SMRiO75077. Positions 296-773.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini287 – 792506ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini814 – 83219CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei793 – 81321HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini299 – 496198Peptidase M12BPROSITE-ProRule annotationAdd
    BLAST
    Domaini502 – 58887DisintegrinPROSITE-ProRule annotationAdd
    BLAST
    Domaini732 – 76938EGF-likePROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni563 – 5686May bind the integrin receptor

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi589 – 61123Cys-richAdd
    BLAST

    Domaini

    A conserved motif AVN[ED]CD within the disintegrin-like domain could be involved in the binding to the integrin receptor.

    Sequence similaritiesi

    Contains 1 disintegrin domain.PROSITE-ProRule annotation
    Contains 1 EGF-like domain.PROSITE-ProRule annotation
    Contains 1 peptidase M12B domain.PROSITE-ProRule annotation

    Keywords - Domaini

    EGF-like domain, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG256419.
    HOGENOMiHOG000231962.
    HOVERGENiHBG050456.
    KOiK06837.
    OMAiHGMFEDN.
    OrthoDBiEOG7B31M6.
    PhylomeDBiO75077.
    TreeFamiTF314733.

    Family and domain databases

    Gene3Di3.40.390.10. 1 hit.
    4.10.70.10. 1 hit.
    InterProiIPR006586. ADAM_Cys-rich.
    IPR001762. Blood-coag_inhib_Disintegrin.
    IPR000742. EG-like_dom.
    IPR013032. EGF-like_CS.
    IPR024079. MetalloPept_cat_dom.
    IPR001590. Peptidase_M12B.
    IPR002870. Peptidase_M12B_N.
    [Graphical view]
    PfamiPF08516. ADAM_CR. 1 hit.
    PF00200. Disintegrin. 1 hit.
    PF01562. Pep_M12B_propep. 1 hit.
    PF01421. Reprolysin. 1 hit.
    [Graphical view]
    SMARTiSM00608. ACR. 1 hit.
    SM00050. DISIN. 1 hit.
    SM00181. EGF. 1 hit.
    [Graphical view]
    SUPFAMiSSF57552. SSF57552. 1 hit.
    PROSITEiPS50215. ADAM_MEPRO. 1 hit.
    PS50214. DISINTEGRIN_2. 1 hit.
    PS00022. EGF_1. 1 hit.
    PS50026. EGF_3. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform Alpha (identifier: O75077-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKPPGSSSRQ PPLAGCSLAG ASCGPQRGPA GSVPASAPAR TPPCRLLLVL    50
    LLLPPLAASS RPRAWGAAAP SAPHWNETAE KNLGVLADED NTLQQNSSSN 100
    ISYSNAMQKE ITLPSRLIYY INQDSESPYH VLDTKARHQQ KHNKAVHLAQ 150
    ASFQIEAFGS KFILDLILNN GLLSSDYVEI HYENGKPQYS KGGEHCYYHG 200
    SIRGVKDSKV ALSTCNGLHG MFEDDTFVYM IEPLELVHDE KSTGRPHIIQ 250
    KTLAGQYSKQ MKNLTMERGD QWPFLSELQW LKRRKRAVNP SRGIFEEMKY 300
    LELMIVNDHK TYKKHRSSHA HTNNFAKSVV NLVDSIYKEQ LNTRVVLVAV 350
    ETWTEKDQID ITTNPVQMLH EFSKYRQRIK QHADAVHLIS RVTFHYKRSS 400
    LSYFGGVCSR TRGVGVNEYG LPMAVAQVLS QSLAQNLGIQ WEPSSRKPKC 450
    DCTESWGGCI MEETGVSHSR KFSKCSILEY RDFLQRGGGA CLFNRPTKLF 500
    EPTECGNGYV EAGEECDCGF HVECYGLCCK KCSLSNGAHC SDGPCCNNTS 550
    CLFQPRGYEC RDAVNECDIT EYCTGDSGQC PPNLHKQDGY ACNQNQGRCY 600
    NGECKTRDNQ CQYIWGTKAA GSDKFCYEKL NTEGTEKGNC GKDGDRWIQC 650
    SKHDVFCGFL LCTNLTRAPR IGQLQGEIIP TSFYHQGRVI DCSGAHVVLD 700
    DDTDVGYVED GTPCGPSMMC LDRKCLQIQA LNMSSCPLDS KGKVCSGHGV 750
    CSNEATCICD FTWAGTDCSI RDPVRNLHPP KDEGPKGPSA TNLIIGSIAG 800
    AILVAAIVLG GTGWGFKNVK KRRFDPTQQG PI 832
    Length:832
    Mass (Da):91,926
    Last modified:November 1, 1998 - v1
    Checksum:i7841A9670E1C24EF
    GO
    Isoform Beta (identifier: O75077-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         787-817: GPSATNLIIGSIAGAILVAAIVLGGTGWGFK → VNMATSRLIGAVAGTLLALGVIFGGTGWGIE

    Show »
    Length:832
    Mass (Da):92,046
    Checksum:iE388ACE51334052C
    GO
    Isoform Gamma (identifier: O75077-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         787-832: GPSATNLIIG...RFDPTQQGPI → EMSRREGSIL...AAVLLELLSL

    Show »
    Length:832
    Mass (Da):92,130
    Checksum:i7F54A1805FA2EC58
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei787 – 83246GPSAT…QQGPI → EMSRREGSILLSKAPSESAA LDGHRLALLDSGYDILAAVL LELLSL in isoform Gamma. 1 PublicationVSP_012045Add
    BLAST
    Alternative sequencei787 – 81731GPSAT…GWGFK → VNMATSRLIGAVAGTLLALG VIFGGTGWGIE in isoform Beta. 1 PublicationVSP_012046Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB009672 mRNA. Translation: BAA32351.1.
    AJ005580 mRNA. Translation: CAC20565.1.
    CH471063 Genomic DNA. Translation: EAW70386.1.
    BC132763 mRNA. Translation: AAI32764.1.
    BC132765 mRNA. Translation: AAI32766.1.
    CCDSiCCDS2369.1. [O75077-1]
    RefSeqiNP_003803.1. NM_003812.3. [O75077-1]
    XP_005246989.1. XM_005246932.2. [O75077-3]
    UniGeneiHs.370287.
    Hs.591643.

    Genome annotation databases

    EnsembliENST00000264377; ENSP00000264377; ENSG00000114948. [O75077-1]
    GeneIDi8745.
    KEGGihsa:8745.
    UCSCiuc002vbq.4. human. [O75077-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Web resourcesi

    Atlas of Genetics and Cytogenetics in Oncology and Haematology

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB009672 mRNA. Translation: BAA32351.1 .
    AJ005580 mRNA. Translation: CAC20565.1 .
    CH471063 Genomic DNA. Translation: EAW70386.1 .
    BC132763 mRNA. Translation: AAI32764.1 .
    BC132765 mRNA. Translation: AAI32766.1 .
    CCDSi CCDS2369.1. [O75077-1 ]
    RefSeqi NP_003803.1. NM_003812.3. [O75077-1 ]
    XP_005246989.1. XM_005246932.2. [O75077-3 ]
    UniGenei Hs.370287.
    Hs.591643.

    3D structure databases

    ProteinModelPortali O75077.
    SMRi O75077. Positions 296-773.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 114282. 1 interaction.
    IntActi O75077. 1 interaction.
    MINTi MINT-257697.
    STRINGi 9606.ENSP00000264377.

    Protein family/group databases

    MEROPSi M12.979.

    PTM databases

    PhosphoSitei O75077.

    Proteomic databases

    PaxDbi O75077.
    PRIDEi O75077.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000264377 ; ENSP00000264377 ; ENSG00000114948 . [O75077-1 ]
    GeneIDi 8745.
    KEGGi hsa:8745.
    UCSCi uc002vbq.4. human. [O75077-1 ]

    Organism-specific databases

    CTDi 8745.
    GeneCardsi GC02P207272.
    HGNCi HGNC:202. ADAM23.
    HPAi CAB033276.
    HPA012130.
    MIMi 603710. gene.
    neXtProti NX_O75077.
    PharmGKBi PA24519.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG256419.
    HOGENOMi HOG000231962.
    HOVERGENi HBG050456.
    KOi K06837.
    OMAi HGMFEDN.
    OrthoDBi EOG7B31M6.
    PhylomeDBi O75077.
    TreeFami TF314733.

    Miscellaneous databases

    GeneWikii ADAM23.
    GenomeRNAii 8745.
    NextBioi 32813.
    PROi O75077.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O75077.
    Bgeei O75077.
    CleanExi HS_ADAM23.
    Genevestigatori O75077.

    Family and domain databases

    Gene3Di 3.40.390.10. 1 hit.
    4.10.70.10. 1 hit.
    InterProi IPR006586. ADAM_Cys-rich.
    IPR001762. Blood-coag_inhib_Disintegrin.
    IPR000742. EG-like_dom.
    IPR013032. EGF-like_CS.
    IPR024079. MetalloPept_cat_dom.
    IPR001590. Peptidase_M12B.
    IPR002870. Peptidase_M12B_N.
    [Graphical view ]
    Pfami PF08516. ADAM_CR. 1 hit.
    PF00200. Disintegrin. 1 hit.
    PF01562. Pep_M12B_propep. 1 hit.
    PF01421. Reprolysin. 1 hit.
    [Graphical view ]
    SMARTi SM00608. ACR. 1 hit.
    SM00050. DISIN. 1 hit.
    SM00181. EGF. 1 hit.
    [Graphical view ]
    SUPFAMi SSF57552. SSF57552. 1 hit.
    PROSITEi PS50215. ADAM_MEPRO. 1 hit.
    PS50214. DISINTEGRIN_2. 1 hit.
    PS00022. EGF_1. 1 hit.
    PS50026. EGF_3. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Metalloproteinase-like, disintegrin-like, cysteine-rich proteins MDC2 and MDC3: novel human cellular disintegrins highly expressed in the brain."
      Sagane K., Ohya Y., Hasegawa Y., Tanaka I.
      Biochem. J. 334:93-98(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA).
      Tissue: Brain.
    2. "ADAM 23/MDC3, a human disintegrin that promotes cell adhesion via interaction with the alpha v beta 3 integrin through an RGD-independent mechanism."
      Cal S., Freije J.M.P., Lopez J.M., Takada Y., Lopez-Otin C.
      Mol. Biol. Cell 11:1457-1469(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA), INTERACTION WITH INTEGRIN ALPHA-V/BETA-3, MUTAGENESIS OF GLU-566.
      Tissue: Brain.
    3. "Two novel isoforms of Adam23 expressed in the developmental process of mouse and human brains."
      Sun Y.P., Deng K.J., Wang F., Zhang J., Huang X., Qiao S., Zhao S.
      Gene 325:171-178(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA; BETA AND GAMMA), TISSUE SPECIFICITY.
      Tissue: Fetal brain.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM ALPHA).
      Tissue: Brain.

    Entry informationi

    Entry nameiADA23_HUMAN
    AccessioniPrimary (citable) accession number: O75077
    Secondary accession number(s): A2RU59
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 7, 2004
    Last sequence update: November 1, 1998
    Last modified: October 1, 2014
    This is version 113 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. Peptidase families
      Classification of peptidase families and list of entries
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3