O75072 (FKTN_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 110.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Fukutin EC=2.-.-.- Alternative name(s): Fukuyama-type congenital muscular dystrophy protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 461 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May be a glycosyltransferase which participates in glycosylation of alpha-dystroglycan/DAG1. May interact with and reinforce a large complex encompassing the outside and inside of muscle membranes. Could be involved in brain development. Ref.8 |
| Subcellular location | Golgi apparatus membrane; Single-pass type II membrane protein By similarity. |
| Tissue specificity | Widely expressed with highest expression in brain, heart, pancreas and skeletal muscle. Expressed at similar levels in control fetal and adult brain, but is much reduced in Fukuyama-type congenital dystrophy (FCMD) brains. Expressed in migrating neurons, including Cajar-Retzius cells and adult cortical neurons, as well as hippocampal pyramidal cells and cerebellar Purkinje cells. No expression observed in the glia limitans, the subpial astrocytes (which contribute to basement membrane formation) or other glial cells. In the FCMD brain, neurons in regions with no dysplasia show fair expression, whereas transcripts are nearly undetectable in the overmigrated dysplastic region. Ref.7 |
| Involvement in disease | Muscular dystrophy-dystroglycanopathy congenital with brain and eye anomalies A4 (MDDGA4) [MIM:253800]: An autosomal recessive disorder characterized by congenital muscular dystrophy associated with cobblestone lissencephaly and other brain anomalies, eye malformations, profound mental retardation, and death usually in the first years of life. Included diseases are the more severe Walker-Warburg syndrome and the slightly less severe muscle-eye-brain disease. Muscular dystrophy-dystroglycanopathy congenital without mental retardation B4 (MDDGB4) [MIM:613152]: An autosomal recessive disorder characterized by congenital muscular dystrophy and evidence of dystroglycanopathy. Features included increased serum creatine kinase, generalized weakness, mild white matter changes on brain MRI, and absence of mental retardation. Muscular dystrophy-dystroglycanopathy limb-girdle C4 (MDDGC4) [MIM:611588]: An autosomal recessive degenerative myopathy characterized by progressive weakness of the pelvic and shoulder girdle muscles, and elevated serum creatine kinase. MDDGC4 has no brain involvement and a remarkable clinical response to corticosteroids. Cardiomyopathy, dilated 1X (CMD1X) [MIM:611615]: A disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death. |
| Sequence similarities | Belongs to the LicD transferase family. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O75072-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O75072-2) The sequence of this isoform differs from the canonical sequence as follows: 426-461: TWKIPVKTWDWKRSPPNVQPNGIWPISEWDEVIQLY → NQQGA | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 461 | 461 | Fukutin | PRO_0000204720 | |||||
Regions | |||||||||
| Topological domain | 1 – 7 | 7 | Cytoplasmic Potential | ||||||
| Transmembrane | 8 – 28 | 21 | Helical; Signal-anchor for type II membrane protein; Potential | ||||||
| Topological domain | 29 – 461 | 433 | Lumenal Potential | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 92 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 426 – 461 | 36 | TWKIP…VIQLY → NQQGA in isoform 2. | VSP_045961 | |||||
| Natural variant | 56 | 1 | R → C. Corresponds to variant rs41277797 [ dbSNP | Ensembl ]. | VAR_061296 | |||||
| Natural variant | 114 | 1 | A → T in MDDGC4. Ref.19 | VAR_065050 | |||||
| Natural variant | 125 | 1 | G → S in a patient diagnosed with Walker-Warburg syndrome. Ref.11 Corresponds to variant rs34006675 [ dbSNP | Ensembl ]. | VAR_033926 | |||||
| Natural variant | 170 | 1 | A → E in MDDGA4. Ref.18 | VAR_065051 | |||||
| Natural variant | 176 | 1 | F → S in MDDGC4. Ref.19 | VAR_065052 | |||||
| Natural variant | 179 | 1 | R → T in CMD1X. Ref.14 | VAR_039287 | |||||
| Natural variant | 203 | 1 | R → Q. Ref.1 Corresponds to variant rs34787999 [ dbSNP | Ensembl ]. | VAR_033927 | |||||
| Natural variant | 225 | 1 | D → E in a breast cancer sample; somatic mutation. Ref.16 | VAR_036334 | |||||
| Natural variant | 225 | 1 | D → N in a breast cancer sample; somatic mutation. Ref.16 | VAR_036335 | |||||
| Natural variant | 246 | 1 | R → G in MDDGB4; detected in a compound heterozygote with very mild phenotype carrying a non-sense mutation. Ref.18 | VAR_065053 | |||||
| Natural variant | 250 | 1 | C → G in MDDGA4. Ref.13 | VAR_018278 | |||||
| Natural variant | 307 | 1 | R → Q in MDDGB4 and MDDGC4; the mutant protein is expressed and localized correctly within the cell. Ref.15 Ref.17 Ref.18 | VAR_039288 | |||||
| Natural variant | 358 | 1 | Q → P in CMD1X. Ref.14 | VAR_039289 | |||||
| Natural variant | 371 | 1 | Y → C in MDDGA4. Ref.18 | VAR_065054 | |||||
| Natural variant | 446 | 1 | N → D. Ref.10 Corresponds to variant rs41313301 [ dbSNP | Ensembl ]. | VAR_018279 | |||||
Experimental info | |||||||||
| Sequence conflict | 414 | 1 | E → K in BAG62491. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||
References
Web resources
| GeneReviews |
| GGDB GlycoGene database |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB008226 mRNA. Translation: BAA32000.1. AB038490 Genomic DNA. Translation: BAA94082.1. AK300840 mRNA. Translation: BAG62491.1. AL158070 Genomic DNA. Translation: CAC22162.1. BC101808 mRNA. Translation: AAI01809.1. BC112038 mRNA. Translation: AAI12039.1. BC117699 mRNA. Translation: AAI17700.1. |
| IPI | IPI00306835. |
| RefSeq | NP_001073270.1. NM_001079802.1. NP_001185892.1. NM_001198963.1. NP_006722.2. NM_006731.2. |
| UniGene | Hs.55777. |
3D structure databases | |
| ProteinModelPortal | O75072. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000223528. |
PTM databases | |
| PhosphoSite | O75072. |
Proteomic databases | |
| PaxDb | O75072. |
| PRIDE | O75072. |
Protocols and materials databases | |
| DNASU | 2218. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000223528; ENSP00000223528; ENSG00000106692. ENST00000357998; ENSP00000350687; ENSG00000106692. |
| GeneID | 2218. |
| KEGG | hsa:2218. |
| UCSC | uc004bcr.3. human. |
Organism-specific databases | |
| CTD | 2218. |
| GeneCards | GC09P108320. |
| HGNC | HGNC:3622. FKTN. |
| HPA | HPA012820. |
| MIM | 253800. phenotype. 607440. gene. 611588. phenotype. 611615. phenotype. 613152. phenotype. |
| neXtProt | NX_O75072. |
| Orphanet | 206554. Autosomal recessive limb-girdle muscular dystrophy type 2M. 272. Congenital muscular dystrophy, Fukuyama type. 154. Familial isolated dilated cardiomyopathy. 899. Walker-Warburg syndrome. |
| PharmGKB | PA162388669. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG83383. |
| HOGENOM | HOG000231657. |
| HOVERGEN | HBG005068. |
| InParanoid | O75072. |
| OMA | FQLYYYK. |
| OrthoDB | EOG4X97H4. |
| PhylomeDB | O75072. |
Gene expression databases | |
| ArrayExpress | O75072. |
| Bgee | O75072. |
| CleanEx | HS_FKTN. |
| Genevestigator | O75072. |
Family and domain databases | |
| InterPro | IPR009644. Fukutin-related. IPR007074. LicD. [Graphical view] |
| PANTHER | PTHR15407. PTHR15407. 1 hit. |
| Pfam | PF04991. LicD. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 2218. |
| NextBio | 35535038. |
| SOURCE | Search... |
Entry information
| Entry name | FKTN_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O75072 Secondary accession number(s): B4DUX9 Q9P295 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
