O75061 (AUXI_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 105.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Putative tyrosine-protein phosphatase auxilin EC=3.1.3.48 Alternative name(s): DnaJ homolog subfamily C member 6 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 913 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Recruits HSPA8/HSC70 to clathrin-coated vesicles and promotes uncoating of clathrin-coated vesicles By similarity. |
| Catalytic activity | Protein tyrosine phosphate + H2O = protein tyrosine + phosphate. |
| Subunit structure | Interacts with HSPA8/HSC70. Interacts with CLTC. Interacts with AP2A2 By similarity. |
| Sequence similarities | Contains 1 C2 tensin-type domain. Contains 1 J domain. Contains 1 phosphatase tensin-type domain. |
| Sequence caution | The sequence BAA32318.2 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat SH3-binding |
| Molecular function | Chaperone Hydrolase Protein phosphatase |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cellular membrane organization Traceable author statement. Source: Reactome peptidyl-tyrosine dephosphorylationInferred from electronic annotation. Source: GOC post-Golgi vesicle-mediated transportTraceable author statement. Source: Reactome |
| Cellular_component | cytosol Traceable author statement. Source: Reactome |
| Molecular_function | protein tyrosine phosphatase activity Inferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O75061-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O75061-2) The sequence of this isoform differs from the canonical sequence as follows: 1-7: MKDSENK → MSLLGSYRKKTSNDGYESLQLVDSNGDLSAGSGGVGGKQRVNAGAAARSPARQPPDRASTMDSS | ||||||
| Isoform 3 (identifier: O75061-3) The sequence of this isoform differs from the canonical sequence as follows: 1-13: Missing. 456-913: Missing. | ||||||
| Isoform 4 (identifier: O75061-4) The sequence of this isoform differs from the canonical sequence as follows: 1-13: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 913 | 913 | Putative tyrosine-protein phosphatase auxilin | PRO_0000244516 | |||||
Regions | |||||||||
| Repeat | 36 – 39 | 4 | 1 | ||||||
| Repeat | 40 – 43 | 4 | 2 | ||||||
| Repeat | 44 – 47 | 4 | 3 | ||||||
| Domain | 55 – 222 | 168 | Phosphatase tensin-type | ||||||
| Domain | 228 – 366 | 139 | C2 tensin-type | ||||||
| Domain | 849 – 913 | 65 | J | ||||||
| Region | 36 – 47 | 12 | 3 X 4 AA approximate tandem repeats | ||||||
| Motif | 409 – 417 | 9 | SH3-binding Potential | ||||||
| Compositional bias | 466 – 760 | 295 | Pro-rich | ||||||
| Compositional bias | 529 – 532 | 4 | Poly-Gly | ||||||
Sites | |||||||||
| Active site | 164 | 1 | Phosphocysteine intermediate Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 563 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 570 | 1 | Phosphoserine Ref.6 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 13 | 13 | Missing in isoform 3 and isoform 4. | VSP_019579 | |||||
| Alternative sequence | 1 – 7 | 7 | MKDSENK → MSLLGSYRKKTSNDGYESLQ LVDSNGDLSAGSGGVGGKQR VNAGAAARSPARQPPDRAST MDSS in isoform 2. | VSP_019580 | |||||
| Alternative sequence | 456 – 913 | 458 | Missing in isoform 3. | VSP_019581 | |||||
| Natural variant | 671 | 1 | S → N. Corresponds to variant rs4915691 [ dbSNP | Ensembl ]. | VAR_026908 | |||||
Experimental info | |||||||||
| Sequence conflict | 178 | 1 | M → V in BAH12344. Ref.2 | ||||||
| Sequence conflict | 425 | 1 | F → S in AAH51722. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB007942 mRNA. Translation: BAA32318.2. Different initiation. AK296408 mRNA. Translation: BAH12344.1. AL139294, AL355487, AC119800 Genomic DNA. Translation: CAI18997.1. AL139294, AL355487, AC119800 Genomic DNA. Translation: CAI18999.1. AL355487, AC119800, AL139294 Genomic DNA. Translation: CAI23547.1. AL355487, AC119800, AL139294 Genomic DNA. Translation: CAI23548.1. AL356212 Genomic DNA. No translation available. CH471059 Genomic DNA. Translation: EAX06533.1. CH471059 Genomic DNA. Translation: EAX06534.1. CH471059 Genomic DNA. Translation: EAX06536.1. CH471059 Genomic DNA. Translation: EAX06537.1. BC051722 mRNA. Translation: AAH51722.1. BC109279 mRNA. Translation: AAI09280.2. BC109280 mRNA. Translation: AAI09281.2. |
| IPI | IPI00184119. IPI00639806. IPI00760699. |
| RefSeq | NP_001243793.1. NM_001256864.1. NP_001243794.1. NM_001256865.1. NP_055602.1. NM_014787.3. |
| UniGene | Hs.647643. |
3D structure databases | |
| ProteinModelPortal | O75061. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000378735. |
PTM databases | |
| PhosphoSite | O75061. |
Proteomic databases | |
| PaxDb | O75061. |
| PRIDE | O75061. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000263441; ENSP00000263441; ENSG00000116675. ENST00000371069; ENSP00000360108; ENSG00000116675. ENST00000395325; ENSP00000378735; ENSG00000116675. |
| GeneID | 9829. |
| KEGG | hsa:9829. |
| UCSC | uc001dcc.1. human. uc001dce.1. human. |
Organism-specific databases | |
| CTD | 9829. |
| GeneCards | GC01P065714. |
| HGNC | HGNC:15469. DNAJC6. |
| HPA | HPA031182. |
| MIM | 608375. gene. |
| neXtProt | NX_O75061. |
| PharmGKB | PA27423. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG269956. |
| HOGENOM | HOG000034235. |
| HOVERGEN | HBG004322. |
| KO | K09526. |
| OMA | LCWQDQK. |
| OrthoDB | EOG4T4CTX. |
Enzyme and pathway databases | |
| Reactome | REACT_11123. Membrane Trafficking. |
Gene expression databases | |
| ArrayExpress | O75061. |
| Bgee | O75061. |
| CleanEx | HS_DNAJC6. |
| Genevestigator | O75061. |
| GermOnline | ENSG00000116675. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.10.287.110. 1 hit. |
| InterPro | IPR008973. C2_Ca/lipid-bd_dom_CaLB. IPR001623. DnaJ_domain. IPR014019. Phosphatase_tensin-typ. IPR014020. Tensin_phosphatase_C2-dom. [Graphical view] |
| Pfam | PF00226. DnaJ. 1 hit. PF10409. PTEN_C2. 1 hit. [Graphical view] |
| SMART | SM00271. DnaJ. 1 hit. [Graphical view] |
| SUPFAM | SSF49562. C2_CaLB. 1 hit. SSF46565. DnaJ_N. 1 hit. |
| PROSITE | PS51182. C2_TENSIN. 1 hit. PS00636. DNAJ_1. False negative. PS50076. DNAJ_2. 1 hit. PS51181. PPASE_TENSIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 9829. |
| NextBio | 37030. |
| SOURCE | Search... |
Entry information
| Entry name | AUXI_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O75061 Secondary accession number(s): B7Z3V8 Q5T615 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
