Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O75061 (AUXI_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 114. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Putative tyrosine-protein phosphatase auxilin

EC=3.1.3.48
Alternative name(s):
DnaJ homolog subfamily C member 6
Gene names
Name:DNAJC6
Synonyms:KIAA0473
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length913 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Recruits HSPA8/HSC70 to clathrin-coated vesicles and promotes uncoating of clathrin-coated vesicles By similarity.

Catalytic activity

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.

Subunit structure

Interacts with HSPA8/HSC70. Interacts with CLTC. Interacts with AP2A2 By similarity.

Sequence similarities

Contains 1 C2 tensin-type domain.

Contains 1 J domain.

Contains 1 phosphatase tensin-type domain.

Sequence caution

The sequence BAA32318.2 differs from that shown. Reason: Erroneous initiation.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainRepeat
SH3-binding
   Molecular functionChaperone
Hydrolase
Protein phosphatase
   PTMPhosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processmembrane organization

Traceable author statement. Source: Reactome

post-Golgi vesicle-mediated transport

Traceable author statement. Source: Reactome

   Cellular_componentcytosol

Traceable author statement. Source: Reactome

   Molecular_functionprotein tyrosine phosphatase activity

Inferred from electronic annotation. Source: UniProtKB-EC

Complete GO annotation...

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: O75061-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O75061-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MKDSENK → MSLLGSYRKKTSNDGYESLQLVDSNGDLSAGSGGVGGKQRVNAGAAARSPARQPPDRASTMDSS
Isoform 3 (identifier: O75061-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: Missing.
     456-913: Missing.
Isoform 4 (identifier: O75061-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 913913Putative tyrosine-protein phosphatase auxilin
PRO_0000244516

Regions

Repeat36 – 3941
Repeat40 – 4342
Repeat44 – 4743
Domain55 – 222168Phosphatase tensin-type
Domain228 – 366139C2 tensin-type
Domain849 – 91365J
Region36 – 47123 X 4 AA approximate tandem repeats
Motif409 – 4179SH3-binding Potential
Compositional bias466 – 760295Pro-rich
Compositional bias529 – 5324Poly-Gly

Sites

Active site1641Phosphocysteine intermediate Potential

Amino acid modifications

Modified residue5631Phosphoserine Ref.6
Modified residue5701Phosphoserine Ref.6

Natural variations

Alternative sequence1 – 1313Missing in isoform 3 and isoform 4.
VSP_019579
Alternative sequence1 – 77MKDSENK → MSLLGSYRKKTSNDGYESLQ LVDSNGDLSAGSGGVGGKQR VNAGAAARSPARQPPDRAST MDSS in isoform 2.
VSP_019580
Alternative sequence456 – 913458Missing in isoform 3.
VSP_019581
Natural variant6711S → N.
Corresponds to variant rs4915691 [ dbSNP | Ensembl ].
VAR_026908

Experimental info

Sequence conflict1781M → V in BAH12344. Ref.2
Sequence conflict4251F → S in AAH51722. Ref.5

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 27, 2006. Version 3.
Checksum: 7B7187AAC8ADF2E4

FASTA91399,997
        10         20         30         40         50         60 
MKDSENKGAS SPDMEPSYGG GLFDMVKGGA GRLFSNLKDN LKDTLKDTSS RVIQSVTSYT 

        70         80         90        100        110        120 
KGDLDFTYVT SRIIVMSFPL DNVDIGFRNQ VDDIRSFLDS RHLDHYTVYN LSPKSYRTAK 

       130        140        150        160        170        180 
FHSRVSECSW PIRQAPSLHN LFAVCRNMYN WLLQNPKNVC VVHCLDGRAA SSILVGAMFI 

       190        200        210        220        230        240 
FCNLYSTPGP AIRLLYAKRP GIGLSPSHRR YLGYMCDLLA DKPYRPHFKP LTIKSITVSP 

       250        260        270        280        290        300 
IPFFNKQRNG CRPYCDVLIG ETKIYSTCTD FERMKEYRVQ DGKIFIPLNI TVQGDVVVSM 

       310        320        330        340        350        360 
YHLRSTIGSR LQAKVTNTQI FQLQFHTGFI PLDTTVLKFT KPELDACDVP EKYPQLFQVT 

       370        380        390        400        410        420 
LDVELQPHDK VIDLTPPWEH YCTKDVNPSI LFSSHQEHQD TLALGGQAPI DIPPDNPRHY 

       430        440        450        460        470        480 
GQSGFFASLC WQDQKSEKSF CEEDHAALVN QESEQSDDEL LTLSSPHGNA NGDKPHGVKK 

       490        500        510        520        530        540 
PSKKQQEPAA PPPPEDVDLL GLEGSAMSNS FSPPAAPPTN SELLSDLFGG GGAAGPTQAG 

       550        560        570        580        590        600 
QSGVEDVFHP SGPASTQSTP RRSATSTSAS PTLRVGEGAT FDPFGAPSKP SGQDLLGSFL 

       610        620        630        640        650        660 
NTSSASSDPF LQPTRSPSPT VHASSTPAVN IQPDVSGGWD WHAKPGGFGM GSKSAATSPT 

       670        680        690        700        710        720 
GSSHGTPTHQ SKPQTLDPFA DLGTLGSSSF ASKPTTPTGL GGGFPPLSSP QKASPQPMGG 

       730        740        750        760        770        780 
GWQQGGAYNW QQPQPKPQPS MPHSSPQNRP NYNVSFSAMP GGQNERGKGS SNLEGKQKAA 

       790        800        810        820        830        840 
DFEDLLSGQG FNAHKDKKGP RTIAEMRKEE MAKEMDPEKL KILEWIEGKE RNIRALLSTM 

       850        860        870        880        890        900 
HTVLWAGETK WKPVGMADLV TPEQVKKVYR KAVLVVHPDK ATGQPYEQYA KMIFMELNDA 

       910 
WSEFENQGQK PLY 

« Hide

Isoform 2 [UniParc].

Checksum: C976C4BB3072DCC7
Show »

FASTA970105,675
Isoform 3 [UniParc].

Checksum: 5E7AB1E840DADD6A
Show »

FASTA44250,302
Isoform 4 [UniParc].

Checksum: 6FD4AB1358FF52E9
Show »

FASTA90098,649

References

[1]"Characterization of cDNA clones in size-fractionated cDNA libraries from human brain."
Seki N., Ohira M., Nagase T., Ishikawa K., Miyajima N., Nakajima D., Nomura N., Ohara O.
DNA Res. 4:345-349(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
Tissue: Thalamus.
[3]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
Tissue: Brain.
[6]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-563 AND SER-570, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[7]"Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[8]"N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB."
Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.
Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB007942 mRNA. Translation: BAA32318.2. Different initiation.
AK296408 mRNA. Translation: BAH12344.1.
AL139294, AL355487, AC119800 Genomic DNA. Translation: CAI18997.1.
AL139294, AL355487, AC119800 Genomic DNA. Translation: CAI18999.1.
AL355487, AC119800, AL139294 Genomic DNA. Translation: CAI23547.1.
AL355487, AC119800, AL139294 Genomic DNA. Translation: CAI23548.1.
AL356212 Genomic DNA. No translation available.
CH471059 Genomic DNA. Translation: EAX06533.1.
CH471059 Genomic DNA. Translation: EAX06534.1.
CH471059 Genomic DNA. Translation: EAX06536.1.
CH471059 Genomic DNA. Translation: EAX06537.1.
BC051722 mRNA. Translation: AAH51722.1.
BC109279 mRNA. Translation: AAI09280.2.
BC109280 mRNA. Translation: AAI09281.2.
RefSeqNP_001243793.1. NM_001256864.1.
NP_001243794.1. NM_001256865.1.
NP_055602.1. NM_014787.3.
UniGeneHs.647643.

3D structure databases

ProteinModelPortalO75061.
SMRO75061. Positions 56-402, 733-913.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid115167. 2 interactions.
IntActO75061. 1 interaction.
MINTMINT-2797206.
STRING9606.ENSP00000378735.

PTM databases

PhosphoSiteO75061.

Proteomic databases

PaxDbO75061.
PRIDEO75061.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000263441; ENSP00000263441; ENSG00000116675. [O75061-4]
ENST00000371069; ENSP00000360108; ENSG00000116675. [O75061-2]
ENST00000395325; ENSP00000378735; ENSG00000116675. [O75061-1]
GeneID9829.
KEGGhsa:9829.
UCSCuc001dcc.1. human. [O75061-1]
uc001dce.2. human. [O75061-2]

Organism-specific databases

CTD9829.
GeneCardsGC01P065714.
HGNCHGNC:15469. DNAJC6.
HPAHPA031182.
HPA054917.
MIM608375. gene.
neXtProtNX_O75061.
Orphanet352497. Juvenile parkinsonism with intellectual deficit due to DNAJC6 deficiency.
352504. Levodopa-unresponsive juvenile parkinsonism.
PharmGKBPA27423.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG269956.
HOGENOMHOG000034235.
HOVERGENHBG004322.
KOK09526.
OMALCWQDQK.
OrthoDBEOG7WT40V.
PhylomeDBO75061.
TreeFamTF105165.

Enzyme and pathway databases

ReactomeREACT_11123. Membrane Trafficking.

Gene expression databases

BgeeO75061.
CleanExHS_DNAJC6.
GenevestigatorO75061.

Family and domain databases

Gene3D1.10.287.110. 1 hit.
InterProIPR000008. C2_dom.
IPR001623. DnaJ_domain.
IPR014020. Tensin_C2-dom.
[Graphical view]
PfamPF00226. DnaJ. 1 hit.
PF10409. PTEN_C2. 1 hit.
[Graphical view]
SMARTSM00271. DnaJ. 1 hit.
[Graphical view]
SUPFAMSSF46565. SSF46565. 1 hit.
SSF49562. SSF49562. 1 hit.
PROSITEPS51182. C2_TENSIN. 1 hit.
PS50076. DNAJ_2. 1 hit.
PS51181. PPASE_TENSIN. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiAuxilin.
GenomeRNAi9829.
NextBio37030.
PROO75061.
SOURCESearch...

Entry information

Entry nameAUXI_HUMAN
AccessionPrimary (citable) accession number: O75061
Secondary accession number(s): B7Z3V8 expand/collapse secondary AC list , D3DQ65, D3DQ66, Q32M66, Q4G0K1, Q5T614, Q5T615
Entry history
Integrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: June 27, 2006
Last modified: April 16, 2014
This is version 114 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM