O75061 (AUXI_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 16, 2012.
Version 95.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Putative tyrosine-protein phosphatase auxilin EC=3.1.3.48 Alternative name(s): DnaJ homolog subfamily C member 6 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 913 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Recruits HSPA8/HSC70 to clathrin-coated vesicles and promotes uncoating of clathrin-coated vesicles By similarity. |
| Catalytic activity | Protein tyrosine phosphate + H2O = protein tyrosine + phosphate. |
| Subunit structure | Interacts with HSPA8/HSC70. Interacts with CLTC. Interacts with AP2A2 By similarity. |
| Sequence similarities | Contains 1 C2 tensin-type domain. Contains 1 J domain. Contains 1 phosphatase tensin-type domain. |
| Sequence caution | The sequence BAA32318.2 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat SH3-binding |
| Molecular function | Chaperone Hydrolase Protein phosphatase |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | cellular membrane organization Traceable author statement. Source: Reactome post-Golgi vesicle-mediated transportTraceable author statement. Source: Reactome |
| Cellular component | cytosol Traceable author statement. Source: Reactome |
| Molecular function | SH3 domain binding Inferred from electronic annotation. Source: UniProtKB-KW heat shock protein bindingInferred from electronic annotation. Source: InterPro protein tyrosine phosphatase activityInferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O75061-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O75061-2) The sequence of this isoform differs from the canonical sequence as follows: 1-7: MKDSENK → MSLLGSYRKKTSNDGYESLQLVDSNGDLSAGSGGVGGKQRVNAGAAARSPARQPPDRASTMDSS | ||||||
| Isoform 3 (identifier: O75061-3) The sequence of this isoform differs from the canonical sequence as follows: 1-13: Missing. 456-913: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 913 | 913 | Putative tyrosine-protein phosphatase auxilin | PRO_0000244516 | |||||
Regions | |||||||||
| Repeat | 36 – 39 | 4 | 1 | ||||||
| Repeat | 40 – 43 | 4 | 2 | ||||||
| Repeat | 44 – 47 | 4 | 3 | ||||||
| Domain | 55 – 222 | 168 | Phosphatase tensin-type | ||||||
| Domain | 228 – 366 | 139 | C2 tensin-type | ||||||
| Domain | 849 – 913 | 65 | J | ||||||
| Region | 36 – 47 | 12 | 3 X 4 AA approximate tandem repeats | ||||||
| Motif | 409 – 417 | 9 | SH3-binding Potential | ||||||
| Compositional bias | 466 – 760 | 295 | Pro-rich | ||||||
| Compositional bias | 529 – 532 | 4 | Poly-Gly | ||||||
Sites | |||||||||
| Active site | 164 | 1 | Phosphocysteine intermediate Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 563 | 1 | Phosphoserine Ref.5 | ||||||
| Modified residue | 566 | 1 | Phosphoserine Ref.5 | ||||||
| Modified residue | 567 | 1 | Phosphothreonine Ref.5 | ||||||
| Modified residue | 570 | 1 | Phosphoserine Ref.5 | ||||||
| Modified residue | 572 | 1 | Phosphothreonine Ref.6 | ||||||
| Modified residue | 696 | 1 | Phosphothreonine Ref.6 | ||||||
| Modified residue | 709 | 1 | Phosphoserine Ref.6 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 13 | 13 | Missing in isoform 3. | VSP_019579 | |||||
| Alternative sequence | 1 – 7 | 7 | MKDSENK → MSLLGSYRKKTSNDGYESLQ LVDSNGDLSAGSGGVGGKQR VNAGAAARSPARQPPDRAST MDSS in isoform 2. | VSP_019580 | |||||
| Alternative sequence | 456 – 913 | 458 | Missing in isoform 3. | VSP_019581 | |||||
| Natural variant | 671 | 1 | S → N. Corresponds to variant rs4915691 [ dbSNP | Ensembl ]. | VAR_026908 | |||||
Experimental info | |||||||||
| Sequence conflict | 425 | 1 | F → S in AAH51722. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| [1] | "Characterization of cDNA clones in size-fractionated cDNA libraries from human brain." Seki N., Ohira M., Nagase T., Ishikawa K., Miyajima N., Nakajima D., Nomura N., Ohara O. DNA Res. 4:345-349(1997) [PubMed: 9455484] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed: 16710414] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3). Tissue: Brain. |
| [5] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-563; SER-566; THR-567 AND SER-570, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [6] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-572; THR-696 AND SER-709, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB007942 mRNA. Translation: BAA32318.2. Different initiation. AL139294, AL355487, AC119800 Genomic DNA. Translation: CAI18997.1. AL139294, AL355487, AC119800 Genomic DNA. Translation: CAI18999.1. AL355487, AC119800, AL139294 Genomic DNA. Translation: CAI23547.1. AL355487, AC119800, AL139294 Genomic DNA. Translation: CAI23548.1. CH471059 Genomic DNA. Translation: EAX06533.1. CH471059 Genomic DNA. Translation: EAX06534.1. BC051722 mRNA. Translation: AAH51722.1. BC109279 mRNA. Translation: AAI09280.2. BC109280 mRNA. Translation: AAI09281.2. |
| IPI | IPI00184119. IPI00639806. IPI00760699. |
| RefSeq | NP_001243793.1. NM_001256864.1. NP_055602.1. NM_014787.3. |
| UniGene | Hs.647643. |
3D structure databases | |
| ProteinModelPortal | O75061. |
| SMR | O75061. Positions 56-402, 733-913. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | O75061. |
PTM databases | |
| PhosphoSite | O75061. |
Proteomic databases | |
| PRIDE | O75061. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000395325; ENSP00000378735; ENSG00000116675. |
| GeneID | 9829. |
| KEGG | hsa:9829. |
| UCSC | uc001dcc.1. human. uc001dce.1. human. |
Organism-specific databases | |
| CTD | 9829. |
| GeneCards | GC01P065681. |
| HGNC | HGNC:15469. DNAJC6. |
| HPA | HPA031182. |
| MIM | 608375. gene. |
| neXtProt | NX_O75061. |
| PharmGKB | PA27423. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG269956. |
| GeneTree | ENSGT00620000087779. |
| HOGENOM | HOG000034235. |
| HOVERGEN | HBG004322. |
| KO | K09526. |
| OMA | EDVFHPS. |
| OrthoDB | EOG4T4CTX. |
Enzyme and pathway databases | |
| Reactome | REACT_11123. Membrane Trafficking. |
Gene expression databases | |
| ArrayExpress | O75061. |
| Bgee | O75061. |
| CleanEx | HS_DNAJC6. |
| Genevestigator | O75061. |
| GermOnline | ENSG00000116675. Homo sapiens. |
Family and domain databases | |
| Gene3D | G3DSA:1.10.287.110. DnaJ_N. 1 hit. |
| InterPro | IPR008973. C2_Ca/lipid-bd_dom_CaLB. IPR001623. DnaJ_N. IPR014019. Phosphatase_tensin-typ. IPR014020. Tensin_phosphatase_C2-dom. [Graphical view] |
| Pfam | PF00226. DnaJ. 1 hit. PF10409. PTEN_C2. 1 hit. [Graphical view] |
| SMART | SM00271. DnaJ. 1 hit. [Graphical view] |
| SUPFAM | SSF49562. C2_CaLB. 1 hit. SSF46565. DnaJ_N. 1 hit. |
| PROSITE | PS51182. C2_TENSIN. 1 hit. PS00636. DNAJ_1. False negative. PS50076. DNAJ_2. 1 hit. PS51181. PPASE_TENSIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 37030. |
| SOURCE | Search... |
Entry information
| Entry name | AUXI_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O75061 Secondary accession number(s): D3DQ65 Q5T615 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with