Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Plexin-A2

Gene

PLXNA2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Coreceptor for SEMA3A and SEMA6A. Necessary for signaling by SEMA6A and class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, invasive growth and cell migration. Class 3 semaphorins bind to a complex composed of a neuropilin and a plexin. The plexin modulates the affinity of the complex for specific semaphorins, and its cytoplasmic domain is required for the activation of down-stream signaling events in the cytoplasm (By similarity).By similarity1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

ReactomeiR-HSA-399954. Sema3A PAK dependent Axon repulsion.
R-HSA-399955. SEMA3A-Plexin repulsion signaling by inhibiting Integrin adhesion.
R-HSA-399956. CRMPs in Sema3A signaling.
R-HSA-416700. Other semaphorin interactions.
SignaLinkiO75051.
SIGNORiO75051.

Names & Taxonomyi

Protein namesi
Recommended name:
Plexin-A2
Alternative name(s):
Semaphorin receptor OCT
Gene namesi
Name:PLXNA2
Synonyms:KIAA0463, OCT, PLXN2
ORF Names:UNQ209/PRO235
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:9100. PLXNA2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini35 – 12371203ExtracellularSequence analysisAdd
BLAST
Transmembranei1238 – 125821HelicalSequence analysisAdd
BLAST
Topological domaini1259 – 1894636CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

  • integral component of plasma membrane Source: UniProtKB
  • plasma membrane Source: Reactome
  • semaphorin receptor complex Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA33426.

Polymorphism and mutation databases

BioMutaiPLXNA2.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3434Sequence analysisAdd
BLAST
Chaini35 – 18941860Plexin-A2PRO_0000232747Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi76 – 761N-linked (GlcNAc...)
Glycosylationi91 – 911N-linked (GlcNAc...)Sequence analysis
Disulfide bondi94 ↔ 103PROSITE-ProRule annotation
Disulfide bondi129 ↔ 137PROSITE-ProRule annotation
Disulfide bondi284 ↔ 405PROSITE-ProRule annotation
Disulfide bondi300 ↔ 356PROSITE-ProRule annotation
Glycosylationi327 – 3271N-linked (GlcNAc...)Sequence analysis
Disulfide bondi374 ↔ 393PROSITE-ProRule annotation
Disulfide bondi511 ↔ 528PROSITE-ProRule annotation
Disulfide bondi517 ↔ 559PROSITE-ProRule annotation
Disulfide bondi520 ↔ 537PROSITE-ProRule annotation
Disulfide bondi531 ↔ 543PROSITE-ProRule annotation
Disulfide bondi594 ↔ 613PROSITE-ProRule annotation
Glycosylationi598 – 5981N-linked (GlcNAc...)Sequence analysis
Glycosylationi696 – 6961N-linked (GlcNAc...)Sequence analysis
Glycosylationi756 – 7561N-linked (GlcNAc...)Sequence analysis
Glycosylationi1205 – 12051N-linked (GlcNAc...)Sequence analysis

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

EPDiO75051.
MaxQBiO75051.
PaxDbiO75051.
PRIDEiO75051.

PTM databases

iPTMnetiO75051.
PhosphoSiteiO75051.

Expressioni

Tissue specificityi

Detected in fetal brain.1 Publication

Gene expression databases

BgeeiO75051.
CleanExiHS_PLXNA2.
GenevisibleiO75051. HS.

Organism-specific databases

HPAiCAB009763.

Interactioni

Subunit structurei

Homodimer. The PLXNA2 homodimer interacts with a SEMA6A homodimer, giving rise to a heterotetramer. Interacts directly with NRP1 and NRP2 (By similarity). Interacts with RND1.By similarity1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
FynP396883EBI-308264,EBI-524514From a different organism.

Protein-protein interaction databases

BioGridi111376. 31 interactions.
DIPiDIP-31672N.
IntActiO75051. 10 interactions.
STRINGi9606.ENSP00000356000.

Structurei

Secondary structure

1
1894
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi1499 – 15046Combined sources
Beta strandi1515 – 15206Combined sources
Helixi1525 – 153612Combined sources
Helixi1548 – 15503Combined sources
Beta strandi1551 – 15577Combined sources
Turni1558 – 15603Combined sources
Beta strandi1561 – 15655Combined sources
Beta strandi1567 – 15693Combined sources
Helixi1584 – 15874Combined sources
Beta strandi1594 – 15996Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3Q3JX-ray1.97A1490-1600[»]
ProteinModelPortaliO75051.
SMRiO75051. Positions 36-702, 1273-1890.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO75051.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini35 – 508474SemaPROSITE-ProRule annotationAdd
BLAST
Domaini858 – 95194IPT/TIG 1Add
BLAST
Domaini954 – 103784IPT/TIG 2Add
BLAST
Domaini1041 – 113999IPT/TIG 3Add
BLAST
Domaini1143 – 122886IPT/TIG 4Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili1261 – 131050Sequence analysisAdd
BLAST

Sequence similaritiesi

Belongs to the plexin family.Curated
Contains 4 IPT/TIG domains.Curated
Contains 1 Sema domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IN3A. Eukaryota.
ENOG410ZA1D. LUCA.
GeneTreeiENSGT00760000119048.
HOVERGENiHBG105711.
InParanoidiO75051.
KOiK06820.
OMAiCKDDPKF.
OrthoDBiEOG7Q8CM9.
PhylomeDBiO75051.
TreeFamiTF312962.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
2.60.40.10. 4 hits.
InterProiIPR013783. Ig-like_fold.
IPR014756. Ig_E-set.
IPR002909. IPT.
IPR031148. Plexin.
IPR016201. Plexin-like_fold.
IPR013548. Plexin_cytoplasmic_RasGAP_dom.
IPR002165. Plexin_repeat.
IPR008936. Rho_GTPase_activation_prot.
IPR001627. Semap_dom.
IPR015943. WD40/YVTN_repeat-like_dom.
[Graphical view]
PANTHERiPTHR22625. PTHR22625. 1 hit.
PfamiPF08337. Plexin_cytopl. 1 hit.
PF01437. PSI. 1 hit.
PF01403. Sema. 1 hit.
PF01833. TIG. 4 hits.
[Graphical view]
SMARTiSM00429. IPT. 4 hits.
SM00423. PSI. 3 hits.
SM00630. Sema. 1 hit.
[Graphical view]
SUPFAMiSSF101912. SSF101912. 1 hit.
SSF103575. SSF103575. 2 hits.
SSF48350. SSF48350. 2 hits.
SSF81296. SSF81296. 4 hits.
PROSITEiPS51004. SEMA. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O75051-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEQRRPWPRA LEVDSRSVVL LSVVWVLLAP PAAGMPQFST FHSENRDWTF
60 70 80 90 100
NHLTVHQGTG AVYVGAINRV YKLTGNLTIQ VAHKTGPEED NKSCYPPLIV
110 120 130 140 150
QPCSEVLTLT NNVNKLLIID YSENRLLACG SLYQGVCKLL RLDDLFILVE
160 170 180 190 200
PSHKKEHYLS SVNKTGTMYG VIVRSEGEDG KLFIGTAVDG KQDYFPTLSS
210 220 230 240 250
RKLPRDPESS AMLDYELHSD FVSSLIKIPS DTLALVSHFD IFYIYGFASG
260 270 280 290 300
GFVYFLTVQP ETPEGVAINS AGDLFYTSRI VRLCKDDPKF HSYVSLPFGC
310 320 330 340 350
TRAGVEYRLL QAAYLAKPGD SLAQAFNITS QDDVLFAIFS KGQKQYHHPP
360 370 380 390 400
DDSALCAFPI RAINLQIKER LQSCYQGEGN LELNWLLGKD VQCTKAPVPI
410 420 430 440 450
DDNFCGLDIN QPLGGSTPVE GLTLYTTSRD RMTSVASYVY NGYSVVFVGT
460 470 480 490 500
KSGKLKKIRA DGPPHGGVQY EMVSVLKDGS PILRDMAFSI DQRYLYVMSE
510 520 530 540 550
RQVTRVPVES CEQYTTCGEC LSSGDPHCGW CALHNMCSRR DKCQQAWEPN
560 570 580 590 600
RFAASISQCV SLAVHPSSIS VSEHSRLLSL VVSDAPDLSA GIACAFGNLT
610 620 630 640 650
EVEGQVSGSQ VICISPGPKD VPVIPLDQDW FGLELQLRSK ETGKIFVSTE
660 670 680 690 700
FKFYNCSAHQ LCLSCVNSAF RCHWCKYRNL CTHDPTTCSF QEGRINISED
710 720 730 740 750
CPQLVPTEEI LIPVGEVKPI TLKARNLPQP QSGQRGYECV LNIQGAIHRV
760 770 780 790 800
PALRFNSSSV QCQNSSYQYD GMDISNLAVD FAVVWNGNFI IDNPQDLKVH
810 820 830 840 850
LYKCAAQRES CGLCLKADRK FECGWCSGER RCTLHQHCTS PSSPWLDWSS
860 870 880 890 900
HNVKCSNPQI TEILTVSGPP EGGTRVTIHG VNLGLDFSEI AHHVQVAGVP
910 920 930 940 950
CTPLPGEYII AEQIVCEMGH ALVGTTSGPV RLCIGECKPE FMTKSHQQYT
960 970 980 990 1000
FVNPSVLSLN PIRGPESGGT MVTITGHYLG AGSSVAVYLG NQTCEFYGRS
1010 1020 1030 1040 1050
MSEIVCVSPP SSNGLGPVPV SVSVDRAHVD SNLQFEYIDD PRVQRIEPEW
1060 1070 1080 1090 1100
SIASGHTPLT ITGFNLDVIQ EPRIRVKFNG KESVNVCKVV NTTTLTCLAP
1110 1120 1130 1140 1150
SLTTDYRPGL DTVERPDEFG FVFNNVQSLL IYNDTKFIYY PNPTFELLSP
1160 1170 1180 1190 1200
TGVLDQKPGS PIILKGKNLC PPASGGAKLN YTVLIGETPC AVTVSETQLL
1210 1220 1230 1240 1250
CEPPNLTGQH KVMVHVGGMV FSPGSVSVIS DSLLTLPAIV SIAAGGSLLL
1260 1270 1280 1290 1300
IIVIIVLIAY KRKSRENDLT LKRLQMQMDN LESRVALECK EAFAELQTDI
1310 1320 1330 1340 1350
NELTSDLDRS GIPYLDYRTY AMRVLFPGIE DHPVLRELEV QGNGQQHVEK
1360 1370 1380 1390 1400
ALKLFAQLIN NKVFLLTFIR TLELQRSFSM RDRGNVASLI MTGLQGRLEY
1410 1420 1430 1440 1450
ATDVLKQLLS DLIDKNLENK NHPKLLLRRT ESVAEKMLTN WFAFLLHKFL
1460 1470 1480 1490 1500
KECAGEPLFM LYCAIKQQME KGPIDAITGE ARYSLSEDKL IRQQIEYKTL
1510 1520 1530 1540 1550
ILNCVNPDNE NSPEIPVKVL NCDTITQVKE KILDAVYKNV PYSQRPRAVD
1560 1570 1580 1590 1600
MDLEWRQGRI ARVVLQDEDI TTKIEGDWKR LNTLMHYQVS DRSVVALVPK
1610 1620 1630 1640 1650
QTSSYNIPAS ASISRTSISR YDSSFRYTGS PDSLRSRAPM ITPDLESGVK
1660 1670 1680 1690 1700
VWHLVKNHDH GDQKEGDRGS KMVSEIYLTR LLATKGTLQK FVDDLFETLF
1710 1720 1730 1740 1750
STVHRGSALP LAIKYMFDFL DEQADRHSIH DTDVRHTWKS NCLPLRFWVN
1760 1770 1780 1790 1800
VIKNPQFVFD IHKGSITDAC LSVVAQTFMD SCSTSEHRLG KDSPSNKLLY
1810 1820 1830 1840 1850
AKDIPSYKSW VERYYADIAK LPAISDQDMN AYLAEQSRLH AVEFNMLSAL
1860 1870 1880 1890
NEIYSYVSKY SEELIGALEQ DEQARRQRLA YKVEQLINAM SIES
Length:1,894
Mass (Da):211,104
Last modified:July 7, 2009 - v4
Checksum:iDFC3DE5BCBB40357
GO
Isoform 2 (identifier: O75051-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGTLGQASLFAPPGNYFWSDHSALCFAESCEGQPGKVEQMSTHRSRLLTAAPLSM
     458-498: IRADGPPHGG...SIDQRYLYVM → VRVYEFRCSN...RQLYFLGEQR
     499-1894: Missing.

Show »
Length:552
Mass (Da):61,649
Checksum:i43B65B3D2C7599BA
GO

Sequence cautioni

The sequence BAA32308.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti94 – 941C → R in AAQ88860 (PubMed:12975309).Curated
Sequence conflicti599 – 5991L → P in CAB57275 (PubMed:8570614).Curated
Sequence conflicti661 – 6611L → P in CAB57275 (PubMed:8570614).Curated
Sequence conflicti1085 – 10851N → V in AAH09343 (PubMed:15489334).Curated
Sequence conflicti1378 – 13781F → L in CAB57275 (PubMed:8570614).Curated
Sequence conflicti1700 – 17001F → L in AAH09343 (PubMed:15489334).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti5 – 51R → Q.1 Publication
Corresponds to variant rs2782948 [ dbSNP | Ensembl ].
VAR_056722
Natural varianti57 – 571Q → R.
Corresponds to variant rs11119014 [ dbSNP | Ensembl ].
VAR_059554
Natural varianti267 – 2671A → T.
Corresponds to variant rs3748735 [ dbSNP | Ensembl ].
VAR_059555
Natural varianti369 – 3691E → G.2 Publications
Corresponds to variant rs4844658 [ dbSNP | Ensembl ].
VAR_058201
Natural varianti805 – 8051A → G.
Corresponds to variant rs17011882 [ dbSNP | Ensembl ].
VAR_059556
Natural varianti1443 – 14431A → T.
Corresponds to variant rs12240051 [ dbSNP | Ensembl ].
VAR_059557

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MGTLGQASLFAPPGNYFWSD HSALCFAESCEGQPGKVEQM STHRSRLLTAAPLSM in isoform 2. 1 PublicationVSP_017967
Alternative sequencei458 – 49841IRADG…YLYVM → VRVYEFRCSNAIHLLSKESL LEGSYWWRFNYRQLYFLGEQ R in isoform 2. 1 PublicationVSP_017968Add
BLAST
Alternative sequencei499 – 18941396Missing in isoform 2. 1 PublicationVSP_017969Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB007932 mRNA. Translation: BAA32308.1. Different initiation.
AY358496 mRNA. Translation: AAQ88860.1.
AL590138, AL356275 Genomic DNA. Translation: CAI39808.1.
AL356275, AL590138 Genomic DNA. Translation: CAI40198.1.
BC006193 mRNA. Translation: AAH06193.2.
BC009343 mRNA. Translation: AAH09343.2.
BC132676 mRNA. Translation: AAI32677.2.
BC136530 mRNA. Translation: AAI36531.1.
X87831 mRNA. Translation: CAB57275.1.
CCDSiCCDS31013.1. [O75051-1]
RefSeqiNP_079455.3. NM_025179.3. [O75051-1]
UniGeneiHs.497626.

Genome annotation databases

EnsembliENST00000367033; ENSP00000356000; ENSG00000076356. [O75051-1]
GeneIDi5362.
KEGGihsa:5362.
UCSCiuc001hgz.4. human. [O75051-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB007932 mRNA. Translation: BAA32308.1. Different initiation.
AY358496 mRNA. Translation: AAQ88860.1.
AL590138, AL356275 Genomic DNA. Translation: CAI39808.1.
AL356275, AL590138 Genomic DNA. Translation: CAI40198.1.
BC006193 mRNA. Translation: AAH06193.2.
BC009343 mRNA. Translation: AAH09343.2.
BC132676 mRNA. Translation: AAI32677.2.
BC136530 mRNA. Translation: AAI36531.1.
X87831 mRNA. Translation: CAB57275.1.
CCDSiCCDS31013.1. [O75051-1]
RefSeqiNP_079455.3. NM_025179.3. [O75051-1]
UniGeneiHs.497626.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3Q3JX-ray1.97A1490-1600[»]
ProteinModelPortaliO75051.
SMRiO75051. Positions 36-702, 1273-1890.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111376. 31 interactions.
DIPiDIP-31672N.
IntActiO75051. 10 interactions.
STRINGi9606.ENSP00000356000.

PTM databases

iPTMnetiO75051.
PhosphoSiteiO75051.

Polymorphism and mutation databases

BioMutaiPLXNA2.

Proteomic databases

EPDiO75051.
MaxQBiO75051.
PaxDbiO75051.
PRIDEiO75051.

Protocols and materials databases

DNASUi5362.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000367033; ENSP00000356000; ENSG00000076356. [O75051-1]
GeneIDi5362.
KEGGihsa:5362.
UCSCiuc001hgz.4. human. [O75051-1]

Organism-specific databases

CTDi5362.
GeneCardsiPLXNA2.
HGNCiHGNC:9100. PLXNA2.
HPAiCAB009763.
MIMi601054. gene.
neXtProtiNX_O75051.
PharmGKBiPA33426.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IN3A. Eukaryota.
ENOG410ZA1D. LUCA.
GeneTreeiENSGT00760000119048.
HOVERGENiHBG105711.
InParanoidiO75051.
KOiK06820.
OMAiCKDDPKF.
OrthoDBiEOG7Q8CM9.
PhylomeDBiO75051.
TreeFamiTF312962.

Enzyme and pathway databases

ReactomeiR-HSA-399954. Sema3A PAK dependent Axon repulsion.
R-HSA-399955. SEMA3A-Plexin repulsion signaling by inhibiting Integrin adhesion.
R-HSA-399956. CRMPs in Sema3A signaling.
R-HSA-416700. Other semaphorin interactions.
SignaLinkiO75051.
SIGNORiO75051.

Miscellaneous databases

ChiTaRSiPLXNA2. human.
EvolutionaryTraceiO75051.
GeneWikiiPLXNA2.
GenomeRNAii5362.
PROiO75051.
SOURCEiSearch...

Gene expression databases

BgeeiO75051.
CleanExiHS_PLXNA2.
GenevisibleiO75051. HS.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
2.60.40.10. 4 hits.
InterProiIPR013783. Ig-like_fold.
IPR014756. Ig_E-set.
IPR002909. IPT.
IPR031148. Plexin.
IPR016201. Plexin-like_fold.
IPR013548. Plexin_cytoplasmic_RasGAP_dom.
IPR002165. Plexin_repeat.
IPR008936. Rho_GTPase_activation_prot.
IPR001627. Semap_dom.
IPR015943. WD40/YVTN_repeat-like_dom.
[Graphical view]
PANTHERiPTHR22625. PTHR22625. 1 hit.
PfamiPF08337. Plexin_cytopl. 1 hit.
PF01437. PSI. 1 hit.
PF01403. Sema. 1 hit.
PF01833. TIG. 4 hits.
[Graphical view]
SMARTiSM00429. IPT. 4 hits.
SM00423. PSI. 3 hits.
SM00630. Sema. 1 hit.
[Graphical view]
SUPFAMiSSF101912. SSF101912. 1 hit.
SSF103575. SSF103575. 2 hits.
SSF48350. SSF48350. 2 hits.
SSF81296. SSF81296. 4 hits.
PROSITEiPS51004. SEMA. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Characterization of cDNA clones in size-fractionated cDNA libraries from human brain."
    Seki N., Ohira M., Nagase T., Ishikawa K., Miyajima N., Nakajima D., Nomura N., Ohara O.
    DNA Res. 4:345-349(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT GLY-369.
    Tissue: Brain.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT GLN-5.
  3. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT GLY-369.
    Tissue: Brain and Placenta.
  5. "A family of transmembrane proteins with homology to the MET-hepatocyte growth factor receptor."
    Maestrini E., Tamagnone L., Longati P., Cremona O., Gulisano M., Bione S., Tamanini F., Neel B.G., Toniolo D., Comoglio P.M.
    Proc. Natl. Acad. Sci. U.S.A. 93:674-678(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 447-1774 (ISOFORM 1), TISSUE SPECIFICITY.
    Tissue: Skeletal muscle.
  6. "Plexins are a large family of receptors for transmembrane, secreted and GPI-anchored semaphorins in vertebrates."
    Tamagnone L., Artigiani S., Chen H., He Z., Ming G.-L., Song H.-L., Chedotal A., Winberg M.L., Goodman C.S., Poo M.-M., Tessier-Lavigne M., Comoglio P.M.
    Cell 99:71-80(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  7. "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
    Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
    J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-91.
    Tissue: Liver.
  8. "Crystal structure of plexin A2 RBD in complex with RND1."
    Structural genomics consortium (SGC)
    Submitted (JAN-2011) to the PDB data bank
    Cited for: X-RAY CRYSTALLOGRAPHY (1.97 ANGSTROMS) OF 1490-1600 IN COMPLEX WITH RND1.

Entry informationi

Entry nameiPLXA2_HUMAN
AccessioniPrimary (citable) accession number: O75051
Secondary accession number(s): A2RTX9
, B2RMX7, Q6UX61, Q96GN9, Q9BRL1, Q9UIW1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 18, 2006
Last sequence update: July 7, 2009
Last modified: June 8, 2016
This is version 126 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.