Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O75038

- PLCH2_HUMAN

UniProt

O75038 - PLCH2_HUMAN

Protein

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2

Gene

PLCH2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 115 (01 Oct 2014)
      Sequence version 3 (13 Nov 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. This phospholipase activity is very sensitive to calcium. May be important for formation and maintenance of the neuronal network in the postnatal brain By similarity.By similarity

    Catalytic activityi

    1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol.

    Cofactori

    Calcium.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei341 – 3411PROSITE-ProRule annotation
    Metal bindingi342 – 3421Calcium 1; catalyticBy similarity
    Metal bindingi371 – 3711Calcium 1; catalyticBy similarity
    Metal bindingi373 – 3731Calcium 1; catalyticBy similarity
    Active sitei385 – 3851PROSITE-ProRule annotation
    Metal bindingi420 – 4201Calcium 1; catalyticBy similarity
    Binding sitei469 – 4691SubstrateBy similarity
    Binding sitei471 – 4711SubstrateBy similarity
    Binding sitei653 – 6531SubstrateBy similarity
    Binding sitei680 – 6801SubstrateBy similarity
    Metal bindingi784 – 7841Calcium 2; via carbonyl oxygenBy similarity
    Metal bindingi786 – 7861Calcium 2By similarity
    Metal bindingi810 – 8101Calcium 2By similarity
    Metal bindingi839 – 8391Calcium 3By similarity
    Metal bindingi840 – 8401Calcium 3; via carbonyl oxygenBy similarity
    Metal bindingi841 – 8411Calcium 3By similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Calcium bindingi182 – 19312PROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. calcium ion binding Source: InterPro
    2. phosphatidylinositol phospholipase C activity Source: UniProtKB-EC
    3. signal transducer activity Source: UniProtKB-KW

    GO - Biological processi

    1. inositol phosphate metabolic process Source: Reactome
    2. intracellular signal transduction Source: InterPro
    3. lipid catabolic process Source: UniProtKB-KW
    4. phosphatidylinositol metabolic process Source: Ensembl
    5. small molecule metabolic process Source: Reactome

    Keywords - Molecular functioni

    Hydrolase, Transducer

    Keywords - Biological processi

    Lipid degradation, Lipid metabolism

    Keywords - Ligandi

    Calcium, Metal-binding

    Enzyme and pathway databases

    ReactomeiREACT_150312. Synthesis of IP3 and IP4 in the cytosol.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 (EC:3.1.4.11)
    Alternative name(s):
    Phosphoinositide phospholipase C-eta-2
    Phosphoinositide phospholipase C-like 4
    Short name:
    PLC-L4
    Short name:
    Phospholipase C-like protein 4
    Phospholipase C-eta-2
    Short name:
    PLC-eta2
    Gene namesi
    Name:PLCH2
    Synonyms:KIAA0450, PLCL4
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:29037. PLCH2.

    Subcellular locationi

    Cytoplasm. Cell membrane
    Note: Localized predominantly at the plasma membrane.By similarity

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell
    2. plasma membrane Source: Reactome

    Keywords - Cellular componenti

    Cell membrane, Cytoplasm, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134914471.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 141614161-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2PRO_0000088507Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei595 – 5951PhosphoserineBy similarity
    Modified residuei605 – 6051PhosphoserineBy similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    PaxDbiO75038.
    PRIDEiO75038.

    PTM databases

    PhosphoSiteiO75038.

    Expressioni

    Tissue specificityi

    Expressed in retina and kidney.1 Publication

    Gene expression databases

    ArrayExpressiO75038.
    BgeeiO75038.
    CleanExiHS_PLCH2.
    GenevestigatoriO75038.

    Organism-specific databases

    HPAiHPA003346.

    Interactioni

    Protein-protein interaction databases

    BioGridi115009. 1 interaction.
    STRINGi9606.ENSP00000367747.

    Structurei

    3D structure databases

    ProteinModelPortaliO75038.
    SMRiO75038. Positions 46-494, 626-883.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini47 – 155109PHPROSITE-ProRule annotationAdd
    BLAST
    Domaini169 – 20436EF-hand 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini205 – 24137EF-hand 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini326 – 471146PI-PLC X-boxPROSITE-ProRule annotationAdd
    BLAST
    Domaini626 – 740115PI-PLC Y-boxPROSITE-ProRule annotationAdd
    BLAST
    Domaini745 – 852108C2PROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1 – 155155Necessary for plasma membrane localizationBy similarityAdd
    BLAST

    Sequence similaritiesi

    Contains 1 C2 domain.PROSITE-ProRule annotation
    Contains 2 EF-hand domains.PROSITE-ProRule annotation
    Contains 1 PH domain.PROSITE-ProRule annotation
    Contains 1 PI-PLC X-box domain.PROSITE-ProRule annotation
    Contains 1 PI-PLC Y-box domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat

    Phylogenomic databases

    eggNOGiNOG149692.
    HOVERGENiHBG107105.
    InParanoidiO75038.
    OMAiCSLETIT.
    OrthoDBiEOG7PGDQ0.
    PhylomeDBiO75038.
    TreeFamiTF313216.

    Family and domain databases

    Gene3Di1.10.238.10. 3 hits.
    2.30.29.30. 1 hit.
    2.60.40.150. 1 hit.
    3.20.20.190. 2 hits.
    InterProiIPR000008. C2_dom.
    IPR011992. EF-hand-dom_pair.
    IPR018247. EF_Hand_1_Ca_BS.
    IPR002048. EF_hand_dom.
    IPR001849. PH_domain.
    IPR011993. PH_like_dom.
    IPR001192. PI-PLC_fam.
    IPR028393. PLC-eta2.
    IPR017946. PLC-like_Pdiesterase_TIM-brl.
    IPR015359. PLipase_C_EF-hand-like.
    IPR000909. PLipase_C_PInositol-sp_X_dom.
    IPR001711. PLipase_C_Pinositol-sp_Y.
    [Graphical view]
    PANTHERiPTHR10336. PTHR10336. 1 hit.
    PTHR10336:SF21. PTHR10336:SF21. 1 hit.
    PfamiPF00168. C2. 1 hit.
    PF13499. EF-hand_7. 1 hit.
    PF09279. EF-hand_like. 1 hit.
    PF00388. PI-PLC-X. 1 hit.
    PF00387. PI-PLC-Y. 1 hit.
    [Graphical view]
    PRINTSiPR00390. PHPHLIPASEC.
    SMARTiSM00239. C2. 1 hit.
    SM00054. EFh. 2 hits.
    SM00233. PH. 1 hit.
    SM00148. PLCXc. 1 hit.
    SM00149. PLCYc. 1 hit.
    [Graphical view]
    SUPFAMiSSF49562. SSF49562. 1 hit.
    SSF51695. SSF51695. 2 hits.
    PROSITEiPS50004. C2. 1 hit.
    PS00018. EF_HAND_1. 1 hit.
    PS50222. EF_HAND_2. 2 hits.
    PS50003. PH_DOMAIN. 1 hit.
    PS50007. PIPLC_X_DOMAIN. 1 hit.
    PS50008. PIPLC_Y_DOMAIN. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O75038-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSGPWPSPDS RTKGTVAWLA EVLLWVGGSV VLSSEWQLGP LVERCMGAMQ     50
    EGMQMVKLRG GSKGLVRFYY LDEHRSCIRW RPSRKNEKAK ISIDSIQEVS 100
    EGRQSEVFQR YPDGSFDPNC CFSIYHGSHR ESLDLVSTSS EVARTWVTGL 150
    RYLMAGISDE DSLARRQRTR DQWLKQTFDE ADKNGDGSLS IGEVLQLLHK 200
    LNVNLPRQRV KQMFREADTD DHQGTLGFEE FCAFYKMMST RRDLYLLMLT 250
    YSNHKDHLDA ASLQRFLQVE QKMAGVTLES CQDIIEQFEP CPENKSKGLL 300
    GIDGFTNYTR SPAGDIFNPE HHHVHQDMTQ PLSHYFITSS HNTYLVGDQL 350
    MSQSRVDMYA WVLQAGCRCV EVDCWDGPDG EPIVHHGYTL TSKILFKDVI 400
    ETINKYAFIK NEYPVILSIE NHCSVIQQKK MAQYLTDILG DKLDLSSVSS 450
    EDATTLPSPQ MLKGKILVKG KKLPANISED AEEGEVSDED SADEIDDDCK 500
    LLNGDASTNR KRVENTAKRK LDSLIKESKI RDCEDPNNFS VSTLSPSGKL 550
    GRKSKAEEDV ESGEDAGASR RNGRLVVGSF SRRKKKGSKL KKAASVEEGD 600
    EGQDSPGGQS RGATRQKKTM KLSRALSDLV KYTKSVATHD IEMEAASSWQ 650
    VSSFSETKAH QILQQKPAQY LRFNQQQLSR IYPSSYRVDS SNYNPQPFWN 700
    AGCQMVALNY QSEGRMLQLN RAKFSANGGC GYVLKPGCMC QGVFNPNSED 750
    PLPGQLKKQL VLRIISGQQL PKPRDSMLGD RGEIIDPFVE VEIIGLPVDC 800
    SREQTRVVDD NGFNPTWEET LVFMVHMPEI ALVRFLVWDH DPIGRDFIGQ 850
    RTLAFSSMMP GYRHVYLEGM EEASIFVHVA VSDISGKVKQ ALGLKGLFLR 900
    GPKPGSLDSH AAGRPPARPS VSQRILRRTA SAPTKSQKPG RRGFPELVLG 950
    TRDTGSKGVA DDVVPPGPGP APEAPAQEGP GSGSPRDTRP LSTQRPLPPL 1000
    CSLETIAEEP APGPGPPPPA AVPTSSSQGR PPYPTGPGAN VASPLEDTEE 1050
    PRDSRPRPCN GEGAGGAYER APGSQTDGRS QPRTLGHLPV IRRVKSEGQV 1100
    PTEPLGGWRP LAAPFPAPAV YSDATGSDPL WQRLEPCGHR DSVSSSSSMS 1150
    SSDTVIDLSL PSLGLGRSRE NLAGAHMGRL PPRPHSASAA RPDLPPVTKS 1200
    KSNPNLRATG QRPPIPDELQ PRSLAPRMAG LPFRPPWGCL SLVGVQDCPV 1250
    AAKSKSLGDL TADDFAPSFE GGSRRLSHSL GLPGGTRRVS GPGVRRDTLT 1300
    EQLRWLTVFQ QAGDITSPTS LGPAGEGVAG GPGFVRRSSS RSHSRVRAIA 1350
    SRARQAQERQ QRLQGLGRQG PPEEERGTPE GACSVGHEGS VDAPAPSKGA 1400
    LGPASAAAEN LVLLRL 1416
    Length:1,416
    Mass (Da):154,668
    Last modified:November 13, 2007 - v3
    Checksum:i05088ACD9C45AE87
    GO
    Isoform 2 (identifier: O75038-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-41: MSGPWPSPDSRTKGTVAWLAEVLLWVGGSVVLSSEWQLGPL → MEEPGPPGGLSQDQ
         987-1156: DTRPLSTQRP...SSMSSSDTVI → GKAPAAVAEK...KSPMFSAVRN
         1157-1416: Missing.

    Show »
    Length:1,129
    Mass (Da):124,302
    Checksum:iAE28DDFBEE739B2A
    GO
    Isoform 3 (identifier: O75038-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         706-741: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:1,380
    Mass (Da):150,778
    Checksum:i7828287338AF8201
    GO
    Isoform 4 (identifier: O75038-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         987-1211: DTRPLSTQRP...SNPNLRATGQ → GKAPAAVAEK...TLLPWLACGP
         1212-1416: Missing.

    Note: No experimental confirmation available.Curated

    Show »
    Length:1,211
    Mass (Da):132,836
    Checksum:i1472D389D2CF4707
    GO
    Isoform 5 (identifier: O75038-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-45: Missing.
         117-785: Missing.
         987-1211: DTRPLSTQRP...SNPNLRATGQ → GKAPAAVAEK...TLLPWLACGP
         1212-1416: Missing.

    Note: No experimental confirmation available.Curated

    Show »
    Length:497
    Mass (Da):52,942
    Checksum:i843420D08D2C3A9F
    GO

    Sequence cautioni

    The sequence AAH43358.1 differs from that shown. Reason: Frameshift at position 172.
    The sequence BAA32295.3 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence BAC56932.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti559 – 5591D → E in BAB84975. 1 PublicationCurated
    Sequence conflicti560 – 5601V → M in BAB84975. 1 PublicationCurated
    Isoform 5 (identifier: O75038-5)
    Sequence conflicti209 – 2091Q → L in BAC56932. 1 PublicationCurated
    Isoform 4 (identifier: O75038-4)
    Sequence conflicti1004 – 10041P → L in BAB84975. 1 PublicationCurated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 4545Missing in isoform 5. 1 PublicationVSP_029067Add
    BLAST
    Alternative sequencei1 – 4141MSGPW…QLGPL → MEEPGPPGGLSQDQ in isoform 2. 1 PublicationVSP_029068Add
    BLAST
    Alternative sequencei117 – 785669Missing in isoform 5. 1 PublicationVSP_029069Add
    BLAST
    Alternative sequencei706 – 74136Missing in isoform 3. 1 PublicationVSP_029070Add
    BLAST
    Alternative sequencei987 – 1211225DTRPL…RATGQ → GKAPAAVAEKSPVRVRPPRV LDGPGPAGMAATCMKCVVGS CAGVNTGGLQRERPPSPGPA SRQAAIRQQPRARADSLGAP CCGLDPHAIPGRSREAPKGP GAWRQGPGGSGSMSSDSSSP DSPGIPERSPRWPEGACRQP GALQGEMSALFAQKLEEIRS KSPMFSAGKPLLPCVVLPHA PGMAGPGSPAAASAWTVSPR VLVLVALYPWHCLRGTLLPW LACGP in isoform 4 and isoform 5. 1 PublicationVSP_029071Add
    BLAST
    Alternative sequencei987 – 1156170DTRPL…SDTVI → GKAPAAVAEKSPVRVRPPRV LDGPGPAGMAATCMKCVVGS CAGVNTGGLQRERPPSPGPA SRQAAIRQQPRARADSLGAP CCGLDPHAIPGRSREAPKGP GAWRQGPGGSGSMSSDSSSP DSPGIPERSPRWPEGACRQP GALQGEMSALFAQKLEEIRS KSPMFSAVRN in isoform 2. 1 PublicationVSP_029072Add
    BLAST
    Alternative sequencei1157 – 1416260Missing in isoform 2. 1 PublicationVSP_029073Add
    BLAST
    Alternative sequencei1212 – 1416205Missing in isoform 4 and isoform 5. 1 PublicationVSP_029074Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    DQ176850 mRNA. Translation: ABA12209.1.
    AK074149 mRNA. Translation: BAB84975.1.
    AK122591 mRNA. Translation: BAC56932.2. Different initiation.
    AB007919 mRNA. Translation: BAA32295.3. Different initiation.
    AL139246 Genomic DNA. Translation: CAX30815.1.
    BC019679 mRNA. Translation: AAH19679.1.
    BC043358 mRNA. Translation: AAH43358.1. Frameshift.
    BC050037 mRNA. Translation: AAH50037.1.
    BC128207 mRNA. Translation: AAI28208.1.
    CCDSiCCDS59959.1. [O75038-1]
    RefSeqiNP_055453.2. NM_014638.2. [O75038-1]
    XP_006711118.1. XM_006711055.1. [O75038-2]
    XP_006725014.1. XM_006724951.1. [O75038-2]
    UniGeneiHs.170156.

    Genome annotation databases

    EnsembliENST00000378486; ENSP00000367747; ENSG00000149527. [O75038-1]
    ENST00000419816; ENSP00000389803; ENSG00000149527. [O75038-1]
    ENST00000449969; ENSP00000397289; ENSG00000149527. [O75038-2]
    GeneIDi9651.
    KEGGihsa:9651.
    UCSCiuc001aji.1. human. [O75038-1]
    uc001ajj.1. human. [O75038-2]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    DQ176850 mRNA. Translation: ABA12209.1 .
    AK074149 mRNA. Translation: BAB84975.1 .
    AK122591 mRNA. Translation: BAC56932.2 . Different initiation.
    AB007919 mRNA. Translation: BAA32295.3 . Different initiation.
    AL139246 Genomic DNA. Translation: CAX30815.1 .
    BC019679 mRNA. Translation: AAH19679.1 .
    BC043358 mRNA. Translation: AAH43358.1 . Frameshift.
    BC050037 mRNA. Translation: AAH50037.1 .
    BC128207 mRNA. Translation: AAI28208.1 .
    CCDSi CCDS59959.1. [O75038-1 ]
    RefSeqi NP_055453.2. NM_014638.2. [O75038-1 ]
    XP_006711118.1. XM_006711055.1. [O75038-2 ]
    XP_006725014.1. XM_006724951.1. [O75038-2 ]
    UniGenei Hs.170156.

    3D structure databases

    ProteinModelPortali O75038.
    SMRi O75038. Positions 46-494, 626-883.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 115009. 1 interaction.
    STRINGi 9606.ENSP00000367747.

    PTM databases

    PhosphoSitei O75038.

    Proteomic databases

    PaxDbi O75038.
    PRIDEi O75038.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000378486 ; ENSP00000367747 ; ENSG00000149527 . [O75038-1 ]
    ENST00000419816 ; ENSP00000389803 ; ENSG00000149527 . [O75038-1 ]
    ENST00000449969 ; ENSP00000397289 ; ENSG00000149527 . [O75038-2 ]
    GeneIDi 9651.
    KEGGi hsa:9651.
    UCSCi uc001aji.1. human. [O75038-1 ]
    uc001ajj.1. human. [O75038-2 ]

    Organism-specific databases

    CTDi 9651.
    GeneCardsi GC01P002397.
    H-InvDB HIX0000057.
    HGNCi HGNC:29037. PLCH2.
    HPAi HPA003346.
    MIMi 612836. gene.
    neXtProti NX_O75038.
    PharmGKBi PA134914471.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG149692.
    HOVERGENi HBG107105.
    InParanoidi O75038.
    OMAi CSLETIT.
    OrthoDBi EOG7PGDQ0.
    PhylomeDBi O75038.
    TreeFami TF313216.

    Enzyme and pathway databases

    Reactomei REACT_150312. Synthesis of IP3 and IP4 in the cytosol.

    Miscellaneous databases

    GenomeRNAii 9651.
    NextBioi 36229.
    PROi O75038.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O75038.
    Bgeei O75038.
    CleanExi HS_PLCH2.
    Genevestigatori O75038.

    Family and domain databases

    Gene3Di 1.10.238.10. 3 hits.
    2.30.29.30. 1 hit.
    2.60.40.150. 1 hit.
    3.20.20.190. 2 hits.
    InterProi IPR000008. C2_dom.
    IPR011992. EF-hand-dom_pair.
    IPR018247. EF_Hand_1_Ca_BS.
    IPR002048. EF_hand_dom.
    IPR001849. PH_domain.
    IPR011993. PH_like_dom.
    IPR001192. PI-PLC_fam.
    IPR028393. PLC-eta2.
    IPR017946. PLC-like_Pdiesterase_TIM-brl.
    IPR015359. PLipase_C_EF-hand-like.
    IPR000909. PLipase_C_PInositol-sp_X_dom.
    IPR001711. PLipase_C_Pinositol-sp_Y.
    [Graphical view ]
    PANTHERi PTHR10336. PTHR10336. 1 hit.
    PTHR10336:SF21. PTHR10336:SF21. 1 hit.
    Pfami PF00168. C2. 1 hit.
    PF13499. EF-hand_7. 1 hit.
    PF09279. EF-hand_like. 1 hit.
    PF00388. PI-PLC-X. 1 hit.
    PF00387. PI-PLC-Y. 1 hit.
    [Graphical view ]
    PRINTSi PR00390. PHPHLIPASEC.
    SMARTi SM00239. C2. 1 hit.
    SM00054. EFh. 2 hits.
    SM00233. PH. 1 hit.
    SM00148. PLCXc. 1 hit.
    SM00149. PLCYc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF49562. SSF49562. 1 hit.
    SSF51695. SSF51695. 2 hits.
    PROSITEi PS50004. C2. 1 hit.
    PS00018. EF_HAND_1. 1 hit.
    PS50222. EF_HAND_2. 2 hits.
    PS50003. PH_DOMAIN. 1 hit.
    PS50007. PIPLC_X_DOMAIN. 1 hit.
    PS50008. PIPLC_Y_DOMAIN. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning and characterization of PLC-eta2."
      Zhou Y., Wing M.R., Sondek J., Harden T.K.
      Biochem. J. 391:667-676(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
    2. "The nucleotide sequence of a long cDNA clone isolated from human spleen."
      Jikuya H., Takano J., Nomura N., Kikuno R., Nagase T., Ohara O.
      Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 556-1403 (ISOFORM 4).
      Tissue: Spleen.
    3. "Characterization of cDNA clones in size-fractionated cDNA libraries from human brain."
      Seki N., Ohira M., Nagase T., Ishikawa K., Miyajima N., Nakajima D., Nomura N., Ohara O.
      DNA Res. 4:345-349(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Brain.
    4. Seki N., Ohira M., Nagase T., Ishikawa K., Miyajima N., Nakajima D., Nomura N., Ohara O.
      Submitted (JAN-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: SEQUENCE REVISION.
    5. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 116-1416 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 143-1416 (ISOFORM 3).
      Tissue: Brain, Pancreas and Skin.

    Entry informationi

    Entry nameiPLCH2_HUMAN
    AccessioniPrimary (citable) accession number: O75038
    Secondary accession number(s): A2VCM3
    , B9DI80, Q3LUA8, Q86XJ2, Q86XU1, Q86YU7, Q8TEH5, Q8WUS6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 21, 2001
    Last sequence update: November 13, 2007
    Last modified: October 1, 2014
    This is version 115 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3