Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O75038 (PLCH2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 113. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2

EC=3.1.4.11
Alternative name(s):
Phosphoinositide phospholipase C-eta-2
Phosphoinositide phospholipase C-like 4
Short name=PLC-L4
Short name=Phospholipase C-like protein 4
Phospholipase C-eta-2
Short name=PLC-eta2
Gene names
Name:PLCH2
Synonyms:KIAA0450, PLCL4
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1416 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. This phospholipase activity is very sensitive to calcium. May be important for formation and maintenance of the neuronal network in the postnatal brain By similarity.

Catalytic activity

1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol.

Cofactor

Calcium By similarity.

Subcellular location

Cytoplasm. Cell membrane. Note: Localized predominantly at the plasma membrane By similarity.

Tissue specificity

Expressed in retina and kidney. Ref.1

Sequence similarities

Contains 1 C2 domain.

Contains 2 EF-hand domains.

Contains 1 PH domain.

Contains 1 PI-PLC X-box domain.

Contains 1 PI-PLC Y-box domain.

Sequence caution

The sequence AAH43358.1 differs from that shown. Reason: Frameshift at position 172.

The sequence BAA32295.3 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

The sequence BAC56932.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: O75038-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O75038-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MSGPWPSPDSRTKGTVAWLAEVLLWVGGSVVLSSEWQLGPL → MEEPGPPGGLSQDQ
     987-1156: DTRPLSTQRP...SSMSSSDTVI → GKAPAAVAEK...KSPMFSAVRN
     1157-1416: Missing.
Isoform 3 (identifier: O75038-3)

The sequence of this isoform differs from the canonical sequence as follows:
     706-741: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: O75038-4)

The sequence of this isoform differs from the canonical sequence as follows:
     987-1211: DTRPLSTQRP...SNPNLRATGQ → GKAPAAVAEK...TLLPWLACGP
     1212-1416: Missing.
Note: No experimental confirmation available.
Isoform 5 (identifier: O75038-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: Missing.
     117-785: Missing.
     987-1211: DTRPLSTQRP...SNPNLRATGQ → GKAPAAVAEK...TLLPWLACGP
     1212-1416: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 141614161-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2
PRO_0000088507

Regions

Domain47 – 155109PH
Domain169 – 20436EF-hand 1
Domain205 – 24137EF-hand 2
Domain326 – 471146PI-PLC X-box
Domain626 – 740115PI-PLC Y-box
Domain745 – 852108C2
Calcium binding182 – 19312 Potential
Region1 – 155155Necessary for plasma membrane localization By similarity

Sites

Active site3411 By similarity
Active site3851 By similarity
Metal binding3421Calcium 1; catalytic By similarity
Metal binding3711Calcium 1; catalytic By similarity
Metal binding3731Calcium 1; catalytic By similarity
Metal binding4201Calcium 1; catalytic By similarity
Metal binding7841Calcium 2; via carbonyl oxygen By similarity
Metal binding7861Calcium 2 By similarity
Metal binding8101Calcium 2 By similarity
Metal binding8391Calcium 3 By similarity
Metal binding8401Calcium 3; via carbonyl oxygen By similarity
Metal binding8411Calcium 3 By similarity
Binding site4691Substrate By similarity
Binding site4711Substrate By similarity
Binding site6531Substrate By similarity
Binding site6801Substrate By similarity

Amino acid modifications

Modified residue5951Phosphoserine By similarity
Modified residue6051Phosphoserine By similarity

Natural variations

Alternative sequence1 – 4545Missing in isoform 5.
VSP_029067
Alternative sequence1 – 4141MSGPW…QLGPL → MEEPGPPGGLSQDQ in isoform 2.
VSP_029068
Alternative sequence117 – 785669Missing in isoform 5.
VSP_029069
Alternative sequence706 – 74136Missing in isoform 3.
VSP_029070
Alternative sequence987 – 1211225DTRPL…RATGQ → GKAPAAVAEKSPVRVRPPRV LDGPGPAGMAATCMKCVVGS CAGVNTGGLQRERPPSPGPA SRQAAIRQQPRARADSLGAP CCGLDPHAIPGRSREAPKGP GAWRQGPGGSGSMSSDSSSP DSPGIPERSPRWPEGACRQP GALQGEMSALFAQKLEEIRS KSPMFSAGKPLLPCVVLPHA PGMAGPGSPAAASAWTVSPR VLVLVALYPWHCLRGTLLPW LACGP in isoform 4 and isoform 5.
VSP_029071
Alternative sequence987 – 1156170DTRPL…SDTVI → GKAPAAVAEKSPVRVRPPRV LDGPGPAGMAATCMKCVVGS CAGVNTGGLQRERPPSPGPA SRQAAIRQQPRARADSLGAP CCGLDPHAIPGRSREAPKGP GAWRQGPGGSGSMSSDSSSP DSPGIPERSPRWPEGACRQP GALQGEMSALFAQKLEEIRS KSPMFSAVRN in isoform 2.
VSP_029072
Alternative sequence1157 – 1416260Missing in isoform 2.
VSP_029073
Alternative sequence1212 – 1416205Missing in isoform 4 and isoform 5.
VSP_029074

Experimental info

Sequence conflict5591D → E in BAB84975. Ref.2
Sequence conflict5601V → M in BAB84975. Ref.2
Isoform 4:
Sequence conflict10041P → L in BAB84975. Ref.2
Isoform 5:
Sequence conflict2091Q → L in BAC56932. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified November 13, 2007. Version 3.
Checksum: 05088ACD9C45AE87

FASTA1,416154,668
        10         20         30         40         50         60 
MSGPWPSPDS RTKGTVAWLA EVLLWVGGSV VLSSEWQLGP LVERCMGAMQ EGMQMVKLRG 

        70         80         90        100        110        120 
GSKGLVRFYY LDEHRSCIRW RPSRKNEKAK ISIDSIQEVS EGRQSEVFQR YPDGSFDPNC 

       130        140        150        160        170        180 
CFSIYHGSHR ESLDLVSTSS EVARTWVTGL RYLMAGISDE DSLARRQRTR DQWLKQTFDE 

       190        200        210        220        230        240 
ADKNGDGSLS IGEVLQLLHK LNVNLPRQRV KQMFREADTD DHQGTLGFEE FCAFYKMMST 

       250        260        270        280        290        300 
RRDLYLLMLT YSNHKDHLDA ASLQRFLQVE QKMAGVTLES CQDIIEQFEP CPENKSKGLL 

       310        320        330        340        350        360 
GIDGFTNYTR SPAGDIFNPE HHHVHQDMTQ PLSHYFITSS HNTYLVGDQL MSQSRVDMYA 

       370        380        390        400        410        420 
WVLQAGCRCV EVDCWDGPDG EPIVHHGYTL TSKILFKDVI ETINKYAFIK NEYPVILSIE 

       430        440        450        460        470        480 
NHCSVIQQKK MAQYLTDILG DKLDLSSVSS EDATTLPSPQ MLKGKILVKG KKLPANISED 

       490        500        510        520        530        540 
AEEGEVSDED SADEIDDDCK LLNGDASTNR KRVENTAKRK LDSLIKESKI RDCEDPNNFS 

       550        560        570        580        590        600 
VSTLSPSGKL GRKSKAEEDV ESGEDAGASR RNGRLVVGSF SRRKKKGSKL KKAASVEEGD 

       610        620        630        640        650        660 
EGQDSPGGQS RGATRQKKTM KLSRALSDLV KYTKSVATHD IEMEAASSWQ VSSFSETKAH 

       670        680        690        700        710        720 
QILQQKPAQY LRFNQQQLSR IYPSSYRVDS SNYNPQPFWN AGCQMVALNY QSEGRMLQLN 

       730        740        750        760        770        780 
RAKFSANGGC GYVLKPGCMC QGVFNPNSED PLPGQLKKQL VLRIISGQQL PKPRDSMLGD 

       790        800        810        820        830        840 
RGEIIDPFVE VEIIGLPVDC SREQTRVVDD NGFNPTWEET LVFMVHMPEI ALVRFLVWDH 

       850        860        870        880        890        900 
DPIGRDFIGQ RTLAFSSMMP GYRHVYLEGM EEASIFVHVA VSDISGKVKQ ALGLKGLFLR 

       910        920        930        940        950        960 
GPKPGSLDSH AAGRPPARPS VSQRILRRTA SAPTKSQKPG RRGFPELVLG TRDTGSKGVA 

       970        980        990       1000       1010       1020 
DDVVPPGPGP APEAPAQEGP GSGSPRDTRP LSTQRPLPPL CSLETIAEEP APGPGPPPPA 

      1030       1040       1050       1060       1070       1080 
AVPTSSSQGR PPYPTGPGAN VASPLEDTEE PRDSRPRPCN GEGAGGAYER APGSQTDGRS 

      1090       1100       1110       1120       1130       1140 
QPRTLGHLPV IRRVKSEGQV PTEPLGGWRP LAAPFPAPAV YSDATGSDPL WQRLEPCGHR 

      1150       1160       1170       1180       1190       1200 
DSVSSSSSMS SSDTVIDLSL PSLGLGRSRE NLAGAHMGRL PPRPHSASAA RPDLPPVTKS 

      1210       1220       1230       1240       1250       1260 
KSNPNLRATG QRPPIPDELQ PRSLAPRMAG LPFRPPWGCL SLVGVQDCPV AAKSKSLGDL 

      1270       1280       1290       1300       1310       1320 
TADDFAPSFE GGSRRLSHSL GLPGGTRRVS GPGVRRDTLT EQLRWLTVFQ QAGDITSPTS 

      1330       1340       1350       1360       1370       1380 
LGPAGEGVAG GPGFVRRSSS RSHSRVRAIA SRARQAQERQ QRLQGLGRQG PPEEERGTPE 

      1390       1400       1410 
GACSVGHEGS VDAPAPSKGA LGPASAAAEN LVLLRL 

« Hide

Isoform 2 [UniParc].

Checksum: AE28DDFBEE739B2A
Show »

FASTA1,129124,302
Isoform 3 [UniParc].

Checksum: 7828287338AF8201
Show »

FASTA1,380150,778
Isoform 4 [UniParc].

Checksum: 1472D389D2CF4707
Show »

FASTA1,211132,836
Isoform 5 [UniParc].

Checksum: 843420D08D2C3A9F
Show »

FASTA49752,942

References

« Hide 'large scale' references
[1]"Molecular cloning and characterization of PLC-eta2."
Zhou Y., Wing M.R., Sondek J., Harden T.K.
Biochem. J. 391:667-676(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
[2]"The nucleotide sequence of a long cDNA clone isolated from human spleen."
Jikuya H., Takano J., Nomura N., Kikuno R., Nagase T., Ohara O.
Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 556-1403 (ISOFORM 4).
Tissue: Spleen.
[3]"Characterization of cDNA clones in size-fractionated cDNA libraries from human brain."
Seki N., Ohira M., Nagase T., Ishikawa K., Miyajima N., Nakajima D., Nomura N., Ohara O.
DNA Res. 4:345-349(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Brain.
[4]Seki N., Ohira M., Nagase T., Ishikawa K., Miyajima N., Nakajima D., Nomura N., Ohara O.
Submitted (JAN-2005) to the EMBL/GenBank/DDBJ databases
Cited for: SEQUENCE REVISION.
[5]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 116-1416 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 143-1416 (ISOFORM 3).
Tissue: Brain, Pancreas and Skin.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
DQ176850 mRNA. Translation: ABA12209.1.
AK074149 mRNA. Translation: BAB84975.1.
AK122591 mRNA. Translation: BAC56932.2. Different initiation.
AB007919 mRNA. Translation: BAA32295.3. Different initiation.
AL139246 Genomic DNA. Translation: CAX30815.1.
BC019679 mRNA. Translation: AAH19679.1.
BC043358 mRNA. Translation: AAH43358.1. Frameshift.
BC050037 mRNA. Translation: AAH50037.1.
BC128207 mRNA. Translation: AAI28208.1.
CCDSCCDS59959.1. [O75038-1]
RefSeqNP_055453.2. NM_014638.2. [O75038-1]
XP_006711118.1. XM_006711055.1. [O75038-2]
XP_006725014.1. XM_006724951.1. [O75038-2]
UniGeneHs.170156.

3D structure databases

ProteinModelPortalO75038.
SMRO75038. Positions 46-494, 626-883.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid115009. 1 interaction.
STRING9606.ENSP00000367747.

PTM databases

PhosphoSiteO75038.

Proteomic databases

PaxDbO75038.
PRIDEO75038.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000378486; ENSP00000367747; ENSG00000149527. [O75038-1]
ENST00000378488; ENSP00000367749; ENSG00000149527. [O75038-3]
ENST00000419816; ENSP00000389803; ENSG00000149527. [O75038-1]
ENST00000449969; ENSP00000397289; ENSG00000149527. [O75038-2]
GeneID9651.
KEGGhsa:9651.
UCSCuc001aji.1. human. [O75038-1]
uc001ajj.1. human. [O75038-2]

Organism-specific databases

CTD9651.
GeneCardsGC01P002397.
H-InvDBHIX0000057.
HGNCHGNC:29037. PLCH2.
HPAHPA003346.
MIM612836. gene.
neXtProtNX_O75038.
PharmGKBPA134914471.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG149692.
HOVERGENHBG107105.
InParanoidO75038.
OMACSLETIT.
OrthoDBEOG7PGDQ0.
PhylomeDBO75038.
TreeFamTF313216.

Enzyme and pathway databases

ReactomeREACT_111217. Metabolism.

Gene expression databases

ArrayExpressO75038.
BgeeO75038.
CleanExHS_PLCH2.
GenevestigatorO75038.

Family and domain databases

Gene3D1.10.238.10. 3 hits.
2.30.29.30. 1 hit.
2.60.40.150. 1 hit.
3.20.20.190. 2 hits.
InterProIPR000008. C2_dom.
IPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR011993. PH_like_dom.
IPR001192. PI-PLC_fam.
IPR028393. PLC-eta2.
IPR017946. PLC-like_Pdiesterase_TIM-brl.
IPR001849. Pleckstrin_homology.
IPR015359. PLipase_C_EF-hand-like.
IPR000909. PLipase_C_PInositol-sp_X_dom.
IPR001711. PLipase_C_Pinositol-sp_Y.
[Graphical view]
PANTHERPTHR10336. PTHR10336. 1 hit.
PTHR10336:SF21. PTHR10336:SF21. 1 hit.
PfamPF00168. C2. 1 hit.
PF13499. EF-hand_7. 1 hit.
PF09279. EF-hand_like. 1 hit.
PF00388. PI-PLC-X. 1 hit.
PF00387. PI-PLC-Y. 1 hit.
[Graphical view]
PRINTSPR00390. PHPHLIPASEC.
SMARTSM00239. C2. 1 hit.
SM00054. EFh. 2 hits.
SM00233. PH. 1 hit.
SM00148. PLCXc. 1 hit.
SM00149. PLCYc. 1 hit.
[Graphical view]
SUPFAMSSF49562. SSF49562. 1 hit.
SSF51695. SSF51695. 2 hits.
PROSITEPS50004. C2. 1 hit.
PS00018. EF_HAND_1. 1 hit.
PS50222. EF_HAND_2. 2 hits.
PS50003. PH_DOMAIN. 1 hit.
PS50007. PIPLC_X_DOMAIN. 1 hit.
PS50008. PIPLC_Y_DOMAIN. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi9651.
NextBio36229.
PROO75038.
SOURCESearch...

Entry information

Entry namePLCH2_HUMAN
AccessionPrimary (citable) accession number: O75038
Secondary accession number(s): A2VCM3 expand/collapse secondary AC list , B9DI80, Q3LUA8, Q86XJ2, Q86XU1, Q86YU7, Q8TEH5, Q8WUS6
Entry history
Integrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: November 13, 2007
Last modified: July 9, 2014
This is version 113 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM