Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O75038

- PLCH2_HUMAN

UniProt

O75038 - PLCH2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2

Gene

PLCH2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. This phospholipase activity is very sensitive to calcium. May be important for formation and maintenance of the neuronal network in the postnatal brain (By similarity).By similarity

Catalytic activityi

1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol.

Cofactori

Calcium.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei341 – 3411PROSITE-ProRule annotation
Metal bindingi342 – 3421Calcium 1; catalyticBy similarity
Metal bindingi371 – 3711Calcium 1; catalyticBy similarity
Metal bindingi373 – 3731Calcium 1; catalyticBy similarity
Active sitei385 – 3851PROSITE-ProRule annotation
Metal bindingi420 – 4201Calcium 1; catalyticBy similarity
Binding sitei469 – 4691SubstrateBy similarity
Binding sitei471 – 4711SubstrateBy similarity
Binding sitei653 – 6531SubstrateBy similarity
Binding sitei680 – 6801SubstrateBy similarity
Metal bindingi784 – 7841Calcium 2; via carbonyl oxygenBy similarity
Metal bindingi786 – 7861Calcium 2By similarity
Metal bindingi810 – 8101Calcium 2By similarity
Metal bindingi839 – 8391Calcium 3By similarity
Metal bindingi840 – 8401Calcium 3; via carbonyl oxygenBy similarity
Metal bindingi841 – 8411Calcium 3By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Calcium bindingi182 – 19312PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. calcium ion binding Source: InterPro
  2. phosphatidylinositol phospholipase C activity Source: UniProtKB-EC
  3. signal transducer activity Source: UniProtKB-KW

GO - Biological processi

  1. inositol phosphate metabolic process Source: Reactome
  2. intracellular signal transduction Source: InterPro
  3. lipid catabolic process Source: UniProtKB-KW
  4. phosphatidylinositol metabolic process Source: Ensembl
  5. small molecule metabolic process Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Transducer

Keywords - Biological processi

Lipid degradation, Lipid metabolism

Keywords - Ligandi

Calcium, Metal-binding

Enzyme and pathway databases

ReactomeiREACT_150312. Synthesis of IP3 and IP4 in the cytosol.

Names & Taxonomyi

Protein namesi
Recommended name:
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 (EC:3.1.4.11)
Alternative name(s):
Phosphoinositide phospholipase C-eta-2
Phosphoinositide phospholipase C-like 4
Short name:
PLC-L4
Short name:
Phospholipase C-like protein 4
Phospholipase C-eta-2
Short name:
PLC-eta2
Gene namesi
Name:PLCH2
Synonyms:KIAA0450, PLCL4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:29037. PLCH2.

Subcellular locationi

Cytoplasm. Cell membrane
Note: Localized predominantly at the plasma membrane.By similarity

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-KW
  2. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134914471.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 141614161-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2PRO_0000088507Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei595 – 5951PhosphoserineBy similarity
Modified residuei605 – 6051PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiO75038.
PRIDEiO75038.

PTM databases

PhosphoSiteiO75038.

Expressioni

Tissue specificityi

Expressed in retina and kidney.1 Publication

Gene expression databases

BgeeiO75038.
CleanExiHS_PLCH2.
ExpressionAtlasiO75038. baseline.
GenevestigatoriO75038.

Organism-specific databases

HPAiHPA003346.

Interactioni

Protein-protein interaction databases

BioGridi115009. 1 interaction.
STRINGi9606.ENSP00000367747.

Structurei

3D structure databases

ProteinModelPortaliO75038.
SMRiO75038. Positions 46-494, 626-883.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini47 – 155109PHPROSITE-ProRule annotationAdd
BLAST
Domaini169 – 20436EF-hand 1PROSITE-ProRule annotationAdd
BLAST
Domaini205 – 24137EF-hand 2PROSITE-ProRule annotationAdd
BLAST
Domaini326 – 471146PI-PLC X-boxPROSITE-ProRule annotationAdd
BLAST
Domaini626 – 740115PI-PLC Y-boxPROSITE-ProRule annotationAdd
BLAST
Domaini745 – 852108C2PROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 155155Necessary for plasma membrane localizationBy similarityAdd
BLAST

Sequence similaritiesi

Contains 1 C2 domain.PROSITE-ProRule annotation
Contains 2 EF-hand domains.PROSITE-ProRule annotation
Contains 1 PH domain.PROSITE-ProRule annotation
Contains 1 PI-PLC X-box domain.PROSITE-ProRule annotation
Contains 1 PI-PLC Y-box domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiNOG149692.
GeneTreeiENSGT00760000118936.
HOVERGENiHBG107105.
InParanoidiO75038.
OMAiCSLETIT.
OrthoDBiEOG7PGDQ0.
PhylomeDBiO75038.
TreeFamiTF313216.

Family and domain databases

Gene3Di1.10.238.10. 3 hits.
2.30.29.30. 1 hit.
2.60.40.150. 1 hit.
3.20.20.190. 2 hits.
InterProiIPR000008. C2_dom.
IPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR001849. PH_domain.
IPR011993. PH_like_dom.
IPR001192. PI-PLC_fam.
IPR028393. PLC-eta2.
IPR017946. PLC-like_Pdiesterase_TIM-brl.
IPR015359. PLipase_C_EF-hand-like.
IPR000909. PLipase_C_PInositol-sp_X_dom.
IPR001711. PLipase_C_Pinositol-sp_Y.
[Graphical view]
PANTHERiPTHR10336. PTHR10336. 1 hit.
PTHR10336:SF21. PTHR10336:SF21. 1 hit.
PfamiPF00168. C2. 1 hit.
PF13499. EF-hand_7. 1 hit.
PF09279. EF-hand_like. 1 hit.
PF00388. PI-PLC-X. 1 hit.
PF00387. PI-PLC-Y. 1 hit.
[Graphical view]
PRINTSiPR00390. PHPHLIPASEC.
SMARTiSM00239. C2. 1 hit.
SM00054. EFh. 2 hits.
SM00233. PH. 1 hit.
SM00148. PLCXc. 1 hit.
SM00149. PLCYc. 1 hit.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 1 hit.
SSF51695. SSF51695. 2 hits.
PROSITEiPS50004. C2. 1 hit.
PS00018. EF_HAND_1. 1 hit.
PS50222. EF_HAND_2. 2 hits.
PS50003. PH_DOMAIN. 1 hit.
PS50007. PIPLC_X_DOMAIN. 1 hit.
PS50008. PIPLC_Y_DOMAIN. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O75038-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSGPWPSPDS RTKGTVAWLA EVLLWVGGSV VLSSEWQLGP LVERCMGAMQ
60 70 80 90 100
EGMQMVKLRG GSKGLVRFYY LDEHRSCIRW RPSRKNEKAK ISIDSIQEVS
110 120 130 140 150
EGRQSEVFQR YPDGSFDPNC CFSIYHGSHR ESLDLVSTSS EVARTWVTGL
160 170 180 190 200
RYLMAGISDE DSLARRQRTR DQWLKQTFDE ADKNGDGSLS IGEVLQLLHK
210 220 230 240 250
LNVNLPRQRV KQMFREADTD DHQGTLGFEE FCAFYKMMST RRDLYLLMLT
260 270 280 290 300
YSNHKDHLDA ASLQRFLQVE QKMAGVTLES CQDIIEQFEP CPENKSKGLL
310 320 330 340 350
GIDGFTNYTR SPAGDIFNPE HHHVHQDMTQ PLSHYFITSS HNTYLVGDQL
360 370 380 390 400
MSQSRVDMYA WVLQAGCRCV EVDCWDGPDG EPIVHHGYTL TSKILFKDVI
410 420 430 440 450
ETINKYAFIK NEYPVILSIE NHCSVIQQKK MAQYLTDILG DKLDLSSVSS
460 470 480 490 500
EDATTLPSPQ MLKGKILVKG KKLPANISED AEEGEVSDED SADEIDDDCK
510 520 530 540 550
LLNGDASTNR KRVENTAKRK LDSLIKESKI RDCEDPNNFS VSTLSPSGKL
560 570 580 590 600
GRKSKAEEDV ESGEDAGASR RNGRLVVGSF SRRKKKGSKL KKAASVEEGD
610 620 630 640 650
EGQDSPGGQS RGATRQKKTM KLSRALSDLV KYTKSVATHD IEMEAASSWQ
660 670 680 690 700
VSSFSETKAH QILQQKPAQY LRFNQQQLSR IYPSSYRVDS SNYNPQPFWN
710 720 730 740 750
AGCQMVALNY QSEGRMLQLN RAKFSANGGC GYVLKPGCMC QGVFNPNSED
760 770 780 790 800
PLPGQLKKQL VLRIISGQQL PKPRDSMLGD RGEIIDPFVE VEIIGLPVDC
810 820 830 840 850
SREQTRVVDD NGFNPTWEET LVFMVHMPEI ALVRFLVWDH DPIGRDFIGQ
860 870 880 890 900
RTLAFSSMMP GYRHVYLEGM EEASIFVHVA VSDISGKVKQ ALGLKGLFLR
910 920 930 940 950
GPKPGSLDSH AAGRPPARPS VSQRILRRTA SAPTKSQKPG RRGFPELVLG
960 970 980 990 1000
TRDTGSKGVA DDVVPPGPGP APEAPAQEGP GSGSPRDTRP LSTQRPLPPL
1010 1020 1030 1040 1050
CSLETIAEEP APGPGPPPPA AVPTSSSQGR PPYPTGPGAN VASPLEDTEE
1060 1070 1080 1090 1100
PRDSRPRPCN GEGAGGAYER APGSQTDGRS QPRTLGHLPV IRRVKSEGQV
1110 1120 1130 1140 1150
PTEPLGGWRP LAAPFPAPAV YSDATGSDPL WQRLEPCGHR DSVSSSSSMS
1160 1170 1180 1190 1200
SSDTVIDLSL PSLGLGRSRE NLAGAHMGRL PPRPHSASAA RPDLPPVTKS
1210 1220 1230 1240 1250
KSNPNLRATG QRPPIPDELQ PRSLAPRMAG LPFRPPWGCL SLVGVQDCPV
1260 1270 1280 1290 1300
AAKSKSLGDL TADDFAPSFE GGSRRLSHSL GLPGGTRRVS GPGVRRDTLT
1310 1320 1330 1340 1350
EQLRWLTVFQ QAGDITSPTS LGPAGEGVAG GPGFVRRSSS RSHSRVRAIA
1360 1370 1380 1390 1400
SRARQAQERQ QRLQGLGRQG PPEEERGTPE GACSVGHEGS VDAPAPSKGA
1410
LGPASAAAEN LVLLRL
Length:1,416
Mass (Da):154,668
Last modified:November 13, 2007 - v3
Checksum:i05088ACD9C45AE87
GO
Isoform 2 (identifier: O75038-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MSGPWPSPDSRTKGTVAWLAEVLLWVGGSVVLSSEWQLGPL → MEEPGPPGGLSQDQ
     987-1156: DTRPLSTQRP...SSMSSSDTVI → GKAPAAVAEK...KSPMFSAVRN
     1157-1416: Missing.

Show »
Length:1,129
Mass (Da):124,302
Checksum:iAE28DDFBEE739B2A
GO
Isoform 3 (identifier: O75038-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     706-741: Missing.

Note: No experimental confirmation available.

Show »
Length:1,380
Mass (Da):150,778
Checksum:i7828287338AF8201
GO
Isoform 4 (identifier: O75038-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     987-1211: DTRPLSTQRP...SNPNLRATGQ → GKAPAAVAEK...TLLPWLACGP
     1212-1416: Missing.

Note: No experimental confirmation available.Curated

Show »
Length:1,211
Mass (Da):132,836
Checksum:i1472D389D2CF4707
GO
Isoform 5 (identifier: O75038-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: Missing.
     117-785: Missing.
     987-1211: DTRPLSTQRP...SNPNLRATGQ → GKAPAAVAEK...TLLPWLACGP
     1212-1416: Missing.

Note: No experimental confirmation available.Curated

Show »
Length:497
Mass (Da):52,942
Checksum:i843420D08D2C3A9F
GO

Sequence cautioni

The sequence AAH43358.1 differs from that shown. Reason: Frameshift at position 172.
The sequence BAA32295.3 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
The sequence BAC56932.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti559 – 5591D → E in BAB84975. 1 PublicationCurated
Sequence conflicti560 – 5601V → M in BAB84975. 1 PublicationCurated
Isoform 5 (identifier: O75038-5)
Sequence conflicti209 – 2091Q → L in BAC56932. 1 PublicationCurated
Isoform 4 (identifier: O75038-4)
Sequence conflicti1004 – 10041P → L in BAB84975. 1 PublicationCurated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4545Missing in isoform 5. 1 PublicationVSP_029067Add
BLAST
Alternative sequencei1 – 4141MSGPW…QLGPL → MEEPGPPGGLSQDQ in isoform 2. 1 PublicationVSP_029068Add
BLAST
Alternative sequencei117 – 785669Missing in isoform 5. 1 PublicationVSP_029069Add
BLAST
Alternative sequencei706 – 74136Missing in isoform 3. 1 PublicationVSP_029070Add
BLAST
Alternative sequencei987 – 1211225DTRPL…RATGQ → GKAPAAVAEKSPVRVRPPRV LDGPGPAGMAATCMKCVVGS CAGVNTGGLQRERPPSPGPA SRQAAIRQQPRARADSLGAP CCGLDPHAIPGRSREAPKGP GAWRQGPGGSGSMSSDSSSP DSPGIPERSPRWPEGACRQP GALQGEMSALFAQKLEEIRS KSPMFSAGKPLLPCVVLPHA PGMAGPGSPAAASAWTVSPR VLVLVALYPWHCLRGTLLPW LACGP in isoform 4 and isoform 5. 1 PublicationVSP_029071Add
BLAST
Alternative sequencei987 – 1156170DTRPL…SDTVI → GKAPAAVAEKSPVRVRPPRV LDGPGPAGMAATCMKCVVGS CAGVNTGGLQRERPPSPGPA SRQAAIRQQPRARADSLGAP CCGLDPHAIPGRSREAPKGP GAWRQGPGGSGSMSSDSSSP DSPGIPERSPRWPEGACRQP GALQGEMSALFAQKLEEIRS KSPMFSAVRN in isoform 2. 1 PublicationVSP_029072Add
BLAST
Alternative sequencei1157 – 1416260Missing in isoform 2. 1 PublicationVSP_029073Add
BLAST
Alternative sequencei1212 – 1416205Missing in isoform 4 and isoform 5. 1 PublicationVSP_029074Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
DQ176850 mRNA. Translation: ABA12209.1.
AK074149 mRNA. Translation: BAB84975.1.
AK122591 mRNA. Translation: BAC56932.2. Different initiation.
AB007919 mRNA. Translation: BAA32295.3. Different initiation.
AL139246 Genomic DNA. Translation: CAX30815.1.
BC019679 mRNA. Translation: AAH19679.1.
BC043358 mRNA. Translation: AAH43358.1. Frameshift.
BC050037 mRNA. Translation: AAH50037.1.
BC128207 mRNA. Translation: AAI28208.1.
CCDSiCCDS59959.1. [O75038-1]
RefSeqiNP_055453.2. NM_014638.2. [O75038-1]
XP_006711118.1. XM_006711055.1. [O75038-2]
XP_006725014.1. XM_006724951.1. [O75038-2]
UniGeneiHs.170156.

Genome annotation databases

EnsembliENST00000378486; ENSP00000367747; ENSG00000149527. [O75038-1]
ENST00000419816; ENSP00000389803; ENSG00000149527. [O75038-1]
ENST00000449969; ENSP00000397289; ENSG00000149527. [O75038-2]
GeneIDi9651.
KEGGihsa:9651.
UCSCiuc001aji.1. human. [O75038-1]
uc001ajj.1. human. [O75038-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
DQ176850 mRNA. Translation: ABA12209.1 .
AK074149 mRNA. Translation: BAB84975.1 .
AK122591 mRNA. Translation: BAC56932.2 . Different initiation.
AB007919 mRNA. Translation: BAA32295.3 . Different initiation.
AL139246 Genomic DNA. Translation: CAX30815.1 .
BC019679 mRNA. Translation: AAH19679.1 .
BC043358 mRNA. Translation: AAH43358.1 . Frameshift.
BC050037 mRNA. Translation: AAH50037.1 .
BC128207 mRNA. Translation: AAI28208.1 .
CCDSi CCDS59959.1. [O75038-1 ]
RefSeqi NP_055453.2. NM_014638.2. [O75038-1 ]
XP_006711118.1. XM_006711055.1. [O75038-2 ]
XP_006725014.1. XM_006724951.1. [O75038-2 ]
UniGenei Hs.170156.

3D structure databases

ProteinModelPortali O75038.
SMRi O75038. Positions 46-494, 626-883.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 115009. 1 interaction.
STRINGi 9606.ENSP00000367747.

PTM databases

PhosphoSitei O75038.

Proteomic databases

PaxDbi O75038.
PRIDEi O75038.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000378486 ; ENSP00000367747 ; ENSG00000149527 . [O75038-1 ]
ENST00000419816 ; ENSP00000389803 ; ENSG00000149527 . [O75038-1 ]
ENST00000449969 ; ENSP00000397289 ; ENSG00000149527 . [O75038-2 ]
GeneIDi 9651.
KEGGi hsa:9651.
UCSCi uc001aji.1. human. [O75038-1 ]
uc001ajj.1. human. [O75038-2 ]

Organism-specific databases

CTDi 9651.
GeneCardsi GC01P002397.
H-InvDB HIX0000057.
HGNCi HGNC:29037. PLCH2.
HPAi HPA003346.
MIMi 612836. gene.
neXtProti NX_O75038.
PharmGKBi PA134914471.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG149692.
GeneTreei ENSGT00760000118936.
HOVERGENi HBG107105.
InParanoidi O75038.
OMAi CSLETIT.
OrthoDBi EOG7PGDQ0.
PhylomeDBi O75038.
TreeFami TF313216.

Enzyme and pathway databases

Reactomei REACT_150312. Synthesis of IP3 and IP4 in the cytosol.

Miscellaneous databases

GenomeRNAii 9651.
NextBioi 36229.
PROi O75038.
SOURCEi Search...

Gene expression databases

Bgeei O75038.
CleanExi HS_PLCH2.
ExpressionAtlasi O75038. baseline.
Genevestigatori O75038.

Family and domain databases

Gene3Di 1.10.238.10. 3 hits.
2.30.29.30. 1 hit.
2.60.40.150. 1 hit.
3.20.20.190. 2 hits.
InterProi IPR000008. C2_dom.
IPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR001849. PH_domain.
IPR011993. PH_like_dom.
IPR001192. PI-PLC_fam.
IPR028393. PLC-eta2.
IPR017946. PLC-like_Pdiesterase_TIM-brl.
IPR015359. PLipase_C_EF-hand-like.
IPR000909. PLipase_C_PInositol-sp_X_dom.
IPR001711. PLipase_C_Pinositol-sp_Y.
[Graphical view ]
PANTHERi PTHR10336. PTHR10336. 1 hit.
PTHR10336:SF21. PTHR10336:SF21. 1 hit.
Pfami PF00168. C2. 1 hit.
PF13499. EF-hand_7. 1 hit.
PF09279. EF-hand_like. 1 hit.
PF00388. PI-PLC-X. 1 hit.
PF00387. PI-PLC-Y. 1 hit.
[Graphical view ]
PRINTSi PR00390. PHPHLIPASEC.
SMARTi SM00239. C2. 1 hit.
SM00054. EFh. 2 hits.
SM00233. PH. 1 hit.
SM00148. PLCXc. 1 hit.
SM00149. PLCYc. 1 hit.
[Graphical view ]
SUPFAMi SSF49562. SSF49562. 1 hit.
SSF51695. SSF51695. 2 hits.
PROSITEi PS50004. C2. 1 hit.
PS00018. EF_HAND_1. 1 hit.
PS50222. EF_HAND_2. 2 hits.
PS50003. PH_DOMAIN. 1 hit.
PS50007. PIPLC_X_DOMAIN. 1 hit.
PS50008. PIPLC_Y_DOMAIN. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and characterization of PLC-eta2."
    Zhou Y., Wing M.R., Sondek J., Harden T.K.
    Biochem. J. 391:667-676(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
  2. "The nucleotide sequence of a long cDNA clone isolated from human spleen."
    Jikuya H., Takano J., Nomura N., Kikuno R., Nagase T., Ohara O.
    Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 556-1403 (ISOFORM 4).
    Tissue: Spleen.
  3. "Characterization of cDNA clones in size-fractionated cDNA libraries from human brain."
    Seki N., Ohira M., Nagase T., Ishikawa K., Miyajima N., Nakajima D., Nomura N., Ohara O.
    DNA Res. 4:345-349(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  4. Seki N., Ohira M., Nagase T., Ishikawa K., Miyajima N., Nakajima D., Nomura N., Ohara O.
    Submitted (JAN-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: SEQUENCE REVISION.
  5. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 116-1416 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 143-1416 (ISOFORM 3).
    Tissue: Brain, Pancreas and Skin.

Entry informationi

Entry nameiPLCH2_HUMAN
AccessioniPrimary (citable) accession number: O75038
Secondary accession number(s): A2VCM3
, B9DI80, Q3LUA8, Q86XJ2, Q86XU1, Q86YU7, Q8TEH5, Q8WUS6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: November 13, 2007
Last modified: October 29, 2014
This is version 116 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3