Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kinesin-like protein KIF21B

Gene

KIF21B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Microtubule-binding motor protein probably involved in neuronal dendritic transport. In vitro, has a plus-end directed motor activity (By similarity).By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi87 – 948ATPPROSITE-ProRule annotation

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Motor protein

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-HSA-6811434. COPI-dependent Golgi-to-ER retrograde traffic.
R-HSA-983189. Kinesins.
SignaLinkiO75037.

Names & Taxonomyi

Protein namesi
Recommended name:
Kinesin-like protein KIF21B
Gene namesi
Name:KIF21B
Synonyms:KIAA0449
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:29442. KIF21B.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134925106.

Polymorphism and mutation databases

BioMutaiKIF21B.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 16371637Kinesin-like protein KIF21BPRO_0000125464Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei579 – 5791PhosphoserineBy similarity
Modified residuei582 – 5821PhosphothreonineBy similarity
Modified residuei1167 – 11671PhosphoserineCombined sources
Modified residuei1215 – 12151PhosphoserineBy similarity
Modified residuei1237 – 12371PhosphothreonineCombined sources
Modified residuei1241 – 12411PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO75037.
MaxQBiO75037.
PaxDbiO75037.
PRIDEiO75037.

PTM databases

iPTMnetiO75037.
PhosphoSiteiO75037.

Expressioni

Gene expression databases

BgeeiO75037.
CleanExiHS_KIF21B.
GenevisibleiO75037. HS.

Organism-specific databases

HPAiHPA027249.
HPA027274.

Interactioni

Protein-protein interaction databases

BioGridi116684. 32 interactions.
IntActiO75037. 29 interactions.
MINTiMINT-4989489.
STRINGi9606.ENSP00000328494.

Structurei

3D structure databases

ProteinModelPortaliO75037.
SMRiO75037. Positions 9-391, 1252-1633.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini8 – 370363Kinesin motorPROSITE-ProRule annotationAdd
BLAST
Repeati1306 – 134338WD 1Add
BLAST
Repeati1346 – 138439WD 2Add
BLAST
Repeati1410 – 144839WD 3Add
BLAST
Repeati1451 – 149343WD 4Add
BLAST
Repeati1502 – 153938WD 5Add
BLAST
Repeati1543 – 158240WD 6Add
BLAST
Repeati1585 – 162238WD 7Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili376 – 604229Sequence analysisAdd
BLAST
Coiled coili631 – 824194Sequence analysisAdd
BLAST
Coiled coili928 – 101689Sequence analysisAdd
BLAST

Sequence similaritiesi

Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family.PROSITE-ProRule annotation
Contains 1 kinesin motor domain.PROSITE-ProRule annotation
Contains 7 WD repeats.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Repeat, WD repeat

Phylogenomic databases

eggNOGiKOG0244. Eukaryota.
COG5059. LUCA.
GeneTreeiENSGT00840000129683.
HOVERGENiHBG052247.
InParanoidiO75037.
KOiK10395.
OMAiAICTNSK.
PhylomeDBiO75037.
TreeFamiTF105224.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
3.40.850.10. 1 hit.
InterProiIPR027640. Kinesin-like_fam.
IPR019821. Kinesin_motor_CS.
IPR001752. Kinesin_motor_dom.
IPR027417. P-loop_NTPase.
IPR009053. Prefoldin.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PANTHERiPTHR24115. PTHR24115. 5 hits.
PfamiPF00225. Kinesin. 1 hit.
PF00400. WD40. 4 hits.
[Graphical view]
PRINTSiPR00380. KINESINHEAVY.
SMARTiSM00129. KISc. 1 hit.
SM00320. WD40. 7 hits.
[Graphical view]
SUPFAMiSSF46579. SSF46579. 1 hit.
SSF50978. SSF50978. 1 hit.
SSF52540. SSF52540. 1 hit.
PROSITEiPS00411. KINESIN_MOTOR_1. 1 hit.
PS50067. KINESIN_MOTOR_2. 1 hit.
PS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 4 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O75037-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGQGDCCVK VAVRIRPQLS KEKIEGCHIC TSVTPGEPQV LLGKDKAFTY
60 70 80 90 100
DFVFDLDTWQ EQIYSTCVSK LIEGCFEGYN ATVLAYGQTG AGKTYTMGTG
110 120 130 140 150
FDMATSEEEQ GIIPRAIAHL FGGIAERKRR AQEQGVAGPE FKVSAQFLEL
160 170 180 190 200
YNEEILDLFD STRDPDTRHR RSNIKIHEDA NGGIYTTGVT SRLIHSQEEL
210 220 230 240 250
IQCLKQGALS RTTASTQMNV QSSRSHAIFT IHLCQMRMCT QPDLVNEAVT
260 270 280 290 300
GLPDGTPPSS EYETLTAKFH FVDLAGSERL KRTGATGERA KEGISINCGL
310 320 330 340 350
LALGNVISAL GDQSKKVVHV PYRDSKLTRL LQDSLGGNSQ TIMIACVSPS
360 370 380 390 400
DRDFMETLNT LKYANRARNI KNKVVVNQDK TSQQISALRA EIARLQMELM
410 420 430 440 450
EYKAGKRVIG EDGAEGYSDL FRENAMLQKE NGALRLRVKA MQEAIDAINN
460 470 480 490 500
RVTQLMSQEA NLLLAKAGDG NEAIGALIQN YIREIEELRT KLLESEAMNE
510 520 530 540 550
SLRRSLSRAS ARSPYSLGAS PAAPAFGGSP ASSMEDASEV IRRAKQDLER
560 570 580 590 600
LKKKEVRQRR KSPEKEAFKK RAKLQQENSE ETDENEAEEE EEERDESGCE
610 620 630 640 650
EEEGREDEDE DSGSEESLVD SDSDPEEKEV NFQADLADLT CEIEIKQKLI
660 670 680 690 700
DELENSQRRL QTLKHQYEEK LILLQNKIRD TQLERDRVLQ NLSTMECYTE
710 720 730 740 750
EKANKIKADY EKRLREMNRD LQKLQAAQKE HARLLKNQSR YERELKKLQA
760 770 780 790 800
EVAEMKKAKV ALMKQMREEQ QRRRLVETKR NREIAQLKKE QRRQEFQIRA
810 820 830 840 850
LESQKRQQEM VLRRKTQEVS ALRRLAKPMS ERVAGRAGLK PPMLDSGAEV
860 870 880 890 900
SASTTSSEAE SGARSVSSIV RQWNRKINHF LGDHPAPTVN GTRPARKKFQ
910 920 930 940 950
KKGASQSFSK AARLKWQSLE RRIIDIVMQR MTIVNLEADM ERLIKKREEL
960 970 980 990 1000
FLLQEALRRK RERLQAESPE EEKGLQELAE EIEVLAANID YINDGITDCQ
1010 1020 1030 1040 1050
ATIVQLEETK EELDSTDTSV VISSCSLAEA RLLLDNFLKA SIDKGLQVAQ
1060 1070 1080 1090 1100
KEAQIRLLEG RLRQTDMAGS SQNHLLLDAL REKAEAHPEL QALIYNVQQE
1110 1120 1130 1140 1150
NGYASTDEEI SEFSEGSFSQ SFTMKGSTSH DDFKFKSEPK LSAQMKAVSA
1160 1170 1180 1190 1200
ECLGPPLDIS TKNITKSLAS LVEIKEDGVG FSVRDPYYRD RVSRTVSLPT
1210 1220 1230 1240 1250
RGSTFPRQSR ATETSPLTRR KSYDRGQPIR STDVGFTPPS SPPTRPRNDR
1260 1270 1280 1290 1300
NVFSRLTSNQ SQGSALDKSD DSDSSLSEVL RGIISPVGGA KGARTAPLQC
1310 1320 1330 1340 1350
VSMAEGHTKP ILCLDATDEL LFTGSKDRSC KMWNLVTGQE IAALKGHPNN
1360 1370 1380 1390 1400
VVSIKYCSHS GLVFSVSTSY IKVWDIRDSA KCIRTLTSSG QVISGDACAA
1410 1420 1430 1440 1450
TSTRAITSAQ GEHQINQIAL SPSGTMLYAA SGNAVRIWEL SRFQPVGKLT
1460 1470 1480 1490 1500
GHIGPVMCLT VTQTASQHDL VVTGSKDHYV KMFELGECVT GTIGPTHNFE
1510 1520 1530 1540 1550
PPHYDGIECL AIQGDILFSG SRDNGIKKWD LDQQELIQQI PNAHKDWVCA
1560 1570 1580 1590 1600
LAFIPGRPML LSACRAGVIK VWNVDNFTPI GEIKGHDSPI NAICTNAKHI
1610 1620 1630
FTASSDCRVK LWNYVPGLTP CLPRRVLAIK GRATTLP
Length:1,637
Mass (Da):182,662
Last modified:February 1, 2005 - v2
Checksum:i792647EA1D909C24
GO
Isoform 2 (identifier: O75037-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1269-1281: Missing.

Note: No experimental confirmation available.
Show »
Length:1,624
Mass (Da):181,270
Checksum:i827B497E8ECAC6A1
GO
Isoform 3 (identifier: O75037-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1269-1281: Missing.
     1607-1636: CRVKLWNYVPGLTPCLPRRVLAIKGRATTL → LTVKFWSVRRLPHSGP

Show »
Length:1,610
Mass (Da):179,754
Checksum:iE65AB888C7F031B9
GO
Isoform 4 (identifier: O75037-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1607-1636: CRVKLWNYVPGLTPCLPRRVLAIKGRATTL → LTVKFWSVRRLPHSGP

Show »
Length:1,623
Mass (Da):181,146
Checksum:i90644A587723C23F
GO

Sequence cautioni

The sequence BAA32294.2 differs from that shown. Reason: Erroneous initiation. Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1269 – 128113Missing in isoform 2 and isoform 3. 2 PublicationsVSP_016217Add
BLAST
Alternative sequencei1607 – 163630CRVKL…RATTL → LTVKFWSVRRLPHSGP in isoform 3 and isoform 4. 1 PublicationVSP_045333Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB007918 mRNA. Translation: BAA32294.2. Different initiation.
AC099756 Genomic DNA. No translation available.
AL358473 Genomic DNA. No translation available.
CH471067 Genomic DNA. Translation: EAW91328.1.
BC137281 mRNA. Translation: AAI37282.1.
BC144557 mRNA. Translation: AAI44558.1.
CCDSiCCDS30965.1. [O75037-2]
CCDS58054.1. [O75037-3]
CCDS58055.1. [O75037-4]
CCDS58056.1. [O75037-1]
PIRiT00066.
RefSeqiNP_001239029.1. NM_001252100.1. [O75037-1]
NP_001239031.1. NM_001252102.1. [O75037-4]
NP_001239032.1. NM_001252103.1. [O75037-3]
NP_060066.2. NM_017596.3. [O75037-2]
UniGeneiHs.169182.

Genome annotation databases

EnsembliENST00000332129; ENSP00000328494; ENSG00000116852. [O75037-2]
ENST00000360529; ENSP00000353724; ENSG00000116852. [O75037-3]
ENST00000422435; ENSP00000411831; ENSG00000116852. [O75037-1]
ENST00000461742; ENSP00000433808; ENSG00000116852. [O75037-4]
GeneIDi23046.
KEGGihsa:23046.
UCSCiuc001gvr.3. human. [O75037-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB007918 mRNA. Translation: BAA32294.2. Different initiation.
AC099756 Genomic DNA. No translation available.
AL358473 Genomic DNA. No translation available.
CH471067 Genomic DNA. Translation: EAW91328.1.
BC137281 mRNA. Translation: AAI37282.1.
BC144557 mRNA. Translation: AAI44558.1.
CCDSiCCDS30965.1. [O75037-2]
CCDS58054.1. [O75037-3]
CCDS58055.1. [O75037-4]
CCDS58056.1. [O75037-1]
PIRiT00066.
RefSeqiNP_001239029.1. NM_001252100.1. [O75037-1]
NP_001239031.1. NM_001252102.1. [O75037-4]
NP_001239032.1. NM_001252103.1. [O75037-3]
NP_060066.2. NM_017596.3. [O75037-2]
UniGeneiHs.169182.

3D structure databases

ProteinModelPortaliO75037.
SMRiO75037. Positions 9-391, 1252-1633.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116684. 32 interactions.
IntActiO75037. 29 interactions.
MINTiMINT-4989489.
STRINGi9606.ENSP00000328494.

PTM databases

iPTMnetiO75037.
PhosphoSiteiO75037.

Polymorphism and mutation databases

BioMutaiKIF21B.

Proteomic databases

EPDiO75037.
MaxQBiO75037.
PaxDbiO75037.
PRIDEiO75037.

Protocols and materials databases

DNASUi23046.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000332129; ENSP00000328494; ENSG00000116852. [O75037-2]
ENST00000360529; ENSP00000353724; ENSG00000116852. [O75037-3]
ENST00000422435; ENSP00000411831; ENSG00000116852. [O75037-1]
ENST00000461742; ENSP00000433808; ENSG00000116852. [O75037-4]
GeneIDi23046.
KEGGihsa:23046.
UCSCiuc001gvr.3. human. [O75037-1]

Organism-specific databases

CTDi23046.
GeneCardsiKIF21B.
HGNCiHGNC:29442. KIF21B.
HPAiHPA027249.
HPA027274.
MIMi608322. gene.
neXtProtiNX_O75037.
PharmGKBiPA134925106.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0244. Eukaryota.
COG5059. LUCA.
GeneTreeiENSGT00840000129683.
HOVERGENiHBG052247.
InParanoidiO75037.
KOiK10395.
OMAiAICTNSK.
PhylomeDBiO75037.
TreeFamiTF105224.

Enzyme and pathway databases

ReactomeiR-HSA-6811434. COPI-dependent Golgi-to-ER retrograde traffic.
R-HSA-983189. Kinesins.
SignaLinkiO75037.

Miscellaneous databases

ChiTaRSiKIF21B. human.
GenomeRNAii23046.
PROiO75037.
SOURCEiSearch...

Gene expression databases

BgeeiO75037.
CleanExiHS_KIF21B.
GenevisibleiO75037. HS.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
3.40.850.10. 1 hit.
InterProiIPR027640. Kinesin-like_fam.
IPR019821. Kinesin_motor_CS.
IPR001752. Kinesin_motor_dom.
IPR027417. P-loop_NTPase.
IPR009053. Prefoldin.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PANTHERiPTHR24115. PTHR24115. 5 hits.
PfamiPF00225. Kinesin. 1 hit.
PF00400. WD40. 4 hits.
[Graphical view]
PRINTSiPR00380. KINESINHEAVY.
SMARTiSM00129. KISc. 1 hit.
SM00320. WD40. 7 hits.
[Graphical view]
SUPFAMiSSF46579. SSF46579. 1 hit.
SSF50978. SSF50978. 1 hit.
SSF52540. SSF52540. 1 hit.
PROSITEiPS00411. KINESIN_MOTOR_1. 1 hit.
PS50067. KINESIN_MOTOR_2. 1 hit.
PS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 4 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Characterization of cDNA clones in size-fractionated cDNA libraries from human brain."
    Seki N., Ohira M., Nagase T., Ishikawa K., Miyajima N., Nakajima D., Nomura N., Ohara O.
    DNA Res. 4:345-349(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  2. Ohara O., Nagase T., Kikuno R.
    Submitted (AUG-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: SEQUENCE REVISION.
  3. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
  6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-1237, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  7. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-1237 AND SER-1241, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  8. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1167 AND THR-1237, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiKI21B_HUMAN
AccessioniPrimary (citable) accession number: O75037
Secondary accession number(s): B2RP62, B7ZMI0, Q5T4J3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: February 1, 2005
Last modified: June 8, 2016
This is version 141 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.