O75030 (MITF_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
December 14, 2011.
Version 123.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Microphthalmia-associated transcription factor Alternative name(s): Class E basic helix-loop-helix protein 32 Short name=bHLHe32 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 526 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Transcription factor for tyrosinase and tyrosinase-related protein 1. Binds to a symmetrical DNA sequence (E-boxes) (5'-CACGTG-3') found in the tyrosinase promoter. Plays a critical role in the differentiation of various cell types as neural crest-derived melanocytes, mast cells, osteoclasts and optic cup-derived retinal pigment epithelium. |
| Subunit structure | Efficient DNA binding requires dimerization with another bHLH protein. Binds DNA in the form of homodimer or heterodimer with either TFE3, TFEB or TFEC. Interacts with KARS. Ref.8 |
| Subcellular location | |
| Tissue specificity | Isoform M is exclusively expressed in melanocytes and melanoma cells. Isoform A and isoform H are widely expressed in many cell types including melanocytes and retinal pigment epithelium (RPE). Isoform C is expressed in many cell types including RPE but not in melanocyte-lineage cells. |
| Post-translational modification | Phosphorylation at Ser-405 significantly enhances the ability to bind the tyrosinase promoter. |
| Involvement in disease | Defects in MITF are the cause of Waardenburg syndrome type 2A (WS2A) [MIM:193510]. It is a dominant inherited disorder characterized by sensorineural hearing loss and patches of depigmentation. The features show variable expression and penetrance. Ref.13 Defects in MITF are a cause of Waardenburg syndrome type 2 with ocular albinism (WS2-OA) [MIM:103470]. It is an ocular albinism with sensorineural deafness. Defects in MITF are the cause of Tietz syndrome (TIETZS) [MIM:103500]. It is an autosomal dominant disorder characterized by generalized hypopigmentation and profound, congenital, bilateral deafness. Penetrance is complete. Ref.14 |
| Sequence similarities | Belongs to the MiT/TFE family. Contains 1 basic helix-loop-helix (bHLH) domain. |
Ontologies
Alternative products
| This entry describes 10 isoforms produced by alternative splicing. [Align] [Select] Note: The X2-type isoforms differ from the X1-type isoforms by the absence of a 6 residue insert. | ||||||
| Isoform A1 (identifier: O75030-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform A2 (identifier: O75030-2) The sequence of this isoform differs from the canonical sequence as follows: 294-299: Missing. | ||||||
| Isoform B1 (identifier: O75030-3) The sequence of this isoform differs from the canonical sequence as follows: 1-34: MQSESGIVPDFEVGEEFHEEPKTYYELKSQPLKS → MLYAFWFSH | ||||||
| Isoform B2 (identifier: O75030-4) The sequence of this isoform differs from the canonical sequence as follows: 1-34: MQSESGIVPDFEVGEEFHEEPKTYYELKSQPLKS → MLYAFWFSH 294-299: Missing. | ||||||
| Isoform C1 (identifier: O75030-5) The sequence of this isoform differs from the canonical sequence as follows: 1-34: MQSESGIVPDFEVGEEFHEEPKTYYELKSQPLKS → MGHLENTSVVFPRAIFSLCEKETRKLTLCLFSR | ||||||
| Isoform C2 (identifier: O75030-6) The sequence of this isoform differs from the canonical sequence as follows: 1-34: MQSESGIVPDFEVGEEFHEEPKTYYELKSQPLKS → MGHLENTSVVFPRAIFSLCEKETRKLTLCLFSR 294-299: Missing. | ||||||
| Isoform H1 (identifier: O75030-7) The sequence of this isoform differs from the canonical sequence as follows: 1-35: MQSESGIVPDFEVGEEFHEEPKTYYELKSQPLKSS → MEALRVQMFMPCSFESLYL | ||||||
| Isoform H2 (identifier: O75030-8) The sequence of this isoform differs from the canonical sequence as follows: 1-35: MQSESGIVPDFEVGEEFHEEPKTYYELKSQPLKSS → MEALRVQMFMPCSFESLYL 294-299: Missing. | ||||||
| Isoform M1 (identifier: O75030-9) The sequence of this isoform differs from the canonical sequence as follows: 1-118: MQSESGIVPD...ATQVPMEVLK → MLEMLEYNHYQ | ||||||
| Isoform M2 (identifier: O75030-10) The sequence of this isoform differs from the canonical sequence as follows: 1-118: MQSESGIVPD...ATQVPMEVLK → MLEMLEYNHYQ 294-299: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 526 | 526 | Microphthalmia-associated transcription factor | PRO_0000127276 | |||||
Regions | |||||||||
| Domain | 325 – 365 | 41 | Helix-loop-helix motif | ||||||
| Domain | 374 – 395 | 22 | Leucine-zipper | ||||||
| DNA binding | 309 – 324 | 16 | Basic motif | ||||||
| Region | 224 – 295 | 72 | Transactivation | ||||||
| Region | 401 – 431 | 31 | DNA binding regulation | ||||||
Amino acid modifications | |||||||||
| Modified residue | 54 | 1 | Phosphothreonine Ref.10 | ||||||
| Modified residue | 405 | 1 | Phosphoserine; by GSK3 Ref.7 | ||||||
| Modified residue | 414 | 1 | Phosphoserine Ref.11 Ref.12 | ||||||
| Cross-link | 289 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) Ref.9 | |||||||
| Cross-link | 423 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) Ref.9 | |||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 118 | 118 | MQSES…MEVLK → MLEMLEYNHYQ in isoform M1 and isoform M2. | VSP_002127 | |||||
| Alternative sequence | 1 – 35 | 35 | MQSES…PLKSS → MEALRVQMFMPCSFESLYL in isoform H1 and isoform H2. | VSP_002126 | |||||
| Alternative sequence | 1 – 34 | 34 | MQSES…QPLKS → MLYAFWFSH in isoform B1 and isoform B2. | VSP_002124 | |||||
| Alternative sequence | 1 – 34 | 34 | MQSES…QPLKS → MGHLENTSVVFPRAIFSLCE KETRKLTLCLFSR in isoform C1 and isoform C2. | VSP_002125 | |||||
| Alternative sequence | 294 – 299 | 6 | Missing in isoform A2, isoform B2, isoform C2, isoform H2 and isoform M2. | VSP_002128 | |||||
| Natural variant | 310 | 1 | R → K in WS2A; could be a polymorphism. Ref.13 | VAR_010297 | |||||
| Natural variant | 317 | 1 | N → K in TIETZS. Ref.14 | VAR_010298 | |||||
| Natural variant | 324 | 1 | Missing in WS2A. | VAR_010299 | |||||
| Natural variant | 357 | 1 | S → P in WS2A. Ref.13 | VAR_010300 | |||||
| Natural variant | 385 | 1 | N → D in WS2A. Ref.13 | VAR_010301 | |||||
| Natural variant | 405 | 1 | S → P in WS2A. Ref.13 | VAR_010302 | |||||
Experimental info | |||||||||
| Mutagenesis | 289 | 1 | K → R: Loss of sumoylation; when associated with R-423. Ref.9 | ||||||
| Mutagenesis | 405 | 1 | S → A or P: Loss of phosphorylation and function. Ref.7 | ||||||
| Mutagenesis | 423 | 1 | K → R: Loss of sumoylation; when associated with R-289. Ref.9 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of a novel isoform of microphthalmia-associated transcription factor that is enriched in retinal pigment epithelium." Amae S., Fuse N., Yasumoto K., Sato S., Yajima I., Yamamoto H., Udono T., Durlu Y.K., Tamai M., Takahashi K., Shibahara S. Biochem. Biophys. Res. Commun. 247:710-715(1998) [PubMed: 9647758] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A2), NUCLEOTIDE SEQUENCE [MRNA] OF 1-35 (ISOFORMS H1/H2). Tissue: Kidney. |
| [2] | "Cloning of MITF, the human homolog of the mouse microphthalmia gene and assignment to chromosome 3p14.1-p12.3." Tachibana M., Perez-Jurado L.A., Nakayama A., Hodgkinson C.A., Li X., Schneider M., Miki T., Fex J., Francke U., Arnheiter H. Hum. Mol. Genet. 3:553-557(1994) [PubMed: 8069297] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM M1). Tissue: Skin. |
| [3] | "Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs." Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. Poustka A.Genome Res. 11:422-435(2001) [PubMed: 11230166] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A2). Tissue: Uterus. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS M1 AND M2). Tissue: Skin. |
| [5] | "Structural organization of the human microphthalmia-associated transcription factor gene containing four alternative promoters." Udono T., Yasumoto K., Takeda K., Amae S., Watanabe K., Saito H., Fuse N., Tachibana M., Takahashi K., Tamai M., Shibahara S. Biochim. Biophys. Acta 1491:205-219(2000) [PubMed: 10760582] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS A1/A2; B1/B2; H1/H2 AND M1/M2). |
| [6] | "Molecular cloning of cDNA encoding a novel microphthalmia-associated transcription factor isoform with a distinct amino-terminus." Fuse N., Yasumoto K., Takeda K., Amae S., Yoshizawa M., Udono T., Takahashi K., Tamai M., Tomita Y., Tachibana M., Shibahara S. J. Biochem. 126:1043-1051(1999) [PubMed: 10578055] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORM C1/C2). Tissue: Kidney. |
| [7] | "Ser298 of MITF, a mutation site in Waardenburg syndrome type 2, is a phosphorylation site with functional significance." Takeda K., Takemoto C., Kobayashi I., Watanabe A., Nobukuni Y., Fisher D.E., Tachibana M. Hum. Mol. Genet. 9:125-132(2000) [PubMed: 10587587] [Abstract] Cited for: MUTAGENESIS OF SER-405, PHOSPHORYLATION AT SER-405. |
| [8] | "The function of lysyl-tRNA synthetase and Ap4A as signaling regulators of MITF activity in FcepsilonRI-activated mast cells." Lee Y.N., Nechushtan H., Figov N., Razin E. Immunity 20:145-151(2004) [PubMed: 14975237] [Abstract] Cited for: INTERACTION WITH KARS. |
| [9] | "Sumoylation of MITF and its related family members TFE3 and TFEB." Miller A.J., Levy C., Davis I.J., Razin E., Fisher D.E. J. Biol. Chem. 280:146-155(2005) [PubMed: 15507434] [Abstract] Cited for: SUMOYLATION AT LYS-289 AND LYS-423, MUTAGENESIS OF LYS-289 AND LYS-423. |
| [10] | "Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column." Imami K., Sugiyama N., Kyono Y., Tomita M., Ishihama Y. Anal. Sci. 24:161-166(2008) [PubMed: 18187866] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-54, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [11] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed: 18220336] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-414, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-414, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [13] | "The mutational spectrum in Waardenburg syndrome." Tassabehji M., Newton V.E., Liu X.-Z., Brady A., Donnai D., Krajewska-Walasek M., Murday V., Norman A., Obersztyn E., Reardon W., Rice J.C., Trembath R., Wieacker P., Whiteford M., Winter R., Read A.P. Hum. Mol. Genet. 4:2131-2137(1995) [PubMed: 8589691] [Abstract] Cited for: VARIANTS WS2A LYS-310; ARG-324 DEL; PRO-357; ASP-385 AND PRO-405. |
| [14] | "Tietz syndrome (hypopigmentation/deafness) caused by mutation of MITF." Smith S.D., Kelley P.M., Kenyon J.B., Hoover D. J. Med. Genet. 37:446-448(2000) [PubMed: 10851256] [Abstract] Cited for: VARIANT TIETZS LYS-317. Tissue: Blood. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB006909 mRNA. Translation: BAA32288.1. AB006989 mRNA. No translation available. Z29678 mRNA. Translation: CAA82775.1. AL110195 mRNA. Translation: CAB53672.1. BC026961 mRNA. Translation: AAH26961.1. BC065243 mRNA. Translation: AAH65243.1. AF034755 Genomic DNA. Translation: AAC39639.1. AB032359 Genomic DNA. Translation: BAA95208.1. AB032358 Genomic DNA. Translation: BAA95207.1. AB032357 Genomic DNA. Translation: BAA95206.1. AB009608 Genomic DNA. Translation: BAA95209.1. Different termination. |
| IPI | IPI00023896. IPI00215772. IPI00217203. IPI00217204. IPI00217206. IPI00217209. IPI00217210. IPI00217211. IPI00217212. IPI00293035. |
| PIR | I38024. T14752. |
| RefSeq | NP_000239.1. NM_000248.3. NP_001171896.1. NM_001184967.1. NP_006713.1. NM_006722.2. NP_937801.1. NM_198158.2. NP_937802.1. NM_198159.2. NP_937820.1. NM_198177.2. |
| UniGene | Hs.166017. Hs.618266. |
3D structure databases | |
| ProteinModelPortal | O75030. |
| SMR | O75030. Positions 309-373. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O75030. 3 interactions. |
| STRING | O75030. |
PTM databases | |
| PhosphoSite | O75030. |
Proteomic databases | |
| PRIDE | O75030. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000448226; ENSP00000391803; ENSG00000187098. |
| GeneID | 4286. |
| KEGG | hsa:4286. |
| UCSC | uc003dnz.1. human. uc003doa.1. human. uc003dob.1. human. uc003dod.1. human. uc003doe.1. human. uc003dof.1. human. |
Organism-specific databases | |
| CTD | 4286. |
| GeneCards | GC03P069871. |
| HGNC | HGNC:7105. MITF. |
| HPA | CAB002578. HPA003259. |
| MIM | 103470. phenotype. 103500. phenotype. 156845. gene. 193510. phenotype. |
| neXtProt | NX_O75030. |
| Orphanet | 42665. Tietz syndrome. 895. Waardenburg syndrome type 2. |
| PharmGKB | PA30823. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG09118. |
| GeneTree | ENSGT00390000004402. |
| HOGENOM | HBG716774. |
| HOVERGEN | HBG006768. |
| InParanoid | O75030. |
| OMA | ENCNQDL. |
| PhylomeDB | O75030. |
Enzyme and pathway databases | |
| Pathway_Interaction_DB | il6_7pathway. IL6-mediated signaling events. kitpathway. Signaling events mediated by Stem cell factor receptor (c-Kit). p38alphabetadownstreampathway. Signaling mediated by p38-alpha and p38-beta. |
Gene expression databases | |
| ArrayExpress | O75030. |
| Bgee | O75030. |
| CleanEx | HS_MITF. |
| Genevestigator | O75030. |
| GermOnline | ENSG00000187098. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR024097. bHLH_ZIP_TF. IPR021802. bHLH_ZIP_TF_MiT/TFE. IPR011598. HLH_DNA-bd. [Graphical view] |
| Gene3D | G3DSA:4.10.280.10. HLH_DNA_bd. 1 hit. |
| KO | K09455. |
| PANTHER | PTHR10014. PTHR10014. 1 hit. |
| Pfam | PF11851. DUF3371. 1 hit. PF00010. HLH. 1 hit. [Graphical view] |
| SMART | SM00353. HLH. 1 hit. [Graphical view] |
| SUPFAM | SSF47459. HLH_basic. 1 hit. |
| PROSITE | PS50888. HLH. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 16861. |
| PMAP-CutDB | O75030. |
| SOURCE | Search... |
Entry information
| Entry name | MITF_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O75030 Secondary accession number(s): Q14841 Q9P2Y8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with