Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Voltage-dependent L-type calcium channel subunit alpha-1D

Gene

CACNA1D

Organism
Gallus gallus (Chicken)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

The isoform alpha-1D gives rise to L-type calcium currents. Long-lasting (L-type) calcium channels belong to the 'high-voltage activated' (HVA) group.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei359Calcium ion selectivity and permeabilityBy similarity1
Sitei726Calcium ion selectivity and permeabilityBy similarity1
Sitei1122Calcium ion selectivity and permeabilityBy similarity1
Sitei1435Calcium ion selectivity and permeabilityBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Calcium bindingi1522 – 1533Sequence analysisAdd BLAST12

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Calcium channel, Ion channel, Voltage-gated channel

Keywords - Biological processi

Calcium transport, Ion transport, Transport

Keywords - Ligandi

Calcium, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Voltage-dependent L-type calcium channel subunit alpha-1D
Alternative name(s):
CHCACHA1D
Voltage-gated calcium channel subunit alpha Cav1.3
Gene namesi
Name:CACNA1D
OrganismiGallus gallus (Chicken)
Taxonomic identifieri9031 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiArchelosauriaArchosauriaDinosauriaSaurischiaTheropodaCoelurosauriaAvesNeognathaeGalloanseraeGalliformesPhasianidaePhasianinaeGallus
Proteomesi
  • UP000000539 Componenti: Unplaced

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 121CytoplasmicSequence analysisAdd BLAST121
Transmembranei122 – 140Helical; Name=S1 of repeat ISequence analysisAdd BLAST19
Topological domaini141 – 158ExtracellularSequence analysisAdd BLAST18
Transmembranei159 – 178Helical; Name=S2 of repeat ISequence analysisAdd BLAST20
Topological domaini179 – 190CytoplasmicSequence analysisAdd BLAST12
Transmembranei191 – 209Helical; Name=S3 of repeat ISequence analysisAdd BLAST19
Topological domaini210 – 230ExtracellularSequence analysisAdd BLAST21
Transmembranei231 – 249Helical; Name=S4 of repeat ISequence analysisAdd BLAST19
Topological domaini250 – 268CytoplasmicSequence analysisAdd BLAST19
Transmembranei269 – 288Helical; Name=S5 of repeat ISequence analysisAdd BLAST20
Topological domaini289 – 376ExtracellularSequence analysisAdd BLAST88
Transmembranei377 – 401Helical; Name=S6 of repeat ISequence analysisAdd BLAST25
Topological domaini402 – 544CytoplasmicSequence analysisAdd BLAST143
Transmembranei545 – 564Helical; Name=S1 of repeat IISequence analysisAdd BLAST20
Topological domaini565 – 579ExtracellularSequence analysisAdd BLAST15
Transmembranei580 – 598Helical; Name=S2 of repeat IISequence analysisAdd BLAST19
Topological domaini599 – 606CytoplasmicSequence analysis8
Transmembranei607 – 625Helical; Name=S3 of repeat IISequence analysisAdd BLAST19
Topological domaini626 – 635ExtracellularSequence analysis10
Transmembranei636 – 654Helical; Name=S4 of repeat IISequence analysisAdd BLAST19
Topological domaini655 – 673CytoplasmicSequence analysisAdd BLAST19
Transmembranei674 – 694Helical; Name=S5 of repeat IISequence analysisAdd BLAST21
Topological domaini695 – 748ExtracellularSequence analysisAdd BLAST54
Transmembranei749 – 773Helical; Name=S6 of repeat IISequence analysisAdd BLAST25
Topological domaini774 – 907CytoplasmicSequence analysisAdd BLAST134
Transmembranei908 – 926Helical; Name=S1 of repeat IIISequence analysisAdd BLAST19
Topological domaini927 – 942ExtracellularSequence analysisAdd BLAST16
Transmembranei943 – 962Helical; Name=S2 of repeat IIISequence analysisAdd BLAST20
Topological domaini963 – 974CytoplasmicSequence analysisAdd BLAST12
Transmembranei975 – 993Helical; Name=S3 of repeat IIISequence analysisAdd BLAST19
Topological domaini994 – 999ExtracellularSequence analysis6
Transmembranei1000 – 1019Helical; Name=S4 of repeat IIISequence analysisAdd BLAST20
Topological domaini1020 – 1038CytoplasmicSequence analysisAdd BLAST19
Transmembranei1039 – 1058Helical; Name=S5 of repeat IIISequence analysisAdd BLAST20
Topological domaini1059 – 1148ExtracellularSequence analysisAdd BLAST90
Transmembranei1149 – 1169Helical; Name=S6 of repeat IIISequence analysisAdd BLAST21
Topological domaini1170 – 1226CytoplasmicSequence analysisAdd BLAST57
Transmembranei1227 – 1245Helical; Name=S1 of repeat IVSequence analysisAdd BLAST19
Topological domaini1246 – 1260ExtracellularSequence analysisAdd BLAST15
Transmembranei1261 – 1280Helical; Name=S2 of repeat IVSequence analysisAdd BLAST20
Topological domaini1281 – 1297CytoplasmicSequence analysisAdd BLAST17
Transmembranei1298 – 1319Helical; Name=S3 of repeat IVSequence analysisAdd BLAST22
Topological domaini1320 – 1342ExtracellularSequence analysisAdd BLAST23
Transmembranei1343 – 1362Helical; Name=S4 of repeat IVSequence analysisAdd BLAST20
Topological domaini1363 – 1381CytoplasmicSequence analysisAdd BLAST19
Transmembranei1382 – 1401Helical; Name=S5 of repeat IVSequence analysisAdd BLAST20
Topological domaini1402 – 1468ExtracellularSequence analysisAdd BLAST67
Transmembranei1469 – 1493Helical; Name=S6 of repeat IVSequence analysisAdd BLAST25
Topological domaini1494 – 2190CytoplasmicSequence analysisAdd BLAST697

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000539371 – 2190Voltage-dependent L-type calcium channel subunit alpha-1DAdd BLAST2190

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi150N-linked (GlcNAc...)Sequence analysis1
Glycosylationi324N-linked (GlcNAc...)Sequence analysis1
Modified residuei1504Phosphoserine; by PKASequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiO73700.
PRIDEiO73700.

Expressioni

Tissue specificityi

Expressed in the basilar papilla of the cochlea.

Interactioni

Subunit structurei

Voltage-dependent calcium channels are multisubunit complexes, consisting of alpha-1, alpha-2, beta and delta subunits in a 1:1:1:1 ratio. The channel activity is directed by the pore-forming and voltage-sensitive alpha-1 subunit. In many cases, this subunit is sufficient to generate voltage-sensitive calcium channel activity. The auxiliary subunits beta and alpha-2/delta linked by a disulfide bridge regulate the channel activity (By similarity). Interacts with RIMBP2.By similarity

Protein-protein interaction databases

STRINGi9031.ENSGALP00000008540.

Structurei

3D structure databases

ProteinModelPortaliO73700.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati108 – 404IAdd BLAST297
Repeati530 – 776IIAdd BLAST247
Repeati894 – 1176IIIAdd BLAST283
Repeati1213 – 1496IVAdd BLAST284

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni424 – 441Binding to the beta subunitBy similarityAdd BLAST18
Regioni1096 – 1186Dihydropyridine bindingBy similarityAdd BLAST91
Regioni1449 – 1515Dihydropyridine bindingBy similarityAdd BLAST67
Regioni1461 – 1504Phenylalkylamine bindingBy similarityAdd BLAST44

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi5 – 8Poly-Gln4
Compositional biasi674 – 680Poly-Leu7
Compositional biasi1154 – 1160Poly-Ile7
Compositional biasi1703 – 1706Poly-Glu4

Domaini

Each of the four internal repeats contains five hydrophobic transmembrane segments (S1, S2, S3, S5, S6) and one positively charged transmembrane segment (S4). S4 segments probably represent the voltage-sensor and are characterized by a series of positively charged amino acids at every third position.

Sequence similaritiesi

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2301. Eukaryota.
ENOG410XNP6. LUCA.
GeneTreeiENSGT00830000128247.
HOGENOMiHOG000231529.
HOVERGENiHBG050763.
InParanoidiO73700.
KOiK04851.
PhylomeDBiO73700.

Family and domain databases

Gene3Di1.20.120.350. 5 hits.
InterProiIPR031688. CAC1F_C.
IPR027359. Channel_four-helix_dom.
IPR031649. GPHH_dom.
IPR005821. Ion_trans_dom.
IPR005452. LVDCC_a1dsu.
IPR014873. VDCC_a1su_IQ.
IPR005446. VDCC_L_a1su.
IPR002077. VDCCAlpha1.
[Graphical view]
PfamiPF08763. Ca_chan_IQ. 1 hit.
PF16885. CAC1F_C. 1 hit.
PF16905. GPHH. 1 hit.
PF00520. Ion_trans. 4 hits.
[Graphical view]
PRINTSiPR00167. CACHANNEL.
PR01630. LVDCCALPHA1.
PR01636. LVDCCALPHA1D.
SMARTiSM01062. Ca_chan_IQ. 1 hit.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O73700-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQHHQQQQPE QHPEEANYAS STRIPLPGDG PTTQSNSSAP SKQTVLSWQA
60 70 80 90 100
AIDAARQAKA AQNMNTTTAQ PVGSLSQRKR QQYAKSKKQG NTSNSRPPRA
110 120 130 140 150
LFCLSLNNPI RRACISLVEW KPFDIFILLS IFANCVALAV YIPFPEDDSN
160 170 180 190 200
STNHNLEKVE YAFLIIFTVE TFLKIIAYGL LLHPNAYVRN GWNLLDFVIV
210 220 230 240 250
VVGLFSVILE QLTKETEGGS HSGGKPGGFD VKALRAFRVL RPLRLVSGVP
260 270 280 290 300
SLQVVLNSII KAMVPLLHIA LLVLFVIIIY AIIGLELFIG KMHKSCFLID
310 320 330 340 350
SDILVEEDPA PCAFSGNGRQ CVMNGTECKG GWVGPNGGIT NFDNFAFAML
360 370 380 390 400
TVFQCITMEG WTDVLYWVND AIGCEWPWIY FVSLIILGSF FVLNLVLGVL
410 420 430 440 450
SGEFSKEREK AKARGDFQKL REKQQLEEDL KGYLDWITQA EDIDPENDEE
460 470 480 490 500
ADEEGKRNRV TLADLMEEKK KSRLSCFGRS SNKHASMPTS ETESVNTENV
510 520 530 540 550
SGEGENPACC GSLCQTISKS KFSRRWRRWN RFNRRKCRAA VKSVTFYWLV
560 570 580 590 600
IVLVFLNTLT ISSEHYNQPD WLTQIQDIAN KVLLALFTCE MLVKMYSLGL
610 620 630 640 650
QAYFVSLFNR FDCFVVCGGI VETILVELEI MSPLGISVFR CVRLLRIFKV
660 670 680 690 700
TRHWASLSNL VASLLNSMKS IASLLLLLFL FIIIFSLLGM QLFGGKFNFD
710 720 730 740 750
ETQTKRSTFD NFPQALLTVF QILTGEDWNA VMYDGIMAYG GPSSSGMIVC
760 770 780 790 800
IYFIILFICG NYILLNVFLA IAVDNLADAE SLNTAQKEEA EEKERKKNAR
810 820 830 840 850
KESLENKKSE KSEGDQKKPK DSKVTIAEYG EGEDEDKDPY PPCDVPVGED
860 870 880 890 900
EEDEEDEPEV PAGPRPRRIS ELNMKEKITP IPEGSAFFIF SSTNPIRVGC
910 920 930 940 950
HRLINHHIFT NLILVFIMLS SVSLAAEDPI RSHSFRNNIL GYADYVFTSM
960 970 980 990 1000
FTFEIILKMT AFGAFLHKGS FCRNYFNLLD LLVVGVSLVS FGIQSSAISV
1010 1020 1030 1040 1050
VKILRVLRVL RPLRAINRAK GLKHVVQCVF VAIRTIGNIM IVTTLLQFMF
1060 1070 1080 1090 1100
ACIGVQLFKG KFYKCTDEAK QNPEECRGIY IVYKDGDVDN PMVKERVWQN
1110 1120 1130 1140 1150
SDFNFDNVLS AMMALFTVST FEGWPALLYK AIDSNGENVG PVYNYRVEIS
1160 1170 1180 1190 1200
IFFIIYIIII AFFMMNIFVG FVIVTFQEQG EQEYKNCELD KNQRQCVEYA
1210 1220 1230 1240 1250
LKARPLRRYI PKNPYQYKFW YVVNSTGFEY IMFVLIMLNT LCLAMQHYGQ
1260 1270 1280 1290 1300
SKLFNDAMDI MNMVFTGVFT VEMVLKLIAF KPKIFVRKKE RWLGYFSDAW
1310 1320 1330 1340 1350
NTFDSLIVIG SIVDVVLSEA DPKPTETVTT DESGNSEDSA RISITFFRLF
1360 1370 1380 1390 1400
RVMRLVKLLS RGEGIRTLLW TFIKSFQALP YVALLIAMLF FIYAVIGMQV
1410 1420 1430 1440 1450
FGKVAMRDNN QINRNNNFQT FPQAVLLLFR CATGEAWQEI MLACLPGKRC
1460 1470 1480 1490 1500
DPESDYNPGE EYTCGSNFAI IYFISFYMLC AFLIINLFVA VIMDNFDYLT
1510 1520 1530 1540 1550
RDWSILGPHH LDEFKRIWSE YDPEAKGRIK HLDVVTLLRR IQPPLGFGKL
1560 1570 1580 1590 1600
CPHRVACKRL VAMNMPLNSD GTVMFNATLF ALVRTALKIK TEGNLEQANE
1610 1620 1630 1640 1650
ELRAVIKKIW KKTSMKLLDQ VVPPAGDDEV TVGKFYATFL IQDYFRKFKK
1660 1670 1680 1690 1700
RKEQGLVGKY PAKNTTIALQ AGLRTLHDIG PEIRRAISCD LQDDEPEENN
1710 1720 1730 1740 1750
PDEEEEVYKR NGALFGNHIN HISSDRRDSF QQINTTHRPL HVQRPSIPSA
1760 1770 1780 1790 1800
SDTEKNIYPH TGNSVYHNHH NHNSVGKQVP NSTNANLNNA NVSKVVHGKH
1810 1820 1830 1840 1850
ANFGSHEHRS ENGYHSYSRA DHEKRRRPSS RRTRYYETYI RSDSGDGRRP
1860 1870 1880 1890 1900
TICREERDIR DYCNDDHYLG EQEYYSGEEY YEEDSMLSGN RHVYDYHCRH
1910 1920 1930 1940 1950
HCHDSDFERP KGYHHPHGFF EEDDSQTCYD TKRSPRRRLL PPTPASNRRS
1960 1970 1980 1990 2000
SFNFECLRRQ SSQDDIPLSP NFHHRTALPL HLMQQQVMAV AGLDSSKAHK
2010 2020 2030 2040 2050
HSPSRSTRSW ATPPATPPNR DHTPYYTPLI QVDRAESTEH MNGSLPSLHR
2060 2070 2080 2090 2100
SSWYTDDPDI SYRTFTPANL TVPNDFRHKH SDKQRSADSL VEAVLISEGL
2110 2120 2130 2140 2150
GRYAKDPKFV SATKHEIADA CDMTIDEMES AASNLLNGNI SNGTNGDMFP
2160 2170 2180 2190
ILSRQDYELQ DFGPGYSDEE PEPGRYEEDL ADEMICITSL
Length:2,190
Mass (Da):249,344
Last modified:August 1, 1998 - v1
Checksum:i10680C1CB7708651
GO
Isoform 2 (identifier: O73700-2) [UniParc]FASTAAdd to basket
Also known as: IIIS2

The sequence of this isoform differs from the canonical sequence as follows:
     939-958: ILGYADYVFTSMFTFEIILK → ILGYFDYAFTAIFTVEILLK

Show »
Length:2,190
Mass (Da):249,310
Checksum:i5D51A01A2A9BF021
GO
Isoform 3 (identifier: O73700-3) [UniParc]FASTAAdd to basket
Also known as: IVS3

The sequence of this isoform differs from the canonical sequence as follows:
     1294-1321: GYFSDAWNTFDSLIVIGSIVDVVLSEAD → HYFTDAWNTFDALIVVGSVVDIAITEVN

Show »
Length:2,190
Mass (Da):249,421
Checksum:iFE395DA3FD0C8EB5
GO
Isoform 4 (identifier: O73700-4) [UniParc]FASTAAdd to basket
Also known as: IVS2-IVS3

The sequence of this isoform differs from the canonical sequence as follows:
     1284-1293: Missing.

Show »
Length:2,180
Mass (Da):247,987
Checksum:i6FE40271A0443CB9
GO
Isoform 5 (identifier: O73700-5) [UniParc]FASTAAdd to basket
Also known as: PSE29-31-2

The sequence of this isoform differs from the canonical sequence as follows:
     1671-1705: AGLRTLHDIGPEIRRAISCDLQDDEPEENNPDEEE → VLIAHTAQTPFCSPASKLFPFGAEAWLQRAAGVA
     1706-2190: Missing.

Show »
Length:1,704
Mass (Da):193,135
Checksum:i2DF59DFFAAB1EED9
GO
Isoform 6 (identifier: O73700-6) [UniParc]FASTAAdd to basket
Also known as: PSE29-31-1

The sequence of this isoform differs from the canonical sequence as follows:
     1710-1728: RNGALFGNHINHISSDRRD → VMSEHGYVIFLLCNMSFIE
     1729-2190: Missing.

Show »
Length:1,728
Mass (Da):196,290
Checksum:i4C3D0DC0F94A21D5
GO
Isoform 7 (identifier: O73700-7) [UniParc]FASTAAdd to basket
Also known as: PSE48, 154-1

The sequence of this isoform differs from the canonical sequence as follows:
     1892-1894: HVY → NGP
     1895-2190: Missing.

Show »
Length:1,894
Mass (Da):215,549
Checksum:i19993FAC5A7C58E9
GO
Isoform 8 (identifier: O73700-8) [UniParc]FASTAAdd to basket
Also known as: I-II-loop

The sequence of this isoform differs from the canonical sequence as follows:
     459-484: Missing.

Show »
Length:2,164
Mass (Da):246,341
Checksum:iEB44B49B6163C315
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_000927459 – 484Missing in isoform 8. CuratedAdd BLAST26
Alternative sequenceiVSP_000928939 – 958ILGYA…EIILK → ILGYFDYAFTAIFTVEILLK in isoform 2. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_0009291284 – 1293Missing in isoform 4. Curated10
Alternative sequenceiVSP_0009301294 – 1321GYFSD…LSEAD → HYFTDAWNTFDALIVVGSVV DIAITEVN in isoform 3. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_0009311671 – 1705AGLRT…PDEEE → VLIAHTAQTPFCSPASKLFP FGAEAWLQRAAGVA in isoform 5. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_0009321706 – 2190Missing in isoform 5. 1 PublicationAdd BLAST485
Alternative sequenceiVSP_0009331710 – 1728RNGAL…SDRRD → VMSEHGYVIFLLCNMSFIE in isoform 6. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_0009341729 – 2190Missing in isoform 6. 1 PublicationAdd BLAST462
Alternative sequenceiVSP_0009351892 – 1894HVY → NGP in isoform 7. Curated3
Alternative sequenceiVSP_0009361895 – 2190Missing in isoform 7. CuratedAdd BLAST296

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF027602 mRNA. Translation: AAC08304.1.
AF027603 mRNA. Translation: AAC08305.1.
AF027604 mRNA. Translation: AAC08306.1.
AF027605 mRNA. Translation: AAC08307.1.
AF027606 mRNA. Translation: AAC08308.1.
RefSeqiNP_990365.1. NM_205034.2. [O73700-1]
UniGeneiGga.51515.
Gga.51516.
Gga.52031.
Gga.528.

Genome annotation databases

EnsembliENSGALT00000036264; ENSGALP00000035486; ENSGALG00000005332. [O73700-1]
GeneIDi395895.
KEGGigga:395895.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF027602 mRNA. Translation: AAC08304.1.
AF027603 mRNA. Translation: AAC08305.1.
AF027604 mRNA. Translation: AAC08306.1.
AF027605 mRNA. Translation: AAC08307.1.
AF027606 mRNA. Translation: AAC08308.1.
RefSeqiNP_990365.1. NM_205034.2. [O73700-1]
UniGeneiGga.51515.
Gga.51516.
Gga.52031.
Gga.528.

3D structure databases

ProteinModelPortaliO73700.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9031.ENSGALP00000008540.

Proteomic databases

PaxDbiO73700.
PRIDEiO73700.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSGALT00000036264; ENSGALP00000035486; ENSGALG00000005332. [O73700-1]
GeneIDi395895.
KEGGigga:395895.

Organism-specific databases

CTDi776.

Phylogenomic databases

eggNOGiKOG2301. Eukaryota.
ENOG410XNP6. LUCA.
GeneTreeiENSGT00830000128247.
HOGENOMiHOG000231529.
HOVERGENiHBG050763.
InParanoidiO73700.
KOiK04851.
PhylomeDBiO73700.

Miscellaneous databases

PROiO73700.

Family and domain databases

Gene3Di1.20.120.350. 5 hits.
InterProiIPR031688. CAC1F_C.
IPR027359. Channel_four-helix_dom.
IPR031649. GPHH_dom.
IPR005821. Ion_trans_dom.
IPR005452. LVDCC_a1dsu.
IPR014873. VDCC_a1su_IQ.
IPR005446. VDCC_L_a1su.
IPR002077. VDCCAlpha1.
[Graphical view]
PfamiPF08763. Ca_chan_IQ. 1 hit.
PF16885. CAC1F_C. 1 hit.
PF16905. GPHH. 1 hit.
PF00520. Ion_trans. 4 hits.
[Graphical view]
PRINTSiPR00167. CACHANNEL.
PR01630. LVDCCALPHA1.
PR01636. LVDCCALPHA1D.
SMARTiSM01062. Ca_chan_IQ. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCAC1D_CHICK
AccessioniPrimary (citable) accession number: O73700
Secondary accession number(s): O73701
, O73702, O73703, O73704
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: August 1, 1998
Last modified: November 30, 2016
This is version 124 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.