Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Voltage-dependent L-type calcium channel subunit alpha-1D

Gene

CACNA1D

Organism
Gallus gallus (Chicken)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

The isoform alpha-1D gives rise to L-type calcium currents. Long-lasting (L-type) calcium channels belong to the 'high-voltage activated' (HVA) group.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei359 – 3591Calcium ion selectivity and permeabilityBy similarity
Sitei726 – 7261Calcium ion selectivity and permeabilityBy similarity
Sitei1122 – 11221Calcium ion selectivity and permeabilityBy similarity
Sitei1435 – 14351Calcium ion selectivity and permeabilityBy similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Calcium bindingi1522 – 153312Sequence analysisAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Calcium channel, Ion channel, Voltage-gated channel

Keywords - Biological processi

Calcium transport, Ion transport, Transport

Keywords - Ligandi

Calcium, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Voltage-dependent L-type calcium channel subunit alpha-1D
Alternative name(s):
CHCACHA1D
Voltage-gated calcium channel subunit alpha Cav1.3
Gene namesi
Name:CACNA1D
OrganismiGallus gallus (Chicken)
Taxonomic identifieri9031 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiArchelosauriaArchosauriaDinosauriaSaurischiaTheropodaCoelurosauriaAvesNeognathaeGalloanseraeGalliformesPhasianidaePhasianinaeGallus
Proteomesi
  • UP000000539 Componenti: Unplaced

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 121121CytoplasmicSequence analysisAdd
BLAST
Transmembranei122 – 14019Helical; Name=S1 of repeat ISequence analysisAdd
BLAST
Topological domaini141 – 15818ExtracellularSequence analysisAdd
BLAST
Transmembranei159 – 17820Helical; Name=S2 of repeat ISequence analysisAdd
BLAST
Topological domaini179 – 19012CytoplasmicSequence analysisAdd
BLAST
Transmembranei191 – 20919Helical; Name=S3 of repeat ISequence analysisAdd
BLAST
Topological domaini210 – 23021ExtracellularSequence analysisAdd
BLAST
Transmembranei231 – 24919Helical; Name=S4 of repeat ISequence analysisAdd
BLAST
Topological domaini250 – 26819CytoplasmicSequence analysisAdd
BLAST
Transmembranei269 – 28820Helical; Name=S5 of repeat ISequence analysisAdd
BLAST
Topological domaini289 – 37688ExtracellularSequence analysisAdd
BLAST
Transmembranei377 – 40125Helical; Name=S6 of repeat ISequence analysisAdd
BLAST
Topological domaini402 – 544143CytoplasmicSequence analysisAdd
BLAST
Transmembranei545 – 56420Helical; Name=S1 of repeat IISequence analysisAdd
BLAST
Topological domaini565 – 57915ExtracellularSequence analysisAdd
BLAST
Transmembranei580 – 59819Helical; Name=S2 of repeat IISequence analysisAdd
BLAST
Topological domaini599 – 6068CytoplasmicSequence analysis
Transmembranei607 – 62519Helical; Name=S3 of repeat IISequence analysisAdd
BLAST
Topological domaini626 – 63510ExtracellularSequence analysis
Transmembranei636 – 65419Helical; Name=S4 of repeat IISequence analysisAdd
BLAST
Topological domaini655 – 67319CytoplasmicSequence analysisAdd
BLAST
Transmembranei674 – 69421Helical; Name=S5 of repeat IISequence analysisAdd
BLAST
Topological domaini695 – 74854ExtracellularSequence analysisAdd
BLAST
Transmembranei749 – 77325Helical; Name=S6 of repeat IISequence analysisAdd
BLAST
Topological domaini774 – 907134CytoplasmicSequence analysisAdd
BLAST
Transmembranei908 – 92619Helical; Name=S1 of repeat IIISequence analysisAdd
BLAST
Topological domaini927 – 94216ExtracellularSequence analysisAdd
BLAST
Transmembranei943 – 96220Helical; Name=S2 of repeat IIISequence analysisAdd
BLAST
Topological domaini963 – 97412CytoplasmicSequence analysisAdd
BLAST
Transmembranei975 – 99319Helical; Name=S3 of repeat IIISequence analysisAdd
BLAST
Topological domaini994 – 9996ExtracellularSequence analysis
Transmembranei1000 – 101920Helical; Name=S4 of repeat IIISequence analysisAdd
BLAST
Topological domaini1020 – 103819CytoplasmicSequence analysisAdd
BLAST
Transmembranei1039 – 105820Helical; Name=S5 of repeat IIISequence analysisAdd
BLAST
Topological domaini1059 – 114890ExtracellularSequence analysisAdd
BLAST
Transmembranei1149 – 116921Helical; Name=S6 of repeat IIISequence analysisAdd
BLAST
Topological domaini1170 – 122657CytoplasmicSequence analysisAdd
BLAST
Transmembranei1227 – 124519Helical; Name=S1 of repeat IVSequence analysisAdd
BLAST
Topological domaini1246 – 126015ExtracellularSequence analysisAdd
BLAST
Transmembranei1261 – 128020Helical; Name=S2 of repeat IVSequence analysisAdd
BLAST
Topological domaini1281 – 129717CytoplasmicSequence analysisAdd
BLAST
Transmembranei1298 – 131922Helical; Name=S3 of repeat IVSequence analysisAdd
BLAST
Topological domaini1320 – 134223ExtracellularSequence analysisAdd
BLAST
Transmembranei1343 – 136220Helical; Name=S4 of repeat IVSequence analysisAdd
BLAST
Topological domaini1363 – 138119CytoplasmicSequence analysisAdd
BLAST
Transmembranei1382 – 140120Helical; Name=S5 of repeat IVSequence analysisAdd
BLAST
Topological domaini1402 – 146867ExtracellularSequence analysisAdd
BLAST
Transmembranei1469 – 149325Helical; Name=S6 of repeat IVSequence analysisAdd
BLAST
Topological domaini1494 – 2190697CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 21902190Voltage-dependent L-type calcium channel subunit alpha-1DPRO_0000053937Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi150 – 1501N-linked (GlcNAc...)Sequence analysis
Glycosylationi324 – 3241N-linked (GlcNAc...)Sequence analysis
Modified residuei1504 – 15041Phosphoserine; by PKASequence analysis

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiO73700.
PRIDEiO73700.

Expressioni

Tissue specificityi

Expressed in the basilar papilla of the cochlea.

Interactioni

Subunit structurei

Voltage-dependent calcium channels are multisubunit complexes, consisting of alpha-1, alpha-2, beta and delta subunits in a 1:1:1:1 ratio. The channel activity is directed by the pore-forming and voltage-sensitive alpha-1 subunit. In many cases, this subunit is sufficient to generate voltage-sensitive calcium channel activity. The auxiliary subunits beta and alpha-2/delta linked by a disulfide bridge regulate the channel activity (By similarity). Interacts with RIMBP2.By similarity

Protein-protein interaction databases

STRINGi9031.ENSGALP00000008540.

Structurei

3D structure databases

ProteinModelPortaliO73700.
SMRiO73700. Positions 1629-1657.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati108 – 404297IAdd
BLAST
Repeati530 – 776247IIAdd
BLAST
Repeati894 – 1176283IIIAdd
BLAST
Repeati1213 – 1496284IVAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni424 – 44118Binding to the beta subunitBy similarityAdd
BLAST
Regioni1096 – 118691Dihydropyridine bindingBy similarityAdd
BLAST
Regioni1449 – 151567Dihydropyridine bindingBy similarityAdd
BLAST
Regioni1461 – 150444Phenylalkylamine bindingBy similarityAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi5 – 84Poly-Gln
Compositional biasi674 – 6807Poly-Leu
Compositional biasi1154 – 11607Poly-Ile
Compositional biasi1703 – 17064Poly-Glu

Domaini

Each of the four internal repeats contains five hydrophobic transmembrane segments (S1, S2, S3, S5, S6) and one positively charged transmembrane segment (S4). S4 segments probably represent the voltage-sensor and are characterized by a series of positively charged amino acids at every third position.

Sequence similaritiesi

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2301. Eukaryota.
ENOG410XNP6. LUCA.
HOGENOMiHOG000231529.
HOVERGENiHBG050763.
InParanoidiO73700.
KOiK04851.
PhylomeDBiO73700.

Family and domain databases

Gene3Di1.20.120.350. 5 hits.
InterProiIPR031688. CAC1F_C.
IPR027359. Channel_four-helix_dom.
IPR031649. GPHH_dom.
IPR005821. Ion_trans_dom.
IPR005452. LVDCC_a1dsu.
IPR014873. VDCC_a1su_IQ.
IPR005446. VDCC_L_a1su.
IPR002077. VDCCAlpha1.
[Graphical view]
PfamiPF08763. Ca_chan_IQ. 1 hit.
PF16885. CAC1F_C. 1 hit.
PF16905. GPHH. 1 hit.
PF00520. Ion_trans. 4 hits.
[Graphical view]
PRINTSiPR00167. CACHANNEL.
PR01630. LVDCCALPHA1.
PR01636. LVDCCALPHA1D.
SMARTiSM01062. Ca_chan_IQ. 1 hit.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O73700-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQHHQQQQPE QHPEEANYAS STRIPLPGDG PTTQSNSSAP SKQTVLSWQA
60 70 80 90 100
AIDAARQAKA AQNMNTTTAQ PVGSLSQRKR QQYAKSKKQG NTSNSRPPRA
110 120 130 140 150
LFCLSLNNPI RRACISLVEW KPFDIFILLS IFANCVALAV YIPFPEDDSN
160 170 180 190 200
STNHNLEKVE YAFLIIFTVE TFLKIIAYGL LLHPNAYVRN GWNLLDFVIV
210 220 230 240 250
VVGLFSVILE QLTKETEGGS HSGGKPGGFD VKALRAFRVL RPLRLVSGVP
260 270 280 290 300
SLQVVLNSII KAMVPLLHIA LLVLFVIIIY AIIGLELFIG KMHKSCFLID
310 320 330 340 350
SDILVEEDPA PCAFSGNGRQ CVMNGTECKG GWVGPNGGIT NFDNFAFAML
360 370 380 390 400
TVFQCITMEG WTDVLYWVND AIGCEWPWIY FVSLIILGSF FVLNLVLGVL
410 420 430 440 450
SGEFSKEREK AKARGDFQKL REKQQLEEDL KGYLDWITQA EDIDPENDEE
460 470 480 490 500
ADEEGKRNRV TLADLMEEKK KSRLSCFGRS SNKHASMPTS ETESVNTENV
510 520 530 540 550
SGEGENPACC GSLCQTISKS KFSRRWRRWN RFNRRKCRAA VKSVTFYWLV
560 570 580 590 600
IVLVFLNTLT ISSEHYNQPD WLTQIQDIAN KVLLALFTCE MLVKMYSLGL
610 620 630 640 650
QAYFVSLFNR FDCFVVCGGI VETILVELEI MSPLGISVFR CVRLLRIFKV
660 670 680 690 700
TRHWASLSNL VASLLNSMKS IASLLLLLFL FIIIFSLLGM QLFGGKFNFD
710 720 730 740 750
ETQTKRSTFD NFPQALLTVF QILTGEDWNA VMYDGIMAYG GPSSSGMIVC
760 770 780 790 800
IYFIILFICG NYILLNVFLA IAVDNLADAE SLNTAQKEEA EEKERKKNAR
810 820 830 840 850
KESLENKKSE KSEGDQKKPK DSKVTIAEYG EGEDEDKDPY PPCDVPVGED
860 870 880 890 900
EEDEEDEPEV PAGPRPRRIS ELNMKEKITP IPEGSAFFIF SSTNPIRVGC
910 920 930 940 950
HRLINHHIFT NLILVFIMLS SVSLAAEDPI RSHSFRNNIL GYADYVFTSM
960 970 980 990 1000
FTFEIILKMT AFGAFLHKGS FCRNYFNLLD LLVVGVSLVS FGIQSSAISV
1010 1020 1030 1040 1050
VKILRVLRVL RPLRAINRAK GLKHVVQCVF VAIRTIGNIM IVTTLLQFMF
1060 1070 1080 1090 1100
ACIGVQLFKG KFYKCTDEAK QNPEECRGIY IVYKDGDVDN PMVKERVWQN
1110 1120 1130 1140 1150
SDFNFDNVLS AMMALFTVST FEGWPALLYK AIDSNGENVG PVYNYRVEIS
1160 1170 1180 1190 1200
IFFIIYIIII AFFMMNIFVG FVIVTFQEQG EQEYKNCELD KNQRQCVEYA
1210 1220 1230 1240 1250
LKARPLRRYI PKNPYQYKFW YVVNSTGFEY IMFVLIMLNT LCLAMQHYGQ
1260 1270 1280 1290 1300
SKLFNDAMDI MNMVFTGVFT VEMVLKLIAF KPKIFVRKKE RWLGYFSDAW
1310 1320 1330 1340 1350
NTFDSLIVIG SIVDVVLSEA DPKPTETVTT DESGNSEDSA RISITFFRLF
1360 1370 1380 1390 1400
RVMRLVKLLS RGEGIRTLLW TFIKSFQALP YVALLIAMLF FIYAVIGMQV
1410 1420 1430 1440 1450
FGKVAMRDNN QINRNNNFQT FPQAVLLLFR CATGEAWQEI MLACLPGKRC
1460 1470 1480 1490 1500
DPESDYNPGE EYTCGSNFAI IYFISFYMLC AFLIINLFVA VIMDNFDYLT
1510 1520 1530 1540 1550
RDWSILGPHH LDEFKRIWSE YDPEAKGRIK HLDVVTLLRR IQPPLGFGKL
1560 1570 1580 1590 1600
CPHRVACKRL VAMNMPLNSD GTVMFNATLF ALVRTALKIK TEGNLEQANE
1610 1620 1630 1640 1650
ELRAVIKKIW KKTSMKLLDQ VVPPAGDDEV TVGKFYATFL IQDYFRKFKK
1660 1670 1680 1690 1700
RKEQGLVGKY PAKNTTIALQ AGLRTLHDIG PEIRRAISCD LQDDEPEENN
1710 1720 1730 1740 1750
PDEEEEVYKR NGALFGNHIN HISSDRRDSF QQINTTHRPL HVQRPSIPSA
1760 1770 1780 1790 1800
SDTEKNIYPH TGNSVYHNHH NHNSVGKQVP NSTNANLNNA NVSKVVHGKH
1810 1820 1830 1840 1850
ANFGSHEHRS ENGYHSYSRA DHEKRRRPSS RRTRYYETYI RSDSGDGRRP
1860 1870 1880 1890 1900
TICREERDIR DYCNDDHYLG EQEYYSGEEY YEEDSMLSGN RHVYDYHCRH
1910 1920 1930 1940 1950
HCHDSDFERP KGYHHPHGFF EEDDSQTCYD TKRSPRRRLL PPTPASNRRS
1960 1970 1980 1990 2000
SFNFECLRRQ SSQDDIPLSP NFHHRTALPL HLMQQQVMAV AGLDSSKAHK
2010 2020 2030 2040 2050
HSPSRSTRSW ATPPATPPNR DHTPYYTPLI QVDRAESTEH MNGSLPSLHR
2060 2070 2080 2090 2100
SSWYTDDPDI SYRTFTPANL TVPNDFRHKH SDKQRSADSL VEAVLISEGL
2110 2120 2130 2140 2150
GRYAKDPKFV SATKHEIADA CDMTIDEMES AASNLLNGNI SNGTNGDMFP
2160 2170 2180 2190
ILSRQDYELQ DFGPGYSDEE PEPGRYEEDL ADEMICITSL
Length:2,190
Mass (Da):249,344
Last modified:August 1, 1998 - v1
Checksum:i10680C1CB7708651
GO
Isoform 2 (identifier: O73700-2) [UniParc]FASTAAdd to basket

Also known as: IIIS2

The sequence of this isoform differs from the canonical sequence as follows:
     939-958: ILGYADYVFTSMFTFEIILK → ILGYFDYAFTAIFTVEILLK

Show »
Length:2,190
Mass (Da):249,310
Checksum:i5D51A01A2A9BF021
GO
Isoform 3 (identifier: O73700-3) [UniParc]FASTAAdd to basket

Also known as: IVS3

The sequence of this isoform differs from the canonical sequence as follows:
     1294-1321: GYFSDAWNTFDSLIVIGSIVDVVLSEAD → HYFTDAWNTFDALIVVGSVVDIAITEVN

Show »
Length:2,190
Mass (Da):249,421
Checksum:iFE395DA3FD0C8EB5
GO
Isoform 4 (identifier: O73700-4) [UniParc]FASTAAdd to basket

Also known as: IVS2-IVS3

The sequence of this isoform differs from the canonical sequence as follows:
     1284-1293: Missing.

Show »
Length:2,180
Mass (Da):247,987
Checksum:i6FE40271A0443CB9
GO
Isoform 5 (identifier: O73700-5) [UniParc]FASTAAdd to basket

Also known as: PSE29-31-2

The sequence of this isoform differs from the canonical sequence as follows:
     1671-1705: AGLRTLHDIGPEIRRAISCDLQDDEPEENNPDEEE → VLIAHTAQTPFCSPASKLFPFGAEAWLQRAAGVA
     1706-2190: Missing.

Show »
Length:1,704
Mass (Da):193,135
Checksum:i2DF59DFFAAB1EED9
GO
Isoform 6 (identifier: O73700-6) [UniParc]FASTAAdd to basket

Also known as: PSE29-31-1

The sequence of this isoform differs from the canonical sequence as follows:
     1710-1728: RNGALFGNHINHISSDRRD → VMSEHGYVIFLLCNMSFIE
     1729-2190: Missing.

Show »
Length:1,728
Mass (Da):196,290
Checksum:i4C3D0DC0F94A21D5
GO
Isoform 7 (identifier: O73700-7) [UniParc]FASTAAdd to basket

Also known as: PSE48, 154-1

The sequence of this isoform differs from the canonical sequence as follows:
     1892-1894: HVY → NGP
     1895-2190: Missing.

Show »
Length:1,894
Mass (Da):215,549
Checksum:i19993FAC5A7C58E9
GO
Isoform 8 (identifier: O73700-8) [UniParc]FASTAAdd to basket

Also known as: I-II-loop

The sequence of this isoform differs from the canonical sequence as follows:
     459-484: Missing.

Show »
Length:2,164
Mass (Da):246,341
Checksum:iEB44B49B6163C315
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei459 – 48426Missing in isoform 8. CuratedVSP_000927Add
BLAST
Alternative sequencei939 – 95820ILGYA…EIILK → ILGYFDYAFTAIFTVEILLK in isoform 2. 1 PublicationVSP_000928Add
BLAST
Alternative sequencei1284 – 129310Missing in isoform 4. CuratedVSP_000929
Alternative sequencei1294 – 132128GYFSD…LSEAD → HYFTDAWNTFDALIVVGSVV DIAITEVN in isoform 3. 1 PublicationVSP_000930Add
BLAST
Alternative sequencei1671 – 170535AGLRT…PDEEE → VLIAHTAQTPFCSPASKLFP FGAEAWLQRAAGVA in isoform 5. 1 PublicationVSP_000931Add
BLAST
Alternative sequencei1706 – 2190485Missing in isoform 5. 1 PublicationVSP_000932Add
BLAST
Alternative sequencei1710 – 172819RNGAL…SDRRD → VMSEHGYVIFLLCNMSFIE in isoform 6. 1 PublicationVSP_000933Add
BLAST
Alternative sequencei1729 – 2190462Missing in isoform 6. 1 PublicationVSP_000934Add
BLAST
Alternative sequencei1892 – 18943HVY → NGP in isoform 7. CuratedVSP_000935
Alternative sequencei1895 – 2190296Missing in isoform 7. CuratedVSP_000936Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF027602 mRNA. Translation: AAC08304.1.
AF027603 mRNA. Translation: AAC08305.1.
AF027604 mRNA. Translation: AAC08306.1.
AF027605 mRNA. Translation: AAC08307.1.
AF027606 mRNA. Translation: AAC08308.1.
RefSeqiNP_990365.1. NM_205034.2. [O73700-1]
UniGeneiGga.51515.
Gga.51516.
Gga.52031.
Gga.528.

Genome annotation databases

GeneIDi395895.
KEGGigga:395895.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF027602 mRNA. Translation: AAC08304.1.
AF027603 mRNA. Translation: AAC08305.1.
AF027604 mRNA. Translation: AAC08306.1.
AF027605 mRNA. Translation: AAC08307.1.
AF027606 mRNA. Translation: AAC08308.1.
RefSeqiNP_990365.1. NM_205034.2. [O73700-1]
UniGeneiGga.51515.
Gga.51516.
Gga.52031.
Gga.528.

3D structure databases

ProteinModelPortaliO73700.
SMRiO73700. Positions 1629-1657.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9031.ENSGALP00000008540.

Proteomic databases

PaxDbiO73700.
PRIDEiO73700.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi395895.
KEGGigga:395895.

Organism-specific databases

CTDi776.

Phylogenomic databases

eggNOGiKOG2301. Eukaryota.
ENOG410XNP6. LUCA.
HOGENOMiHOG000231529.
HOVERGENiHBG050763.
InParanoidiO73700.
KOiK04851.
PhylomeDBiO73700.

Miscellaneous databases

NextBioi20815960.
PROiO73700.

Family and domain databases

Gene3Di1.20.120.350. 5 hits.
InterProiIPR031688. CAC1F_C.
IPR027359. Channel_four-helix_dom.
IPR031649. GPHH_dom.
IPR005821. Ion_trans_dom.
IPR005452. LVDCC_a1dsu.
IPR014873. VDCC_a1su_IQ.
IPR005446. VDCC_L_a1su.
IPR002077. VDCCAlpha1.
[Graphical view]
PfamiPF08763. Ca_chan_IQ. 1 hit.
PF16885. CAC1F_C. 1 hit.
PF16905. GPHH. 1 hit.
PF00520. Ion_trans. 4 hits.
[Graphical view]
PRINTSiPR00167. CACHANNEL.
PR01630. LVDCCALPHA1.
PR01636. LVDCCALPHA1D.
SMARTiSM01062. Ca_chan_IQ. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Predominance of the alpha1D subunit in L-type voltage-gated Ca2+ channels of hair cells in the chicken's cochlea."
    Kollmar R., Montgomery L.G., Fak J., Henry L.J., Hudspeth A.J.
    Proc. Natl. Acad. Sci. U.S.A. 94:14883-14888(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 5 AND 6).
    Tissue: Brain.
  2. "Hair cell-specific splicing of mRNA for the alpha1D subunit of voltage-gated Ca2+ channels in the chicken's cochlea."
    Kollmar R., Fak J., Montgomery L.G., Hudspeth A.J.
    Proc. Natl. Acad. Sci. U.S.A. 94:14889-14893(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: ALTERNATIVE SPLICING.

Entry informationi

Entry nameiCAC1D_CHICK
AccessioniPrimary (citable) accession number: O73700
Secondary accession number(s): O73701
, O73702, O73703, O73704
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: August 1, 1998
Last modified: February 17, 2016
This is version 121 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.