Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O70355

- BTNL2_MOUSE

UniProt

O70355 - BTNL2_MOUSE

Protein

Butyrophilin-like protein 2

Gene

Btnl2

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 100 (01 Oct 2014)
      Sequence version 2 (09 Jan 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Negative regulator of T-cell proliferation.2 Publications

    GO - Molecular functioni

    1. receptor binding Source: MGI

    GO - Biological processi

    1. negative regulation of T cell receptor signaling pathway Source: MGI
    2. positive regulation of interleukin-2 secretion Source: MGI
    3. positive regulation of T cell proliferation Source: MGI

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Butyrophilin-like protein 2
    Gene namesi
    Name:Btnl2
    Synonyms:Gm315, Ng9
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 17

    Organism-specific databases

    MGIiMGI:1859549. Btnl2.

    Subcellular locationi

    Membrane By similarity; Single-pass type II membrane protein By similarity

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 454454Butyrophilin-like protein 2PRO_0000014538Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi50 ↔ 124PROSITE-ProRule annotation
    Disulfide bondi164 ↔ 218PROSITE-ProRule annotation
    Glycosylationi210 – 2101N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi267 ↔ 341PROSITE-ProRule annotation
    Glycosylationi296 – 2961N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi381 ↔ 435PROSITE-ProRule annotation
    Glycosylationi427 – 4271N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi432 – 4321N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    MaxQBiO70355.
    PRIDEiO70355.

    PTM databases

    PhosphoSiteiO70355.

    Expressioni

    Tissue specificityi

    Highly expressed in intestine and at reduced levels in lung and stomach. Also expressed in thymus, spleen, lymph nodes, T-cells, B-cells, and macrophages.2 Publications

    Gene expression databases

    ArrayExpressiO70355.
    BgeeiO70355.
    CleanExiMM_BTNL2.
    GenevestigatoriO70355.

    Structurei

    3D structure databases

    ProteinModelPortaliO70355.
    SMRiO70355. Positions 29-235, 244-445.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 66CytoplasmicSequence Analysis
    Topological domaini24 – 454431ExtracellularSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei7 – 2317Helical; Signal-anchor for type II membrane proteinSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini27 – 140114Ig-like V-type 1Add
    BLAST
    Domaini148 – 23487Ig-like V-type 2Add
    BLAST
    Domaini244 – 355112Ig-like V-type 3Add
    BLAST
    Domaini365 – 45288Ig-like V-type 4Add
    BLAST

    Sequence similaritiesi

    Keywords - Domaini

    Immunoglobulin domain, Repeat, Signal-anchor, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG131805.
    GeneTreeiENSGT00750000117499.
    HOVERGENiHBG054868.
    InParanoidiA6X8K1.
    OMAiWCRFQEG.
    OrthoDBiEOG73804F.
    PhylomeDBiO70355.
    TreeFamiTF331083.

    Family and domain databases

    Gene3Di2.60.40.10. 3 hits.
    InterProiIPR013162. CD80_C2-set.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    IPR013106. Ig_V-set.
    IPR003596. Ig_V-set_subgr.
    [Graphical view]
    PfamiPF08205. C2-set_2. 2 hits.
    PF07686. V-set. 2 hits.
    [Graphical view]
    SMARTiSM00409. IG. 1 hit.
    SM00406. IGv. 1 hit.
    [Graphical view]
    PROSITEiPS50835. IG_LIKE. 4 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O70355-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MVDCPRYSLS GVAASFLFVL LTIKHPDDFR VVGPNLPILA KVGEDALLTC    50
    QLLPKRTTAH MEVRWYRSDP DMPVIMYRDG AEVTGLPMEG YGGRAEWMED 100
    STEEGSVALK IRQVQPSDDG QYWCRFQEGD YWRETSVLLQ VAALGSSPNI 150
    HVEGLGEGEV QLVCTSRGWF PEPEVHWEGI WGEKLMSFSE NHVPGEDGLF 200
    YVEDTLMVRN DSVETISCFI YSHGLRETQE ATIALSERLQ TELASVSVIG 250
    HSQPSPVQVG ENIELTCHLS PQTDAQNLEV RWLRSRYYPA VHVYANGTHV 300
    AGEQMVEYKG RTSLVTDAIH EGKLTLQIHN ARTSDEGQYR CLFGKDGVYQ 350
    EARVDVQVMA VGSTPRITRE VLKDGGMQLR CTSDGWFPRP HVQWRDRDGK 400
    TMPSFSEAFQ QGSQELFQVE TLLLVTNGSM VNVTCSISLP LGQEKTARFP 450
    LSGW 454
    Length:454
    Mass (Da):50,894
    Last modified:January 9, 2007 - v2
    Checksum:iCE09E537F72CF123
    GO
    Isoform 2 (identifier: O70355-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         453-454: GW → DSKIALLWMTLPVVVLPLAMAIDLIKVKRWRRTNEQTHSSNQENNKNDENHRRRLPSDERLR

    Note: No experimental confirmation available.

    Show »
    Length:514
    Mass (Da):58,038
    Checksum:i338128421138120A
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei453 – 4542GW → DSKIALLWMTLPVVVLPLAM AIDLIKVKRWRRTNEQTHSS NQENNKNDENHRRRLPSDER LR in isoform 2. 1 PublicationVSP_022147

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK136521 mRNA. Translation: BAE23022.1.
    AF050157 Genomic DNA. Translation: AAC05288.1. Different termination.
    CR974457 Genomic DNA. Translation: CAO77746.1.
    CCDSiCCDS37585.1. [O70355-2]
    RefSeqiNP_524574.1. NM_079835.2. [O70355-2]
    UniGeneiMm.441007.

    Genome annotation databases

    EnsembliENSMUST00000025198; ENSMUSP00000025198; ENSMUSG00000024340. [O70355-2]
    GeneIDi547431.
    KEGGimmu:547431.
    UCSCiuc008ccl.1. mouse. [O70355-2]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK136521 mRNA. Translation: BAE23022.1 .
    AF050157 Genomic DNA. Translation: AAC05288.1 . Different termination.
    CR974457 Genomic DNA. Translation: CAO77746.1 .
    CCDSi CCDS37585.1. [O70355-2 ]
    RefSeqi NP_524574.1. NM_079835.2. [O70355-2 ]
    UniGenei Mm.441007.

    3D structure databases

    ProteinModelPortali O70355.
    SMRi O70355. Positions 29-235, 244-445.
    ModBasei Search...
    MobiDBi Search...

    PTM databases

    PhosphoSitei O70355.

    Proteomic databases

    MaxQBi O70355.
    PRIDEi O70355.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000025198 ; ENSMUSP00000025198 ; ENSMUSG00000024340 . [O70355-2 ]
    GeneIDi 547431.
    KEGGi mmu:547431.
    UCSCi uc008ccl.1. mouse. [O70355-2 ]

    Organism-specific databases

    CTDi 56244.
    MGIi MGI:1859549. Btnl2.

    Phylogenomic databases

    eggNOGi NOG131805.
    GeneTreei ENSGT00750000117499.
    HOVERGENi HBG054868.
    InParanoidi A6X8K1.
    OMAi WCRFQEG.
    OrthoDBi EOG73804F.
    PhylomeDBi O70355.
    TreeFami TF331083.

    Miscellaneous databases

    NextBioi 414293.
    PROi O70355.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O70355.
    Bgeei O70355.
    CleanExi MM_BTNL2.
    Genevestigatori O70355.

    Family and domain databases

    Gene3Di 2.60.40.10. 3 hits.
    InterProi IPR013162. CD80_C2-set.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    IPR013106. Ig_V-set.
    IPR003596. Ig_V-set_subgr.
    [Graphical view ]
    Pfami PF08205. C2-set_2. 2 hits.
    PF07686. V-set. 2 hits.
    [Graphical view ]
    SMARTi SM00409. IG. 1 hit.
    SM00406. IGv. 1 hit.
    [Graphical view ]
    PROSITEi PS50835. IG_LIKE. 4 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Strain: C57BL/6J.
      Tissue: Cecum.
    2. "Sequence of the mouse major histocompatibility class II region."
      Rowen L., Qin S., Loretz C., Mix L., Lasky S., Madan A., Hood L.
      Submitted (FEB-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: 129.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    4. "BTNL2, a butyrophilin-like molecule that functions to inhibit T cell activation."
      Nguyen T., Liu X.K., Zhang Y., Dong C.
      J. Immunol. 176:7354-7360(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, TISSUE SPECIFICITY.
    5. "BTNL2, a butyrophilin/B7-like molecule, is a negative costimulatory molecule modulated in intestinal inflammation."
      Arnett H.A., Escobar S.S., Gonzalez-Suarez E., Budelsky A.L., Steffen L.A., Boiani N., Zhang M., Siu G., Brewer A.W., Viney J.L.
      J. Immunol. 178:1523-1533(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiBTNL2_MOUSE
    AccessioniPrimary (citable) accession number: O70355
    Secondary accession number(s): A6X8K1, Q3UW94
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 1, 2005
    Last sequence update: January 9, 2007
    Last modified: October 1, 2014
    This is version 100 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3