SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O70355

- BTNL2_MOUSE

UniProt

O70355 - BTNL2_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Butyrophilin-like protein 2
Gene
Btnl2, Gm315, Ng9
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at transcript leveli

Functioni

Negative regulator of T-cell proliferation.2 Publications

GO - Molecular functioni

  1. receptor binding Source: MGI

GO - Biological processi

  1. negative regulation of T cell receptor signaling pathway Source: MGI
  2. positive regulation of T cell proliferation Source: MGI
  3. positive regulation of interleukin-2 secretion Source: MGI
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Butyrophilin-like protein 2
Gene namesi
Name:Btnl2
Synonyms:Gm315, Ng9
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 17

Organism-specific databases

MGIiMGI:1859549. Btnl2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 66Cytoplasmic Reviewed prediction
Transmembranei7 – 2317Helical; Signal-anchor for type II membrane protein; Reviewed prediction
Add
BLAST
Topological domaini24 – 454431Extracellular Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 454454Butyrophilin-like protein 2
PRO_0000014538Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi50 ↔ 124 By similarity
Disulfide bondi164 ↔ 218 By similarity
Glycosylationi210 – 2101N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi267 ↔ 341 By similarity
Glycosylationi296 – 2961N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi381 ↔ 435 By similarity
Glycosylationi427 – 4271N-linked (GlcNAc...) Reviewed prediction
Glycosylationi432 – 4321N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiO70355.
PRIDEiO70355.

PTM databases

PhosphoSiteiO70355.

Expressioni

Tissue specificityi

Highly expressed in intestine and at reduced levels in lung and stomach. Also expressed in thymus, spleen, lymph nodes, T-cells, B-cells, and macrophages.2 Publications

Gene expression databases

ArrayExpressiO70355.
BgeeiO70355.
CleanExiMM_BTNL2.
GenevestigatoriO70355.

Structurei

3D structure databases

ProteinModelPortaliO70355.
SMRiO70355. Positions 29-235, 244-445.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini27 – 140114Ig-like V-type 1
Add
BLAST
Domaini148 – 23487Ig-like V-type 2
Add
BLAST
Domaini244 – 355112Ig-like V-type 3
Add
BLAST
Domaini365 – 45288Ig-like V-type 4
Add
BLAST

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG131805.
GeneTreeiENSGT00750000117499.
HOVERGENiHBG054868.
InParanoidiA6X8K1.
OMAiWCRFQEG.
OrthoDBiEOG73804F.
PhylomeDBiO70355.
TreeFamiTF331083.

Family and domain databases

Gene3Di2.60.40.10. 3 hits.
InterProiIPR013162. CD80_C2-set.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
IPR003596. Ig_V-set_subgr.
[Graphical view]
PfamiPF08205. C2-set_2. 2 hits.
PF07686. V-set. 2 hits.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
SM00406. IGv. 1 hit.
[Graphical view]
PROSITEiPS50835. IG_LIKE. 4 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O70355-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MVDCPRYSLS GVAASFLFVL LTIKHPDDFR VVGPNLPILA KVGEDALLTC    50
QLLPKRTTAH MEVRWYRSDP DMPVIMYRDG AEVTGLPMEG YGGRAEWMED 100
STEEGSVALK IRQVQPSDDG QYWCRFQEGD YWRETSVLLQ VAALGSSPNI 150
HVEGLGEGEV QLVCTSRGWF PEPEVHWEGI WGEKLMSFSE NHVPGEDGLF 200
YVEDTLMVRN DSVETISCFI YSHGLRETQE ATIALSERLQ TELASVSVIG 250
HSQPSPVQVG ENIELTCHLS PQTDAQNLEV RWLRSRYYPA VHVYANGTHV 300
AGEQMVEYKG RTSLVTDAIH EGKLTLQIHN ARTSDEGQYR CLFGKDGVYQ 350
EARVDVQVMA VGSTPRITRE VLKDGGMQLR CTSDGWFPRP HVQWRDRDGK 400
TMPSFSEAFQ QGSQELFQVE TLLLVTNGSM VNVTCSISLP LGQEKTARFP 450
LSGW 454
Length:454
Mass (Da):50,894
Last modified:January 9, 2007 - v2
Checksum:iCE09E537F72CF123
GO
Isoform 2 (identifier: O70355-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     453-454: GW → DSKIALLWMTLPVVVLPLAMAIDLIKVKRWRRTNEQTHSSNQENNKNDENHRRRLPSDERLR

Note: No experimental confirmation available.

Show »
Length:514
Mass (Da):58,038
Checksum:i338128421138120A
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei453 – 4542GW → DSKIALLWMTLPVVVLPLAM AIDLIKVKRWRRTNEQTHSS NQENNKNDENHRRRLPSDER LR in isoform 2.
VSP_022147

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK136521 mRNA. Translation: BAE23022.1.
AF050157 Genomic DNA. Translation: AAC05288.1. Different termination.
CR974457 Genomic DNA. Translation: CAO77746.1.
CCDSiCCDS37585.1. [O70355-2]
RefSeqiNP_524574.1. NM_079835.2. [O70355-2]
UniGeneiMm.441007.

Genome annotation databases

EnsembliENSMUST00000025198; ENSMUSP00000025198; ENSMUSG00000024340. [O70355-2]
GeneIDi547431.
KEGGimmu:547431.
UCSCiuc008ccl.1. mouse. [O70355-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK136521 mRNA. Translation: BAE23022.1 .
AF050157 Genomic DNA. Translation: AAC05288.1 . Different termination.
CR974457 Genomic DNA. Translation: CAO77746.1 .
CCDSi CCDS37585.1. [O70355-2 ]
RefSeqi NP_524574.1. NM_079835.2. [O70355-2 ]
UniGenei Mm.441007.

3D structure databases

ProteinModelPortali O70355.
SMRi O70355. Positions 29-235, 244-445.
ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei O70355.

Proteomic databases

MaxQBi O70355.
PRIDEi O70355.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000025198 ; ENSMUSP00000025198 ; ENSMUSG00000024340 . [O70355-2 ]
GeneIDi 547431.
KEGGi mmu:547431.
UCSCi uc008ccl.1. mouse. [O70355-2 ]

Organism-specific databases

CTDi 56244.
MGIi MGI:1859549. Btnl2.

Phylogenomic databases

eggNOGi NOG131805.
GeneTreei ENSGT00750000117499.
HOVERGENi HBG054868.
InParanoidi A6X8K1.
OMAi WCRFQEG.
OrthoDBi EOG73804F.
PhylomeDBi O70355.
TreeFami TF331083.

Miscellaneous databases

NextBioi 414293.
PROi O70355.
SOURCEi Search...

Gene expression databases

ArrayExpressi O70355.
Bgeei O70355.
CleanExi MM_BTNL2.
Genevestigatori O70355.

Family and domain databases

Gene3Di 2.60.40.10. 3 hits.
InterProi IPR013162. CD80_C2-set.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
IPR003596. Ig_V-set_subgr.
[Graphical view ]
Pfami PF08205. C2-set_2. 2 hits.
PF07686. V-set. 2 hits.
[Graphical view ]
SMARTi SM00409. IG. 1 hit.
SM00406. IGv. 1 hit.
[Graphical view ]
PROSITEi PS50835. IG_LIKE. 4 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: C57BL/6J.
    Tissue: Cecum.
  2. "Sequence of the mouse major histocompatibility class II region."
    Rowen L., Qin S., Loretz C., Mix L., Lasky S., Madan A., Hood L.
    Submitted (FEB-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: 129.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  4. "BTNL2, a butyrophilin-like molecule that functions to inhibit T cell activation."
    Nguyen T., Liu X.K., Zhang Y., Dong C.
    J. Immunol. 176:7354-7360(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY.
  5. "BTNL2, a butyrophilin/B7-like molecule, is a negative costimulatory molecule modulated in intestinal inflammation."
    Arnett H.A., Escobar S.S., Gonzalez-Suarez E., Budelsky A.L., Steffen L.A., Boiani N., Zhang M., Siu G., Brewer A.W., Viney J.L.
    J. Immunol. 178:1523-1533(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY.

Entry informationi

Entry nameiBTNL2_MOUSE
AccessioniPrimary (citable) accession number: O70355
Secondary accession number(s): A6X8K1, Q3UW94
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 2005
Last sequence update: January 9, 2007
Last modified: July 9, 2014
This is version 99 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi