Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O70355

- BTNL2_MOUSE

UniProt

O70355 - BTNL2_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Butyrophilin-like protein 2

Gene

Btnl2

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli

Functioni

Negative regulator of T-cell proliferation.2 Publications

GO - Molecular functioni

  1. receptor binding Source: MGI

GO - Biological processi

  1. negative regulation of T cell receptor signaling pathway Source: MGI
  2. positive regulation of interleukin-2 secretion Source: MGI
  3. positive regulation of T cell proliferation Source: MGI
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Butyrophilin-like protein 2
Gene namesi
Name:Btnl2
Synonyms:Gm315, Ng9
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 17

Organism-specific databases

MGIiMGI:1859549. Btnl2.

Subcellular locationi

Membrane By similarity; Single-pass type II membrane protein By similarity

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 66CytoplasmicSequence Analysis
Transmembranei7 – 2317Helical; Signal-anchor for type II membrane proteinSequence AnalysisAdd
BLAST
Topological domaini24 – 454431ExtracellularSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 454454Butyrophilin-like protein 2PRO_0000014538Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi50 ↔ 124PROSITE-ProRule annotation
Disulfide bondi164 ↔ 218PROSITE-ProRule annotation
Glycosylationi210 – 2101N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi267 ↔ 341PROSITE-ProRule annotation
Glycosylationi296 – 2961N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi381 ↔ 435PROSITE-ProRule annotation
Glycosylationi427 – 4271N-linked (GlcNAc...)Sequence Analysis
Glycosylationi432 – 4321N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiO70355.
PRIDEiO70355.

PTM databases

PhosphoSiteiO70355.

Expressioni

Tissue specificityi

Highly expressed in intestine and at reduced levels in lung and stomach. Also expressed in thymus, spleen, lymph nodes, T-cells, B-cells, and macrophages.2 Publications

Gene expression databases

BgeeiO70355.
CleanExiMM_BTNL2.
ExpressionAtlasiO70355. baseline.
GenevestigatoriO70355.

Structurei

3D structure databases

ProteinModelPortaliO70355.
SMRiO70355. Positions 29-235, 244-445.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini27 – 140114Ig-like V-type 1Add
BLAST
Domaini148 – 23487Ig-like V-type 2Add
BLAST
Domaini244 – 355112Ig-like V-type 3Add
BLAST
Domaini365 – 45288Ig-like V-type 4Add
BLAST

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG131805.
GeneTreeiENSGT00760000118933.
HOVERGENiHBG054868.
InParanoidiO70355.
OMAiWCRFQEG.
OrthoDBiEOG73804F.
PhylomeDBiO70355.
TreeFamiTF331083.

Family and domain databases

Gene3Di2.60.40.10. 3 hits.
InterProiIPR013162. CD80_C2-set.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
IPR003596. Ig_V-set_subgr.
[Graphical view]
PfamiPF08205. C2-set_2. 2 hits.
PF07686. V-set. 2 hits.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
SM00406. IGv. 1 hit.
[Graphical view]
PROSITEiPS50835. IG_LIKE. 4 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O70355-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVDCPRYSLS GVAASFLFVL LTIKHPDDFR VVGPNLPILA KVGEDALLTC
60 70 80 90 100
QLLPKRTTAH MEVRWYRSDP DMPVIMYRDG AEVTGLPMEG YGGRAEWMED
110 120 130 140 150
STEEGSVALK IRQVQPSDDG QYWCRFQEGD YWRETSVLLQ VAALGSSPNI
160 170 180 190 200
HVEGLGEGEV QLVCTSRGWF PEPEVHWEGI WGEKLMSFSE NHVPGEDGLF
210 220 230 240 250
YVEDTLMVRN DSVETISCFI YSHGLRETQE ATIALSERLQ TELASVSVIG
260 270 280 290 300
HSQPSPVQVG ENIELTCHLS PQTDAQNLEV RWLRSRYYPA VHVYANGTHV
310 320 330 340 350
AGEQMVEYKG RTSLVTDAIH EGKLTLQIHN ARTSDEGQYR CLFGKDGVYQ
360 370 380 390 400
EARVDVQVMA VGSTPRITRE VLKDGGMQLR CTSDGWFPRP HVQWRDRDGK
410 420 430 440 450
TMPSFSEAFQ QGSQELFQVE TLLLVTNGSM VNVTCSISLP LGQEKTARFP

LSGW
Length:454
Mass (Da):50,894
Last modified:January 9, 2007 - v2
Checksum:iCE09E537F72CF123
GO
Isoform 2 (identifier: O70355-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     453-454: GW → DSKIALLWMTLPVVVLPLAMAIDLIKVKRWRRTNEQTHSSNQENNKNDENHRRRLPSDERLR

Note: No experimental confirmation available.

Show »
Length:514
Mass (Da):58,038
Checksum:i338128421138120A
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei453 – 4542GW → DSKIALLWMTLPVVVLPLAM AIDLIKVKRWRRTNEQTHSS NQENNKNDENHRRRLPSDER LR in isoform 2. 1 PublicationVSP_022147

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK136521 mRNA. Translation: BAE23022.1.
AF050157 Genomic DNA. Translation: AAC05288.1. Different termination.
CR974457 Genomic DNA. Translation: CAO77746.1.
CCDSiCCDS37585.1. [O70355-2]
RefSeqiNP_524574.1. NM_079835.2. [O70355-2]
UniGeneiMm.441007.

Genome annotation databases

EnsembliENSMUST00000025198; ENSMUSP00000025198; ENSMUSG00000024340. [O70355-2]
GeneIDi547431.
KEGGimmu:547431.
UCSCiuc008ccl.1. mouse. [O70355-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK136521 mRNA. Translation: BAE23022.1 .
AF050157 Genomic DNA. Translation: AAC05288.1 . Different termination.
CR974457 Genomic DNA. Translation: CAO77746.1 .
CCDSi CCDS37585.1. [O70355-2 ]
RefSeqi NP_524574.1. NM_079835.2. [O70355-2 ]
UniGenei Mm.441007.

3D structure databases

ProteinModelPortali O70355.
SMRi O70355. Positions 29-235, 244-445.
ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei O70355.

Proteomic databases

MaxQBi O70355.
PRIDEi O70355.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000025198 ; ENSMUSP00000025198 ; ENSMUSG00000024340 . [O70355-2 ]
GeneIDi 547431.
KEGGi mmu:547431.
UCSCi uc008ccl.1. mouse. [O70355-2 ]

Organism-specific databases

CTDi 56244.
MGIi MGI:1859549. Btnl2.

Phylogenomic databases

eggNOGi NOG131805.
GeneTreei ENSGT00760000118933.
HOVERGENi HBG054868.
InParanoidi O70355.
OMAi WCRFQEG.
OrthoDBi EOG73804F.
PhylomeDBi O70355.
TreeFami TF331083.

Miscellaneous databases

NextBioi 414293.
PROi O70355.
SOURCEi Search...

Gene expression databases

Bgeei O70355.
CleanExi MM_BTNL2.
ExpressionAtlasi O70355. baseline.
Genevestigatori O70355.

Family and domain databases

Gene3Di 2.60.40.10. 3 hits.
InterProi IPR013162. CD80_C2-set.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
IPR003596. Ig_V-set_subgr.
[Graphical view ]
Pfami PF08205. C2-set_2. 2 hits.
PF07686. V-set. 2 hits.
[Graphical view ]
SMARTi SM00409. IG. 1 hit.
SM00406. IGv. 1 hit.
[Graphical view ]
PROSITEi PS50835. IG_LIKE. 4 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: C57BL/6J.
    Tissue: Cecum.
  2. "Sequence of the mouse major histocompatibility class II region."
    Rowen L., Qin S., Loretz C., Mix L., Lasky S., Madan A., Hood L.
    Submitted (FEB-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: 129.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  4. "BTNL2, a butyrophilin-like molecule that functions to inhibit T cell activation."
    Nguyen T., Liu X.K., Zhang Y., Dong C.
    J. Immunol. 176:7354-7360(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY.
  5. "BTNL2, a butyrophilin/B7-like molecule, is a negative costimulatory molecule modulated in intestinal inflammation."
    Arnett H.A., Escobar S.S., Gonzalez-Suarez E., Budelsky A.L., Steffen L.A., Boiani N., Zhang M., Siu G., Brewer A.W., Viney J.L.
    J. Immunol. 178:1523-1533(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY.

Entry informationi

Entry nameiBTNL2_MOUSE
AccessioniPrimary (citable) accession number: O70355
Secondary accession number(s): A6X8K1, Q3UW94
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 2005
Last sequence update: January 9, 2007
Last modified: October 29, 2014
This is version 101 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3