Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O70355 (BTNL2_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 97. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Butyrophilin-like protein 2
Gene names
Name:Btnl2
Synonyms:Gm315, Ng9
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length454 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Negative regulator of T-cell proliferation. Ref.4 Ref.5

Subcellular location

Membrane; Single-pass type II membrane protein By similarity.

Tissue specificity

Highly expressed in intestine and at reduced levels in lung and stomach. Also expressed in thymus, spleen, lymph nodes, T-cells, B-cells, and macrophages. Ref.4 Ref.5

Sequence similarities

Belongs to the immunoglobulin superfamily. BTN/MOG family.

Contains 4 Ig-like V-type (immunoglobulin-like) domains.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: O70355-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O70355-2)

The sequence of this isoform differs from the canonical sequence as follows:
     453-454: GW → DSKIALLWMTLPVVVLPLAMAIDLIKVKRWRRTNEQTHSSNQENNKNDENHRRRLPSDERLR
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 454454Butyrophilin-like protein 2
PRO_0000014538

Regions

Topological domain1 – 66Cytoplasmic Potential
Transmembrane7 – 2317Helical; Signal-anchor for type II membrane protein; Potential
Topological domain24 – 454431Extracellular Potential
Domain27 – 140114Ig-like V-type 1
Domain148 – 23487Ig-like V-type 2
Domain244 – 355112Ig-like V-type 3
Domain365 – 45288Ig-like V-type 4

Amino acid modifications

Glycosylation2101N-linked (GlcNAc...) Potential
Glycosylation2961N-linked (GlcNAc...) Potential
Glycosylation4271N-linked (GlcNAc...) Potential
Glycosylation4321N-linked (GlcNAc...) Potential
Disulfide bond50 ↔ 124 By similarity
Disulfide bond164 ↔ 218 By similarity
Disulfide bond267 ↔ 341 By similarity
Disulfide bond381 ↔ 435 By similarity

Natural variations

Alternative sequence453 – 4542GW → DSKIALLWMTLPVVVLPLAM AIDLIKVKRWRRTNEQTHSS NQENNKNDENHRRRLPSDER LR in isoform 2.
VSP_022147

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified January 9, 2007. Version 2.
Checksum: CE09E537F72CF123

FASTA45450,894
        10         20         30         40         50         60 
MVDCPRYSLS GVAASFLFVL LTIKHPDDFR VVGPNLPILA KVGEDALLTC QLLPKRTTAH 

        70         80         90        100        110        120 
MEVRWYRSDP DMPVIMYRDG AEVTGLPMEG YGGRAEWMED STEEGSVALK IRQVQPSDDG 

       130        140        150        160        170        180 
QYWCRFQEGD YWRETSVLLQ VAALGSSPNI HVEGLGEGEV QLVCTSRGWF PEPEVHWEGI 

       190        200        210        220        230        240 
WGEKLMSFSE NHVPGEDGLF YVEDTLMVRN DSVETISCFI YSHGLRETQE ATIALSERLQ 

       250        260        270        280        290        300 
TELASVSVIG HSQPSPVQVG ENIELTCHLS PQTDAQNLEV RWLRSRYYPA VHVYANGTHV 

       310        320        330        340        350        360 
AGEQMVEYKG RTSLVTDAIH EGKLTLQIHN ARTSDEGQYR CLFGKDGVYQ EARVDVQVMA 

       370        380        390        400        410        420 
VGSTPRITRE VLKDGGMQLR CTSDGWFPRP HVQWRDRDGK TMPSFSEAFQ QGSQELFQVE 

       430        440        450 
TLLLVTNGSM VNVTCSISLP LGQEKTARFP LSGW 

« Hide

Isoform 2 [UniParc].

Checksum: 338128421138120A
Show »

FASTA51458,038

References

« Hide 'large scale' references
[1]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Strain: C57BL/6J.
Tissue: Cecum.
[2]"Sequence of the mouse major histocompatibility class II region."
Rowen L., Qin S., Loretz C., Mix L., Lasky S., Madan A., Hood L.
Submitted (FEB-1998) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: 129.
[3]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[4]"BTNL2, a butyrophilin-like molecule that functions to inhibit T cell activation."
Nguyen T., Liu X.K., Zhang Y., Dong C.
J. Immunol. 176:7354-7360(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, TISSUE SPECIFICITY.
[5]"BTNL2, a butyrophilin/B7-like molecule, is a negative costimulatory molecule modulated in intestinal inflammation."
Arnett H.A., Escobar S.S., Gonzalez-Suarez E., Budelsky A.L., Steffen L.A., Boiani N., Zhang M., Siu G., Brewer A.W., Viney J.L.
J. Immunol. 178:1523-1533(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, TISSUE SPECIFICITY.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK136521 mRNA. Translation: BAE23022.1.
AF050157 Genomic DNA. Translation: AAC05288.1. Different termination.
CR974457 Genomic DNA. Translation: CAO77746.1.
RefSeqNP_524574.1. NM_079835.2.
UniGeneMm.441007.

3D structure databases

ProteinModelPortalO70355.
SMRO70355. Positions 29-235, 244-445.
ModBaseSearch...
MobiDBSearch...

PTM databases

PhosphoSiteO70355.

Proteomic databases

PRIDEO70355.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000025198; ENSMUSP00000025198; ENSMUSG00000024340. [O70355-2]
GeneID547431.
KEGGmmu:547431.
UCSCuc008ccl.1. mouse. [O70355-2]

Organism-specific databases

CTD56244.
MGIMGI:1859549. Btnl2.

Phylogenomic databases

eggNOGNOG131805.
GeneTreeENSGT00750000117499.
HOVERGENHBG054868.
InParanoidA6X8K1.
OMAWCRFQEG.
OrthoDBEOG73804F.
PhylomeDBO70355.
TreeFamTF331083.

Gene expression databases

ArrayExpressO70355.
BgeeO70355.
CleanExMM_BTNL2.
GenevestigatorO70355.

Family and domain databases

Gene3D2.60.40.10. 3 hits.
InterProIPR013162. CD80_C2-set.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
IPR003596. Ig_V-set_subgr.
[Graphical view]
PfamPF08205. C2-set_2. 2 hits.
PF07686. V-set. 2 hits.
[Graphical view]
SMARTSM00409. IG. 1 hit.
SM00406. IGv. 1 hit.
[Graphical view]
PROSITEPS50835. IG_LIKE. 4 hits.
[Graphical view]
ProtoNetSearch...

Other

NextBio414293.
PROO70355.
SOURCESearch...

Entry information

Entry nameBTNL2_MOUSE
AccessionPrimary (citable) accession number: O70355
Secondary accession number(s): A6X8K1, Q3UW94
Entry history
Integrated into UniProtKB/Swiss-Prot: February 1, 2005
Last sequence update: January 9, 2007
Last modified: April 16, 2014
This is version 97 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot