O70293 (GRK6_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 124.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: G protein-coupled receptor kinase 6 EC=2.7.11.16 Alternative name(s): G protein-coupled receptor kinase GRK6 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 576 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Specifically phosphorylates the activated forms of G protein-coupled receptors. Such receptor phosphorylation initiates beta-arrestin-mediated receptor desensitization, internalization, and signaling events leading to their desensitization. Seems to be involved in the desensitization of D2-like dopamine receptors in striatum and chemokine receptor CXCR4 which is critical for CXCL12-induced cell chemotaxis By similarity. Phosphorylates rhodopsin (RHO) (in vitro) and a non G-protein-coupled receptor, LRP6 during Wnt signaling (in vitro) By similarity. Ref.4 Ref.5 Ref.6 |
| Catalytic activity | ATP + [G-protein-coupled receptor] = ADP + [G-protein-coupled receptor] phosphate. |
| Subcellular location | |
| Tissue specificity | Expressed in the brain in striatal neurons. Ref.6 |
| Disruption phenotype | Deficient mice show significant altered central dopamine receptors regulation, deficient lymphocyte chemotaxis and increased acute inflammation and neutrophil chemotaxis. Ref.4 Ref.5 Ref.6 |
| Sequence similarities | Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. GPRK subfamily. Contains 1 AGC-kinase C-terminal domain. Contains 1 protein kinase domain. Contains 1 RGS domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Wnt signaling pathway |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Kinase Serine/threonine-protein kinase Transferase |
| PTM | Lipoprotein Palmitate Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | Wnt receptor signaling pathway Inferred from electronic annotation. Source: UniProtKB-KW termination of G-protein coupled receptor signaling pathwayInferred from electronic annotation. Source: InterPro |
| Cellular_component | membrane Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW G-protein coupled receptor kinase activityInferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform GRK6A (identifier: O70293-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform GRK6B (identifier: O70293-2) The sequence of this isoform differs from the canonical sequence as follows: 560-576: DCCGNCSDSEEELPTRL → RIAVGTAATVRKSSPPASSPQAEAPTGGWR |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 576 | 576 | G protein-coupled receptor kinase 6 | PRO_0000085975 | |||||
Regions | |||||||||
| Domain | 53 – 171 | 119 | RGS | ||||||
| Domain | 186 – 448 | 263 | Protein kinase | ||||||
| Domain | 449 – 514 | 66 | AGC-kinase C-terminal | ||||||
| Nucleotide binding | 192 – 200 | 9 | ATP By similarity | ||||||
| Nucleotide binding | 264 – 270 | 7 | ATP By similarity | ||||||
| Nucleotide binding | 315 – 318 | 4 | ATP By similarity | ||||||
| Region | 1 – 185 | 185 | N-terminal | ||||||
Sites | |||||||||
| Active site | 311 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 215 | 1 | ATP By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 484 | 1 | Phosphoserine; by autocatalysis By similarity | ||||||
| Modified residue | 485 | 1 | Phosphothreonine; by autocatalysis By similarity | ||||||
| Lipidation | 561 | 1 | S-palmitoyl cysteine By similarity | ||||||
| Lipidation | 562 | 1 | S-palmitoyl cysteine By similarity | ||||||
| Lipidation | 565 | 1 | S-palmitoyl cysteine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 560 – 576 | 17 | DCCGN…LPTRL → RIAVGTAATVRKSSPPASSP QAEAPTGGWR in isoform GRK6B. | VSP_004939 | |||||
Experimental info | |||||||||
| Sequence conflict | 98 | 1 | R → Q in AAC09265. Ref.1 | ||||||
| Sequence conflict | 571 | 1 | E → K in AAC09265. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The GRK4 subfamily of G protein-coupled receptor kinases. Alternative splicing, gene organization, and sequence conservation." Premont R.T., Macrae A.D., Aparicio S.A., Kendall H.E., Welch J.E., Lefkowitz R.J. J. Biol. Chem. 274:29381-29389(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS GRK6A AND GRK6B). Strain: 129/SvJ. |
| [2] | "Primary structure of murine G-protein-coupled receptor kinase 6 splice variants predict differential regulation by posttranslational modifications." Moepps B., Vatter P., Frode R., Waechter F., Gierschik P. Submitted (SEP-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS GRK6A AND GRK6B). Strain: 129/SvJ and C57BL/6J. Tissue: Thymus. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM GRK6B). Strain: 129. Tissue: Mammary gland. |
| [4] | "Defective lymphocyte chemotaxis in beta-arrestin2- and GRK6-deficient mice." Fong A.M., Premont R.T., Richardson R.M., Yu Y.R., Lefkowitz R.J., Patel D.D. Proc. Natl. Acad. Sci. U.S.A. 99:7478-7483(2002) [PubMed] [Europe PMC] [Abstract] Cited for: DISRUPTION PHENOTYPE, FUNCTION. |
| [5] | "Increased acute inflammation, leukotriene B4-induced chemotaxis, and signaling in mice deficient for G protein-coupled receptor kinase 6." Kavelaars A., Vroon A., Raatgever R.P., Fong A.M., Premont R.T., Patel D.D., Lefkowitz R.J., Heijnen C.J. J. Immunol. 171:6128-6134(2003) [PubMed] [Europe PMC] [Abstract] Cited for: DISRUPTION PHENOTYPE, FUNCTION. |
| [6] | "Dopaminergic supersensitivity in G protein-coupled receptor kinase 6-deficient mice." Gainetdinov R.R., Bohn L.M., Sotnikova T.D., Cyr M., Laakso A., Macrae A.D., Torres G.E., Kim K.M., Lefkowitz R.J., Caron M.G., Premont R.T. Neuron 38:291-303(2003) [PubMed] [Europe PMC] [Abstract] Cited for: DISRUPTION PHENOTYPE, FUNCTION, TISSUE SPECIFICITY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF040747 mRNA. Translation: AAC09268.1. AF040748 mRNA. Translation: AAC09269.1. AF040749 mRNA. Translation: AAC09270.1. AF040754 Genomic DNA. Translation: AAC09265.1. Y17967 Genomic DNA. Translation: CAA76975.1. Y17967 Genomic DNA. Translation: CAA76976.1. Y15798 mRNA. Translation: CAA75789.1. Y15799 mRNA. Translation: CAA75790.1. BC075719 mRNA. Translation: AAH75719.1. |
| IPI | IPI00230631. IPI00467856. |
| RefSeq | NP_001033107.1. NM_001038018.3. NP_001106182.1. NM_001112711.1. NP_036068.2. NM_011938.3. |
| UniGene | Mm.10193. |
3D structure databases | |
| ProteinModelPortal | O70293. |
| SMR | O70293. Positions 2-557. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-1793102. |
PTM databases | |
| PhosphoSite | O70293. |
Proteomic databases | |
| PaxDb | O70293. |
| PRIDE | O70293. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000001115; ENSMUSP00000001115; ENSMUSG00000074886. |
| GeneID | 26385. |
| KEGG | mmu:26385. |
| UCSC | uc011yzt.1. mouse. |
Organism-specific databases | |
| CTD | 2870. |
| MGI | MGI:1347078. Grk6. |
Phylogenomic databases | |
| eggNOG | COG0515. |
| GeneTree | ENSGT00550000074318. |
| HOGENOM | HOG000006742. |
| HOVERGEN | HBG004532. |
| InParanoid | Q6DI67. |
| KO | K08291. |
| OMA | PFKPDPQ. |
| OrthoDB | EOG4HHP24. |
Gene expression databases | |
| ArrayExpress | O70293. |
| Bgee | O70293. |
| CleanEx | MM_GRK6. |
| Genevestigator | O70293. |
| GermOnline | ENSMUSG00000074886. Mus musculus. |
Family and domain databases | |
| InterPro | IPR000961. AGC-kinase_C. IPR000239. GPCR_kinase. IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR000342. Regulat_G_prot_signal. IPR016137. Regulat_G_prot_signal_superfam. IPR002290. Ser/Thr_dual-sp_kinase_dom. IPR008271. Ser/Thr_kinase_AS. [Graphical view] |
| Pfam | PF00069. Pkinase. 1 hit. PF00615. RGS. 1 hit. [Graphical view] |
| PRINTS | PR00717. GPCRKINASE. |
| SMART | SM00315. RGS. 1 hit. SM00133. S_TK_X. 1 hit. SM00220. S_TKc. 1 hit. [Graphical view] |
| SUPFAM | SSF56112. Kinase_like. 1 hit. SSF48097. Regulat_G_prot_signal_superfam. 1 hit. |
| PROSITE | PS51285. AGC_KINASE_CTER. 1 hit. PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. PS50132. RGS. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 304313. |
| SOURCE | Search... |
Entry information
| Entry name | GRK6_MOUSE | ||||||||
| Accession | Primary (citable) accession number: O70293 Secondary accession number(s): O70294, O70295, Q6DI67 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
