SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O70293

- GRK6_MOUSE

UniProt

O70293 - GRK6_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
G protein-coupled receptor kinase 6
Gene
Grk6, Gprk6
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Specifically phosphorylates the activated forms of G protein-coupled receptors. Such receptor phosphorylation initiates beta-arrestin-mediated receptor desensitization, internalization, and signaling events leading to their desensitization. Seems to be involved in the desensitization of D2-like dopamine receptors in striatum and chemokine receptor CXCR4 which is critical for CXCL12-induced cell chemotaxis By similarity. Phosphorylates rhodopsin (RHO) (in vitro) and a non G-protein-coupled receptor, LRP6 during Wnt signaling (in vitro) By similarity.3 Publications

Catalytic activityi

ATP + [G-protein-coupled receptor] = ADP + [G-protein-coupled receptor] phosphate.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei215 – 2151ATP By similarity
Active sitei311 – 3111Proton acceptor By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi192 – 2009ATP By similarity
Nucleotide bindingi264 – 2707ATP By similarity
Nucleotide bindingi315 – 3184ATP By similarity

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. G-protein coupled receptor kinase activity Source: UniProtKB-EC
  3. protein binding Source: IntAct
Complete GO annotation...

GO - Biological processi

  1. Wnt signaling pathway Source: UniProtKB-KW
  2. termination of G-protein coupled receptor signaling pathway Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Biological processi

Wnt signaling pathway

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
G protein-coupled receptor kinase 6 (EC:2.7.11.16)
Alternative name(s):
G protein-coupled receptor kinase GRK6
Gene namesi
Name:Grk6
Synonyms:Gprk6
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 13

Organism-specific databases

MGIiMGI:1347078. Grk6.

Subcellular locationi

GO - Cellular componenti

  1. membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Disruption phenotypei

Deficient mice show significant altered central dopamine receptors regulation, deficient lymphocyte chemotaxis and increased acute inflammation and neutrophil chemotaxis.3 Publications

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 576576G protein-coupled receptor kinase 6
PRO_0000085975Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei484 – 4841Phosphoserine; by autocatalysis By similarity
Modified residuei485 – 4851Phosphothreonine; by autocatalysis By similarity
Lipidationi561 – 5611S-palmitoyl cysteine By similarity
Lipidationi562 – 5621S-palmitoyl cysteine By similarity
Lipidationi565 – 5651S-palmitoyl cysteine By similarity

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

PaxDbiO70293.
PRIDEiO70293.

PTM databases

PhosphoSiteiO70293.

Expressioni

Tissue specificityi

Expressed in the brain in striatal neurons.1 Publication

Gene expression databases

ArrayExpressiO70293.
BgeeiO70293.
CleanExiMM_GRK6.
GenevestigatoriO70293.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
SLC9A3R1Q286195EBI-7073604,EBI-7073613From a different organism.

Protein-protein interaction databases

IntActiO70293. 3 interactions.
MINTiMINT-1793102.

Structurei

3D structure databases

ProteinModelPortaliO70293.
SMRiO70293. Positions 2-557.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini53 – 171119RGS
Add
BLAST
Domaini186 – 448263Protein kinase
Add
BLAST
Domaini449 – 51466AGC-kinase C-terminal
Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 185185N-terminal
Add
BLAST

Sequence similaritiesi

Contains 1 RGS domain.

Phylogenomic databases

eggNOGiCOG0515.
GeneTreeiENSGT00730000110512.
HOGENOMiHOG000006742.
HOVERGENiHBG004532.
InParanoidiQ6DI67.
KOiK08291.
OMAiMLEPPFK.
OrthoDBiEOG7V1FQK.
PhylomeDBiO70293.
TreeFamiTF313940.

Family and domain databases

InterProiIPR000961. AGC-kinase_C.
IPR000239. GPCR_kinase.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR016137. Regulat_G_prot_signal_superfam.
IPR000342. RGS_dom.
IPR002290. Ser/Thr_dual-sp_kinase_dom.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF00069. Pkinase. 1 hit.
PF00615. RGS. 1 hit.
[Graphical view]
PRINTSiPR00717. GPCRKINASE.
SMARTiSM00315. RGS. 1 hit.
SM00133. S_TK_X. 1 hit.
SM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF48097. SSF48097. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEiPS51285. AGC_KINASE_CTER. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
PS50132. RGS. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform GRK6A (identifier: O70293-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MELENIVANT VLLKAREGGG GNRKGKSKKW RQMLQFPHIS QCEELRLSLE    50
RDYHSLCERQ PIGRLLFREF CATRPELTRC TAFLDGVSEY EVTPDEKRKA 100
CGRRLMQNFL SHTGPDLIPE VPRQLVSNCA QRLEQGPCKD LFQELTRLTH 150
EYLSTAPFAD YLDSIYFNRF LQWKWLERQP VTKNTFRQYR VLGKGGFGEV 200
CACQVRATGK MYACKKLEKK RIKKRKGEAM ALNEKQILEK VNSRFVVSLA 250
YAYETKDALC LVLTLMNGGD LKFHIYHMGQ AGFPEARAVF YAAEICCGLE 300
DLHRERIVYR DLKPENILLD DHGHIRISDL GLAVHVPEGQ TIKGRVGTVG 350
YMAPEVVRNE RYTFSPDWWA LGCLLYEMIA GQSPFQQRKK KIKREEVERL 400
VKEVAEEYTD RFSSQARSLC SQLLSKDPAE RLGCRGGGAR EVKEHPLFKK 450
LNFKRLGAGM LEPPFKPDPQ AIYCKDVLDI EQFSTVKGVD LEPTDQDFYQ 500
KFATGSVSIP WQNEMVETEC FQELNVFGLD GSVPPDLDWK GQPTAPPKKG 550
LLQRLFSRQD CCGNCSDSEE ELPTRL 576
Length:576
Mass (Da):65,979
Last modified:August 1, 1998 - v1
Checksum:i91EEC2028CAF4B91
GO
Isoform GRK6B (identifier: O70293-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     560-576: DCCGNCSDSEEELPTRL → RIAVGTAATVRKSSPPASSPQAEAPTGGWR

Show »
Length:589
Mass (Da):67,115
Checksum:iC08443E7CB2B714D
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei560 – 57617DCCGN…LPTRL → RIAVGTAATVRKSSPPASSP QAEAPTGGWR in isoform GRK6B.
VSP_004939Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti98 – 981R → Q in AAC09265. 1 Publication
Sequence conflicti571 – 5711E → K in AAC09265. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF040747 mRNA. Translation: AAC09268.1.
AF040748 mRNA. Translation: AAC09269.1.
AF040749 mRNA. Translation: AAC09270.1.
AF040754 Genomic DNA. Translation: AAC09265.1.
Y17967 Genomic DNA. Translation: CAA76975.1.
Y17967 Genomic DNA. Translation: CAA76976.1.
Y15798 mRNA. Translation: CAA75789.1.
Y15799 mRNA. Translation: CAA75790.1.
BC075719 mRNA. Translation: AAH75719.1.
CCDSiCCDS49272.1. [O70293-2]
RefSeqiNP_001033107.1. NM_001038018.4. [O70293-2]
NP_001106182.1. NM_001112711.2. [O70293-1]
NP_001272992.1. NM_001286063.1.
NP_001272993.1. NM_001286064.1.
NP_001272994.1. NM_001286065.1.
NP_036068.2. NM_011938.4.
UniGeneiMm.10193.

Genome annotation databases

EnsembliENSMUST00000001115; ENSMUSP00000001115; ENSMUSG00000074886. [O70293-2]
GeneIDi26385.
KEGGimmu:26385.
UCSCiuc007qqw.1. mouse. [O70293-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF040747 mRNA. Translation: AAC09268.1 .
AF040748 mRNA. Translation: AAC09269.1 .
AF040749 mRNA. Translation: AAC09270.1 .
AF040754 Genomic DNA. Translation: AAC09265.1 .
Y17967 Genomic DNA. Translation: CAA76975.1 .
Y17967 Genomic DNA. Translation: CAA76976.1 .
Y15798 mRNA. Translation: CAA75789.1 .
Y15799 mRNA. Translation: CAA75790.1 .
BC075719 mRNA. Translation: AAH75719.1 .
CCDSi CCDS49272.1. [O70293-2 ]
RefSeqi NP_001033107.1. NM_001038018.4. [O70293-2 ]
NP_001106182.1. NM_001112711.2. [O70293-1 ]
NP_001272992.1. NM_001286063.1.
NP_001272993.1. NM_001286064.1.
NP_001272994.1. NM_001286065.1.
NP_036068.2. NM_011938.4.
UniGenei Mm.10193.

3D structure databases

ProteinModelPortali O70293.
SMRi O70293. Positions 2-557.
ModBasei Search...

Protein-protein interaction databases

IntActi O70293. 3 interactions.
MINTi MINT-1793102.

PTM databases

PhosphoSitei O70293.

Proteomic databases

PaxDbi O70293.
PRIDEi O70293.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000001115 ; ENSMUSP00000001115 ; ENSMUSG00000074886 . [O70293-2 ]
GeneIDi 26385.
KEGGi mmu:26385.
UCSCi uc007qqw.1. mouse. [O70293-1 ]

Organism-specific databases

CTDi 2870.
MGIi MGI:1347078. Grk6.

Phylogenomic databases

eggNOGi COG0515.
GeneTreei ENSGT00730000110512.
HOGENOMi HOG000006742.
HOVERGENi HBG004532.
InParanoidi Q6DI67.
KOi K08291.
OMAi MLEPPFK.
OrthoDBi EOG7V1FQK.
PhylomeDBi O70293.
TreeFami TF313940.

Miscellaneous databases

NextBioi 304313.
PROi O70293.
SOURCEi Search...

Gene expression databases

ArrayExpressi O70293.
Bgeei O70293.
CleanExi MM_GRK6.
Genevestigatori O70293.

Family and domain databases

InterProi IPR000961. AGC-kinase_C.
IPR000239. GPCR_kinase.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR016137. Regulat_G_prot_signal_superfam.
IPR000342. RGS_dom.
IPR002290. Ser/Thr_dual-sp_kinase_dom.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view ]
Pfami PF00069. Pkinase. 1 hit.
PF00615. RGS. 1 hit.
[Graphical view ]
PRINTSi PR00717. GPCRKINASE.
SMARTi SM00315. RGS. 1 hit.
SM00133. S_TK_X. 1 hit.
SM00220. S_TKc. 1 hit.
[Graphical view ]
SUPFAMi SSF48097. SSF48097. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEi PS51285. AGC_KINASE_CTER. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
PS50132. RGS. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The GRK4 subfamily of G protein-coupled receptor kinases. Alternative splicing, gene organization, and sequence conservation."
    Premont R.T., Macrae A.D., Aparicio S.A., Kendall H.E., Welch J.E., Lefkowitz R.J.
    J. Biol. Chem. 274:29381-29389(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS GRK6A AND GRK6B).
    Strain: 129/SvJ.
  2. "Primary structure of murine G-protein-coupled receptor kinase 6 splice variants predict differential regulation by posttranslational modifications."
    Moepps B., Vatter P., Frode R., Waechter F., Gierschik P.
    Submitted (SEP-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS GRK6A AND GRK6B).
    Strain: 129/SvJ and C57BL/6J.
    Tissue: Thymus.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM GRK6B).
    Strain: 129.
    Tissue: Mammary gland.
  4. "Defective lymphocyte chemotaxis in beta-arrestin2- and GRK6-deficient mice."
    Fong A.M., Premont R.T., Richardson R.M., Yu Y.R., Lefkowitz R.J., Patel D.D.
    Proc. Natl. Acad. Sci. U.S.A. 99:7478-7483(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: DISRUPTION PHENOTYPE, FUNCTION.
  5. "Increased acute inflammation, leukotriene B4-induced chemotaxis, and signaling in mice deficient for G protein-coupled receptor kinase 6."
    Kavelaars A., Vroon A., Raatgever R.P., Fong A.M., Premont R.T., Patel D.D., Lefkowitz R.J., Heijnen C.J.
    J. Immunol. 171:6128-6134(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: DISRUPTION PHENOTYPE, FUNCTION.
  6. "Dopaminergic supersensitivity in G protein-coupled receptor kinase 6-deficient mice."
    Gainetdinov R.R., Bohn L.M., Sotnikova T.D., Cyr M., Laakso A., Macrae A.D., Torres G.E., Kim K.M., Lefkowitz R.J., Caron M.G., Premont R.T.
    Neuron 38:291-303(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: DISRUPTION PHENOTYPE, FUNCTION, TISSUE SPECIFICITY.

Entry informationi

Entry nameiGRK6_MOUSE
AccessioniPrimary (citable) accession number: O70293
Secondary accession number(s): O70294, O70295, Q6DI67
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: August 1, 1998
Last modified: July 9, 2014
This is version 136 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi