Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O70258 (SGCE_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 103. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Epsilon-sarcoglycan

Short name=Epsilon-SG
Gene names
Name:Sgce
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length437 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Component of the sarcoglycan complex, a subcomplex of the dystrophin-glycoprotein complex which forms a link between the F-actin cytoskeleton and the extracellular matrix.

Subcellular location

Cell membranesarcolemma; Single-pass membrane protein Potential. Cytoplasmcytoskeleton By similarity.

Tissue specificity

Identified in all tissues tested. Expression highest in lung and placenta, moderate in brain, heart and skeletal muscle, low in kidney and liver. Also detected in embryo.

Sequence similarities

Belongs to the sarcoglycan alpha/epsilon family.

Sequence caution

The sequence AAC14020.1 differs from that shown. Reason: Erroneous initiation.

The sequence AAH12665.1 differs from that shown. Reason: Erroneous initiation.

The sequence BAC36184.1 differs from that shown. Reason: Erroneous initiation.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: O70258-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O70258-2)

The sequence of this isoform differs from the canonical sequence as follows:
     36-36: T → TAFLLSCADGINGTVNWKTKQASSFSISRKLAAGKKD

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 437437Epsilon-sarcoglycan
PRO_0000031678

Regions

Topological domain1 – 317317Extracellular Potential
Transmembrane318 – 33821Helical; Potential
Topological domain339 – 43799Cytoplasmic Potential
Compositional bias235 – 341107Cys-rich

Amino acid modifications

Glycosylation2001N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence361T → TAFLLSCADGINGTVNWKTK QASSFSISRKLAAGKKD in isoform 2.
VSP_006019

Experimental info

Sequence conflict4011T → M in AAH12665. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 7, 2009. Version 2.
Checksum: A294007261593637

FASTA43749,736
        10         20         30         40         50         60 
MLLFWWWELG DPCAWTGKGR GTLKMSPATT GTFLLTVYTL FSKVHSDRNV YPSAGVLFVH 

        70         80         90        100        110        120 
VLEREYFKGE FPPYPKPGEV SNDPITFNTN LMGYPDRPGW LRYIQRTPYS DGVLYGSPTA 

       130        140        150        160        170        180 
ENVGKPTIIE ITAYNRRTFE TARHNLIINI MSAEEFPLPY QAEFFIKNMN VEEMLASEVL 

       190        200        210        220        230        240 
GDFLGAVKNV WQPERLNAIN ITSALDRGGR VPLPINDMKE GVYVMVGADV AFSSCLREVE 

       250        260        270        280        290        300 
NPQNQLRCSQ EMEPVITCDK KFRTHFHIDW CKISLVDKTK QVSTYQEVVR GEGILPDGGE 

       310        320        330        340        350        360 
YKPPSDSLKS RDYYTDFLVT LAVPSAVALV LFLILAYIMC CRREGVEKRD MQTPDIQLVH 

       370        380        390        400        410        420 
HSSIQKSTKE LRDMSKNREI AWPLSTLPVF HPVTGEVIPP THTDNYDSTN MPLMQAQQNL 

       430 
PHQTQIPQPQ TTGKWYP 

« Hide

Isoform 2 [UniParc].

Checksum: DCAE4D4FFA879CA6
Show »

FASTA47353,532

References

« Hide 'large scale' references
[1]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Strain: Czech II.
Tissue: Mammary tumor.
[2]"Epsilon-sarcoglycan, a broadly expressed homologue of the gene mutated in limb-girdle muscular dystrophy 2D."
Ettinger A.J., Feng G., Sanes J.R.
J. Biol. Chem. 272:32534-32538(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 11-437 (ISOFORM 1).
Tissue: Lung.
[3]Erratum
Ettinger A.J., Feng G., Sanes J.R.
J. Biol. Chem. 273:19922-19922(1998)
[4]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 22-437 (ISOFORM 1).
Strain: C57BL/6J.
Tissue: Embryo.
[5]"Epsilon-sarcoglycan replaces alpha-sarcoglycan in smooth muscle to form a unique dystrophin-glycoprotein complex."
Straub V., Ettinger A.J., Durbeej M., Venzke D.P., Cutshall S., Sanes J.R., Campbell K.P.
J. Biol. Chem. 274:27989-27996(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 27-437 (ISOFORM 2).
Tissue: Lung.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
BC012665 mRNA. Translation: AAH12665.1. Different initiation.
AF031919 mRNA. Translation: AAC14020.1. Different initiation.
AK076102 mRNA. Translation: BAC36184.1. Different initiation.
AF103877 mRNA. Translation: AAF21895.1.
RefSeqNP_001123660.1. NM_001130188.1.
NP_001123661.1. NM_001130189.1.
NP_001123662.1. NM_001130190.1.
NP_035490.3. NM_011360.3.
UniGeneMm.8739.

3D structure databases

ProteinModelPortalO70258.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid203196. 2 interactions.

PTM databases

PhosphoSiteO70258.

Proteomic databases

PaxDbO70258.
PRIDEO70258.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000115577; ENSMUSP00000111240; ENSMUSG00000004631. [O70258-2]
ENSMUST00000115579; ENSMUSP00000111242; ENSMUSG00000004631. [O70258-1]
GeneID20392.
KEGGmmu:20392.
UCSCuc009avp.2. mouse. [O70258-1]
uc009avq.2. mouse. [O70258-2]

Organism-specific databases

CTD8910.
MGIMGI:1329042. Sgce.

Phylogenomic databases

eggNOGNOG323743.
GeneTreeENSGT00390000005672.
HOGENOMHOG000074154.
HOVERGENHBG006891.
OMAKRNMQTP.
OrthoDBEOG7MD4PV.
PhylomeDBO70258.
TreeFamTF314655.

Gene expression databases

ArrayExpressO70258.
BgeeO70258.
CleanExMM_SGCE.
GenevestigatorO70258.

Family and domain databases

InterProIPR006644. Cadg.
IPR008908. Sarcoglycan_2.
[Graphical view]
PANTHERPTHR10132. PTHR10132. 1 hit.
PfamPF05510. Sarcoglycan_2. 1 hit.
[Graphical view]
SMARTSM00736. CADG. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio298334.
PROO70258.
SOURCESearch...

Entry information

Entry nameSGCE_MOUSE
AccessionPrimary (citable) accession number: O70258
Secondary accession number(s): Q921G2
Entry history
Integrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: July 7, 2009
Last modified: April 16, 2014
This is version 103 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot