ID NUOB1_RHIME Reviewed; 192 AA. AC O68853; DT 30-MAY-2000, integrated into UniProtKB/Swiss-Prot. DT 30-MAY-2000, sequence version 2. DT 16-JUN-2009, entry version 61. DE RecName: Full=NADH-quinone oxidoreductase subunit B 1; DE EC=1.6.99.5; DE AltName: Full=NADH dehydrogenase I subunit B 1; DE AltName: Full=NDH-1 subunit B 1; GN Name=nuoB1; OrderedLocusNames=R01265; ORFNames=SMc01913; OS Rhizobium meliloti (Sinorhizobium meliloti). OC Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; OC Rhizobiaceae; Sinorhizobium/Ensifer group; Sinorhizobium. OX NCBI_TaxID=382; RN [1] RP NUCLEOTIDE SEQUENCE [GENOMIC DNA]. RC STRAIN=RCR2011 / SU47; RA Schmidt R., Uhde C., Nagel A., Puehler A., Selbitschka W.; RT "Sinorhizobium meliloti mutant strain SP10 which is impaired in RT stationary phase survival shows a reduction in the energy charge due RT to its defect in the energy-conserving NADH dehydrogenase."; RL Submitted (MAR-1998) to the EMBL/GenBank/DDBJ databases. RN [2] RP NUCLEOTIDE SEQUENCE [GENOMIC DNA]. RC STRAIN=41; RA Putnoky P., Jady B., Chellapilla K.P., Barta F., Kiss E.; RT "Rhizobium meliloti carries two sets of nuo genes."; RL Submitted (JUL-1999) to the EMBL/GenBank/DDBJ databases. RN [3] RP NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. RC STRAIN=1021; RX MEDLINE=21396507; PubMed=11481430; DOI=10.1073/pnas.161294398; RA Capela D., Barloy-Hubler F., Gouzy J., Bothe G., Ampe F., Batut J., RA Boistard P., Becker A., Boutry M., Cadieu E., Dreano S., Gloux S., RA Godrie T., Goffeau A., Kahn D., Kiss E., Lelaure V., Masuy D., RA Pohl T., Portetelle D., Puehler A., Purnelle B., Ramsperger U., RA Renard C., Thebault P., Vandenbol M., Weidner S., Galibert F.; RT "Analysis of the chromosome sequence of the legume symbiont RT Sinorhizobium meliloti strain 1021."; RL Proc. Natl. Acad. Sci. U.S.A. 98:9877-9882(2001). CC -!- FUNCTION: NDH-1 shuttles electrons from NADH, via FMN and iron- CC sulfur (Fe-S) centers, to quinones in the respiratory chain. The CC immediate electron acceptor for the enzyme in this species is CC believed to be ubiquinone. Couples the redox reaction to proton CC translocation (for every two electrons transferred, four hydrogen CC ions are translocated across the cytoplasmic membrane), and thus CC conserves the redox energy in a proton gradient (By similarity). CC -!- CATALYTIC ACTIVITY: NADH + quinone = NAD(+) + quinol. CC -!- COFACTOR: Binds 1 4Fe-4S cluster (By similarity). CC -!- SUBUNIT: NDH-1 is composed of 14 different subunits. Subunits CC nuoB, C, D, E, F, and G constitute the peripheral sector of the CC complex (By similarity). CC -!- SUBCELLULAR LOCATION: Cell inner membrane; Peripheral membrane CC protein; Cytoplasmic side (By similarity). CC -!- SIMILARITY: Belongs to the complex I 20 kDa subunit family. CC ----------------------------------------------------------------------- CC Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms CC Distributed under the Creative Commons Attribution-NoDerivs License CC ----------------------------------------------------------------------- DR EMBL; AF055637; AAC12755.1; -; Genomic_DNA. DR EMBL; AJ245398; CAB51621.1; -; Genomic_DNA. DR EMBL; AL591688; CAC45844.1; -; Genomic_DNA. DR RefSeq; NP_385371.1; -. DR GeneID; 1232913; -. DR GenomeReviews; AL591688_GR; R01265. DR KEGG; sme:SMc01913; -. DR NMPDR; fig|266834.1.peg.2559; -. DR HOGENOM; O68853; -. DR OMA; O68853; LINWART. DR BioCyc; SMEL266834:SMC01913-MON; -. DR BRENDA; 1.6.99.5; 142. DR GO; GO:0005886; C:plasma membrane; IEA:UniProtKB-SubCell. DR GO; GO:0051539; F:4 iron, 4 sulfur cluster binding; IEA:UniProtKB-KW. DR GO; GO:0005506; F:iron ion binding; IEA:HAMAP. DR GO; GO:0008137; F:NADH dehydrogenase (ubiquinone) activity; IEA:InterPro. DR GO; GO:0048038; F:quinone binding; IEA:UniProtKB-KW. DR GO; GO:0055114; P:oxidation reduction; IEA:HAMAP. DR GO; GO:0019684; P:photosynthesis, light reaction; IEA:HAMAP. DR GO; GO:0006810; P:transport; IEA:UniProtKB-KW. DR HAMAP; MF_01356; -; 1. DR InterPro; IPR006137; NADH_UbQ_OxRdtase-like_20kDa. DR InterPro; IPR006138; NADH_UbQ_OxRdtase_su-20kDa. DR InterPro; IPR014406; NiFe_hyd_3_ssu/Q_oxred_NuoB. DR PANTHER; PTHR11995:SF2; NADH_DH_20kDa; 1. DR PANTHER; PTHR11995; NiFe_hyd_3_ssu/Q_oxred_NuoB; 1. DR Pfam; PF01058; Oxidored_q6; 1. DR TIGRFAMs; TIGR01957; nuoB_fam; 1. DR PROSITE; PS01150; COMPLEX1_20K; 1. PE 3: Inferred from homology; KW 4Fe-4S; Cell inner membrane; Cell membrane; Complete proteome; Iron; KW Iron-sulfur; Membrane; Metal-binding; NAD; Oxidoreductase; Quinone; KW Transport; Ubiquinone. FT CHAIN 1 192 NADH-quinone oxidoreductase subunit B 1. FT /FTId=PRO_0000118775. FT METAL 71 71 Iron-sulfur (4Fe-4S) (Potential). FT METAL 72 72 Iron-sulfur (4Fe-4S) (Potential). FT METAL 136 136 Iron-sulfur (4Fe-4S) (Potential). FT METAL 166 166 Iron-sulfur (4Fe-4S) (Potential). FT CONFLICT 1 33 MELASGTTLVAPQPKGILDPATGKPIGSNDAFF -> MTLS FT V (in Ref. 1). FT CONFLICT 65 68 MTFG -> NELSV (in Ref. 1; AAC12755). SQ SEQUENCE 192 AA; 21002 MW; 5C73D67955AC062D CRC64; MELASGTTLV APQPKGILDP ATGKPIGSND AFFGEINNEL ADKGFLVTST DELINWARTG SLMWMTFGLA CCAVEMMQMS MPRYDAERFG FAPRASPRQS DVMIVAGTLT NKMAPALRKV YDQMPEPRYV ISMGSCANGG GYYHYSYSVV RGCDRVVPVD IYVPGCPPTA EALLYGVLLL QKKIRRTGTI ER //