O66614 COAD_AQUAE Phosphopantetheine adenylyltransferase 2.7.7.3 Dephospho-CoA pyrophosphorylase Pantetheine-phosphate adenylyltransferase PPAT coaD kdtB aq_253 Aquifex aeolicus (strain VF5) Bacteria Aquificae Aquificales Aquificaceae Aquifex NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] VF5 Reversibly transfers an adenylyl group from ATP to 4'-phosphopantetheine, yielding dephospho-CoA (dPCoA) and pyrophosphate (By similarity). ATP + pantetheine 4'-phosphate = diphosphate + 3'-dephospho-CoA. Cofactor biosynthesis; coenzyme A biosynthesis; CoA from (R)-pantothenate: step 4/5. Homohexamer (By similarity). Cytoplasm Belongs to the bacterial CoaD family. ATP-binding Coenzyme A biosynthesis Complete proteome Cytoplasm Nucleotide-binding Nucleotidyltransferase Reference proteome Transferase MGKRVVYPGTFDPPHYGHLDIVKRSARIFDEVVVAVAKKPRKFLLFDAEERVKMFEKMVE DIPNVEVKMFDCLLVDFMKREGINVIVRGVRLFTDFEYELQIALTNYKLAGVETVFMMPS QEYIHISSTIVRDVASYCGDLDNMVHPYVKQKLREKFNCGS Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms Distributed under the Creative Commons Attribution-NoDerivs License