Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Probable protein phosphatase 2C 28

Gene

At2g34740

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Catalytic activityi

[a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

Cofactori

Mg2+By similarity, Mn2+By similarityNote: Binds 2 magnesium or manganese ions per subunit.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi124Manganese 1By similarity1
Metal bindingi124Manganese 2By similarity1
Metal bindingi125Manganese 1; via carbonyl oxygenBy similarity1
Metal bindingi286Manganese 2By similarity1
Metal bindingi325Manganese 2By similarity1

GO - Molecular functioni

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protein phosphatase

Keywords - Ligandi

Magnesium, Manganese, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Probable protein phosphatase 2C 28 (EC:3.1.3.16)
Short name:
AtPP2C28
Gene namesi
Ordered Locus Names:At2g34740
ORF Names:T29F13.5
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 2

Organism-specific databases

TAIRiAT2G34740.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003679571 – 339Probable protein phosphatase 2C 28Add BLAST339

Proteomic databases

PaxDbiO64583.
PRIDEiO64583.

Expressioni

Gene expression databases

GenevisibleiO64583. AT.

Interactioni

Protein-protein interaction databases

STRINGi3702.AT2G34740.1.

Structurei

3D structure databases

ProteinModelPortaliO64583.
SMRiO64583.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini87 – 334PPM-type phosphatasePROSITE-ProRule annotationAdd BLAST248

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi52 – 74Asp-richAdd BLAST23

Sequence similaritiesi

Belongs to the PP2C family.Curated
Contains 1 PPM-type phosphatase domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0698. Eukaryota.
COG0631. LUCA.
HOGENOMiHOG000233896.
InParanoidiO64583.
KOiK14803.
OMAiMSNDEVW.
OrthoDBiEOG09360FJK.

Family and domain databases

Gene3Di3.60.40.10. 1 hit.
InterProiIPR015655. PP2C.
IPR001932. PPM-type_phosphatase_dom.
[Graphical view]
PANTHERiPTHR13832. PTHR13832. 2 hits.
PfamiPF00481. PP2C. 1 hit.
[Graphical view]
SMARTiSM00331. PP2C_SIG. 1 hit.
SM00332. PP2Cc. 1 hit.
[Graphical view]
SUPFAMiSSF81606. SSF81606. 1 hit.
PROSITEiPS51746. PPM_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O64583-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKKTIKNSTH RPEDILVHAI KKRRSASGDV KNAVKLKEGE DYLRVEEEIP
60 70 80 90 100
HDDNVVVIDD GCDHDHDVDD NDDDEEENGR YCRREFDHGY HLVKGQMGHG
110 120 130 140 150
MEDFIVADTK TVKGHNLGLY AIFDGHSGSD VADYLQNHLF DNILSQPDFW
160 170 180 190 200
RNPKKAIKRA YKSTDDYILQ NVVGPRGGST AVTAIVIDGK KIVVANVGDS
210 220 230 240 250
RAILCRESDV VKQITVDHEP DKERDLVKSK GGFVSQKPGN VPRVDGQLAM
260 270 280 290 300
TRAFGDGGLK EHISVIPNIE IAEIHDDTKF LILASDGLWK VMSNDEVWDQ
310 320 330
IKKRGNAEEA AKMLIDKALA RGSKDDISCV VVSFLQWID
Length:339
Mass (Da):37,881
Last modified:June 13, 2012 - v2
Checksum:i3A7310A6CBF3AC47
GO
Isoform 2 (identifier: O64583-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     292-339: MSNDEVWDQIKKRGNAEEAAKMLIDKALARGSKDDISCVVVSFLQWID → STYECHGTLLIGAPKDRTKS

Note: May be due to an intron retention.
Show »
Length:311
Mass (Da):34,633
Checksum:iE5C507B4A6E74366
GO

Sequence cautioni

The sequence AAC16260 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence AEC09017 differs from that shown. Reason: Erroneous gene model prediction.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_041311292 – 339MSNDE…LQWID → STYECHGTLLIGAPKDRTKS in isoform 2. 1 PublicationAdd BLAST48

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC003096 Genomic DNA. Translation: AAC16260.1. Sequence problems.
CP002685 Genomic DNA. Translation: AEC09016.1.
CP002685 Genomic DNA. Translation: AEC09017.1. Sequence problems.
AK175603 mRNA. Translation: BAD43366.1.
PIRiT01361.
RefSeqiNP_001189678.1. NM_001202749.1.
NP_181021.4. NM_129028.4. [O64583-1]
UniGeneiAt.12517.
At.66356.

Genome annotation databases

EnsemblPlantsiAT2G34740.1; AT2G34740.1; AT2G34740. [O64583-1]
GeneIDi818039.
GrameneiAT2G34740.1; AT2G34740.1; AT2G34740.
KEGGiath:AT2G34740.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC003096 Genomic DNA. Translation: AAC16260.1. Sequence problems.
CP002685 Genomic DNA. Translation: AEC09016.1.
CP002685 Genomic DNA. Translation: AEC09017.1. Sequence problems.
AK175603 mRNA. Translation: BAD43366.1.
PIRiT01361.
RefSeqiNP_001189678.1. NM_001202749.1.
NP_181021.4. NM_129028.4. [O64583-1]
UniGeneiAt.12517.
At.66356.

3D structure databases

ProteinModelPortaliO64583.
SMRiO64583.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi3702.AT2G34740.1.

Proteomic databases

PaxDbiO64583.
PRIDEiO64583.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsiAT2G34740.1; AT2G34740.1; AT2G34740. [O64583-1]
GeneIDi818039.
GrameneiAT2G34740.1; AT2G34740.1; AT2G34740.
KEGGiath:AT2G34740.

Organism-specific databases

TAIRiAT2G34740.

Phylogenomic databases

eggNOGiKOG0698. Eukaryota.
COG0631. LUCA.
HOGENOMiHOG000233896.
InParanoidiO64583.
KOiK14803.
OMAiMSNDEVW.
OrthoDBiEOG09360FJK.

Miscellaneous databases

PROiO64583.

Gene expression databases

GenevisibleiO64583. AT.

Family and domain databases

Gene3Di3.60.40.10. 1 hit.
InterProiIPR015655. PP2C.
IPR001932. PPM-type_phosphatase_dom.
[Graphical view]
PANTHERiPTHR13832. PTHR13832. 2 hits.
PfamiPF00481. PP2C. 1 hit.
[Graphical view]
SMARTiSM00331. PP2C_SIG. 1 hit.
SM00332. PP2Cc. 1 hit.
[Graphical view]
SUPFAMiSSF81606. SSF81606. 1 hit.
PROSITEiPS51746. PPM_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiP2C28_ARATH
AccessioniPrimary (citable) accession number: O64583
Secondary accession number(s): F4IIV1, F4IIV2, Q681L4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 14, 2009
Last sequence update: June 13, 2012
Last modified: November 2, 2016
This is version 101 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.