Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O64583 (P2C28_ARATH) Reviewed, UniProtKB/Swiss-Prot

Last modified May 14, 2014. Version 88. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Probable protein phosphatase 2C 28

Short name=AtPP2C28
EC=3.1.3.16
Gene names
Ordered Locus Names:At2g34740
ORF Names:T29F13.5
OrganismArabidopsis thaliana (Mouse-ear cress) [Reference proteome]
Taxonomic identifier3702 [NCBI]
Taxonomic lineageEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis

Protein attributes

Sequence length339 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Catalytic activity

[a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

Cofactor

Binds 2 magnesium or manganese ions per subunit By similarity.

Sequence similarities

Belongs to the PP2C family.

Contains 1 PP2C-like domain.

Sequence caution

The sequence AAC16260.1 differs from that shown. Reason: Erroneous gene model prediction.

The sequence AEC09017.1 differs from that shown. Reason: Erroneous gene model prediction.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
   LigandMagnesium
Manganese
Metal-binding
   Molecular functionHydrolase
Protein phosphatase
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Molecular_functionmetal ion binding

Inferred from electronic annotation. Source: UniProtKB-KW

phosphoprotein phosphatase activity

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: O64583-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O64583-2)

The sequence of this isoform differs from the canonical sequence as follows:
     292-339: MSNDEVWDQIKKRGNAEEAAKMLIDKALARGSKDDISCVVVSFLQWID → STYECHGTLLIGAPKDRTKS
Note: May be due to an intron retention.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 339339Probable protein phosphatase 2C 28
PRO_0000367957

Regions

Domain100 – 327228PP2C-like
Compositional bias52 – 7423Asp-rich

Sites

Metal binding1241Manganese 1 By similarity
Metal binding1241Manganese 2 By similarity
Metal binding1251Manganese 1; via carbonyl oxygen By similarity
Metal binding2861Manganese 2 By similarity
Metal binding3251Manganese 2 By similarity

Natural variations

Alternative sequence292 – 33948MSNDE…LQWID → STYECHGTLLIGAPKDRTKS in isoform 2.
VSP_041311

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 13, 2012. Version 2.
Checksum: 3A7310A6CBF3AC47

FASTA33937,881
        10         20         30         40         50         60 
MKKTIKNSTH RPEDILVHAI KKRRSASGDV KNAVKLKEGE DYLRVEEEIP HDDNVVVIDD 

        70         80         90        100        110        120 
GCDHDHDVDD NDDDEEENGR YCRREFDHGY HLVKGQMGHG MEDFIVADTK TVKGHNLGLY 

       130        140        150        160        170        180 
AIFDGHSGSD VADYLQNHLF DNILSQPDFW RNPKKAIKRA YKSTDDYILQ NVVGPRGGST 

       190        200        210        220        230        240 
AVTAIVIDGK KIVVANVGDS RAILCRESDV VKQITVDHEP DKERDLVKSK GGFVSQKPGN 

       250        260        270        280        290        300 
VPRVDGQLAM TRAFGDGGLK EHISVIPNIE IAEIHDDTKF LILASDGLWK VMSNDEVWDQ 

       310        320        330 
IKKRGNAEEA AKMLIDKALA RGSKDDISCV VVSFLQWID 

« Hide

Isoform 2 [UniParc].

Checksum: E5C507B4A6E74366
Show »

FASTA31134,633

References

« Hide 'large scale' references
[1]"Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana."
Lin X., Kaul S., Rounsley S.D., Shea T.P., Benito M.-I., Town C.D., Fujii C.Y., Mason T.M., Bowman C.L., Barnstead M.E., Feldblyum T.V., Buell C.R., Ketchum K.A., Lee J.J., Ronning C.M., Koo H.L., Moffat K.S., Cronin L.A. expand/collapse author list , Shen M., Pai G., Van Aken S., Umayam L., Tallon L.J., Gill J.E., Adams M.D., Carrera A.J., Creasy T.H., Goodman H.M., Somerville C.R., Copenhaver G.P., Preuss D., Nierman W.C., White O., Eisen J.A., Salzberg S.L., Fraser C.M., Venter J.C.
Nature 402:761-768(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: cv. Columbia.
[2]The Arabidopsis Information Resource (TAIR)
Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
Cited for: GENOME REANNOTATION.
Strain: cv. Columbia.
[3]"Large-scale analysis of RIKEN Arabidopsis full-length (RAFL) cDNAs."
Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Kamiya A., Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K., Kohara Y., Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K., Akiyama K. expand/collapse author list , Satou M., Toyoda T., Konagaya A., Carninci P., Kawai J., Hayashizaki Y., Shinozaki K.
Submitted (SEP-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 170-339 (ISOFORM 2).
Strain: cv. Columbia.
[4]"Genome-wide and expression analysis of protein phosphatase 2C in rice and Arabidopsis."
Xue T., Wang D., Zhang S., Ehlting J., Ni F., Jacab S., Zheng C., Zhong Y.
BMC Genomics 9:550-550(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: GENE FAMILY, NOMENCLATURE.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AC003096 Genomic DNA. Translation: AAC16260.1. Sequence problems.
CP002685 Genomic DNA. Translation: AEC09016.1.
CP002685 Genomic DNA. Translation: AEC09017.1. Sequence problems.
AK175603 mRNA. Translation: BAD43366.1.
PIRT01361.
RefSeqNP_001189678.1. NM_001202749.1.
NP_181021.4. NM_129028.4. [O64583-1]
UniGeneAt.12517.
At.66356.

3D structure databases

ProteinModelPortalO64583.
SMRO64583. Positions 119-334.
ModBaseSearch...
MobiDBSearch...

Proteomic databases

PRIDEO64583.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsAT2G34740.1; AT2G34740.1; AT2G34740. [O64583-1]
GeneID818039.
KEGGath:AT2G34740.

Organism-specific databases

TAIRAT2G34740.

Phylogenomic databases

eggNOGCOG0631.
HOGENOMHOG000233896.
InParanoidO64583.
KOK14803.
OMAYLQSHLF.

Enzyme and pathway databases

BioCycARA:AT2G34740-MONOMER.
ARA:GQT-819-MONOMER.

Gene expression databases

GenevestigatorO64583.

Family and domain databases

Gene3D3.60.40.10. 1 hit.
InterProIPR001932. PP2C-like_dom.
IPR015655. Protein_Pase_2C.
[Graphical view]
PANTHERPTHR13832. PTHR13832. 1 hit.
PfamPF00481. PP2C. 1 hit.
[Graphical view]
SMARTSM00331. PP2C_SIG. 1 hit.
SM00332. PP2Cc. 1 hit.
[Graphical view]
SUPFAMSSF81606. SSF81606. 1 hit.
ProtoNetSearch...

Entry information

Entry nameP2C28_ARATH
AccessionPrimary (citable) accession number: O64583
Secondary accession number(s): F4IIV1, F4IIV2, Q681L4
Entry history
Integrated into UniProtKB/Swiss-Prot: April 14, 2009
Last sequence update: June 13, 2012
Last modified: May 14, 2014
This is version 88 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

Arabidopsis thaliana

Arabidopsis thaliana: entries and gene names