Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O64583

- P2C28_ARATH

UniProt

O64583 - P2C28_ARATH

Protein

Probable protein phosphatase 2C 28

Gene

At2g34740

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 89 (01 Oct 2014)
      Sequence version 2 (13 Jun 2012)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Catalytic activityi

    [a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

    Cofactori

    Binds 2 magnesium or manganese ions per subunit.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi124 – 1241Manganese 1By similarity
    Metal bindingi124 – 1241Manganese 2By similarity
    Metal bindingi125 – 1251Manganese 1; via carbonyl oxygenBy similarity
    Metal bindingi286 – 2861Manganese 2By similarity
    Metal bindingi325 – 3251Manganese 2By similarity

    GO - Molecular functioni

    1. metal ion binding Source: UniProtKB-KW
    2. phosphoprotein phosphatase activity Source: UniProtKB-KW

    Keywords - Molecular functioni

    Hydrolase, Protein phosphatase

    Keywords - Ligandi

    Magnesium, Manganese, Metal-binding

    Enzyme and pathway databases

    BioCyciARA:AT2G34740-MONOMER.
    ARA:GQT-819-MONOMER.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Probable protein phosphatase 2C 28 (EC:3.1.3.16)
    Short name:
    AtPP2C28
    Gene namesi
    Ordered Locus Names:At2g34740
    ORF Names:T29F13.5
    OrganismiArabidopsis thaliana (Mouse-ear cress)
    Taxonomic identifieri3702 [NCBI]
    Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
    ProteomesiUP000006548: Chromosome 2

    Organism-specific databases

    TAIRiAT2G34740.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 339339Probable protein phosphatase 2C 28PRO_0000367957Add
    BLAST

    Proteomic databases

    PRIDEiO64583.

    Expressioni

    Gene expression databases

    GenevestigatoriO64583.

    Structurei

    3D structure databases

    ProteinModelPortaliO64583.
    SMRiO64583. Positions 119-334.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini100 – 327228PP2C-likeAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi52 – 7423Asp-richAdd
    BLAST

    Sequence similaritiesi

    Belongs to the PP2C family.Curated
    Contains 1 PP2C-like domain.Curated

    Phylogenomic databases

    eggNOGiCOG0631.
    HOGENOMiHOG000233896.
    InParanoidiO64583.
    KOiK14803.
    OMAiYLQSHLF.

    Family and domain databases

    Gene3Di3.60.40.10. 1 hit.
    InterProiIPR001932. PP2C-like_dom.
    IPR015655. Protein_Pase_2C.
    [Graphical view]
    PANTHERiPTHR13832. PTHR13832. 1 hit.
    PfamiPF00481. PP2C. 1 hit.
    [Graphical view]
    SMARTiSM00331. PP2C_SIG. 1 hit.
    SM00332. PP2Cc. 1 hit.
    [Graphical view]
    SUPFAMiSSF81606. SSF81606. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O64583-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKKTIKNSTH RPEDILVHAI KKRRSASGDV KNAVKLKEGE DYLRVEEEIP    50
    HDDNVVVIDD GCDHDHDVDD NDDDEEENGR YCRREFDHGY HLVKGQMGHG 100
    MEDFIVADTK TVKGHNLGLY AIFDGHSGSD VADYLQNHLF DNILSQPDFW 150
    RNPKKAIKRA YKSTDDYILQ NVVGPRGGST AVTAIVIDGK KIVVANVGDS 200
    RAILCRESDV VKQITVDHEP DKERDLVKSK GGFVSQKPGN VPRVDGQLAM 250
    TRAFGDGGLK EHISVIPNIE IAEIHDDTKF LILASDGLWK VMSNDEVWDQ 300
    IKKRGNAEEA AKMLIDKALA RGSKDDISCV VVSFLQWID 339
    Length:339
    Mass (Da):37,881
    Last modified:June 13, 2012 - v2
    Checksum:i3A7310A6CBF3AC47
    GO
    Isoform 2 (identifier: O64583-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         292-339: MSNDEVWDQIKKRGNAEEAAKMLIDKALARGSKDDISCVVVSFLQWID → STYECHGTLLIGAPKDRTKS

    Note: May be due to an intron retention.

    Show »
    Length:311
    Mass (Da):34,633
    Checksum:iE5C507B4A6E74366
    GO

    Sequence cautioni

    The sequence AAC16260.1 differs from that shown. Reason: Erroneous gene model prediction.
    The sequence AEC09017.1 differs from that shown. Reason: Erroneous gene model prediction.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei292 – 33948MSNDE…LQWID → STYECHGTLLIGAPKDRTKS in isoform 2. 1 PublicationVSP_041311Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC003096 Genomic DNA. Translation: AAC16260.1. Sequence problems.
    CP002685 Genomic DNA. Translation: AEC09016.1.
    CP002685 Genomic DNA. Translation: AEC09017.1. Sequence problems.
    AK175603 mRNA. Translation: BAD43366.1.
    PIRiT01361.
    RefSeqiNP_001189678.1. NM_001202749.1.
    NP_181021.4. NM_129028.4. [O64583-1]
    UniGeneiAt.12517.
    At.66356.

    Genome annotation databases

    EnsemblPlantsiAT2G34740.1; AT2G34740.1; AT2G34740. [O64583-1]
    GeneIDi818039.
    KEGGiath:AT2G34740.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC003096 Genomic DNA. Translation: AAC16260.1 . Sequence problems.
    CP002685 Genomic DNA. Translation: AEC09016.1 .
    CP002685 Genomic DNA. Translation: AEC09017.1 . Sequence problems.
    AK175603 mRNA. Translation: BAD43366.1 .
    PIRi T01361.
    RefSeqi NP_001189678.1. NM_001202749.1.
    NP_181021.4. NM_129028.4. [O64583-1 ]
    UniGenei At.12517.
    At.66356.

    3D structure databases

    ProteinModelPortali O64583.
    SMRi O64583. Positions 119-334.
    ModBasei Search...
    MobiDBi Search...

    Proteomic databases

    PRIDEi O64583.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    EnsemblPlantsi AT2G34740.1 ; AT2G34740.1 ; AT2G34740 . [O64583-1 ]
    GeneIDi 818039.
    KEGGi ath:AT2G34740.

    Organism-specific databases

    TAIRi AT2G34740.

    Phylogenomic databases

    eggNOGi COG0631.
    HOGENOMi HOG000233896.
    InParanoidi O64583.
    KOi K14803.
    OMAi YLQSHLF.

    Enzyme and pathway databases

    BioCyci ARA:AT2G34740-MONOMER.
    ARA:GQT-819-MONOMER.

    Gene expression databases

    Genevestigatori O64583.

    Family and domain databases

    Gene3Di 3.60.40.10. 1 hit.
    InterProi IPR001932. PP2C-like_dom.
    IPR015655. Protein_Pase_2C.
    [Graphical view ]
    PANTHERi PTHR13832. PTHR13832. 1 hit.
    Pfami PF00481. PP2C. 1 hit.
    [Graphical view ]
    SMARTi SM00331. PP2C_SIG. 1 hit.
    SM00332. PP2Cc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF81606. SSF81606. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: cv. Columbia.
    2. The Arabidopsis Information Resource (TAIR)
      Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
      Cited for: GENOME REANNOTATION.
      Strain: cv. Columbia.
    3. "Large-scale analysis of RIKEN Arabidopsis full-length (RAFL) cDNAs."
      Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Kamiya A., Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K., Kohara Y., Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K., Akiyama K.
      , Satou M., Toyoda T., Konagaya A., Carninci P., Kawai J., Hayashizaki Y., Shinozaki K.
      Submitted (SEP-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 170-339 (ISOFORM 2).
      Strain: cv. Columbia.
    4. "Genome-wide and expression analysis of protein phosphatase 2C in rice and Arabidopsis."
      Xue T., Wang D., Zhang S., Ehlting J., Ni F., Jacab S., Zheng C., Zhong Y.
      BMC Genomics 9:550-550(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: GENE FAMILY, NOMENCLATURE.

    Entry informationi

    Entry nameiP2C28_ARATH
    AccessioniPrimary (citable) accession number: O64583
    Secondary accession number(s): F4IIV1, F4IIV2, Q681L4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 14, 2009
    Last sequence update: June 13, 2012
    Last modified: October 1, 2014
    This is version 89 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programPlant Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Arabidopsis thaliana
      Arabidopsis thaliana: entries and gene names
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3