O64583 (P2C28_ARATH) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 77.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Probable protein phosphatase 2C 28 Short name=AtPP2C28 EC=3.1.3.16 | ||||
| Gene names |
| ||||
| Organism | Arabidopsis thaliana (Mouse-ear cress) [Reference proteome] | ||||
| Taxonomic identifier | 3702 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Viridiplantae › Streptophyta › Embryophyta › Tracheophyta › Spermatophyta › Magnoliophyta › eudicotyledons › core eudicotyledons › rosids › malvids › Brassicales › Brassicaceae › Camelineae › Arabidopsis![]() |
Protein attributes
| Sequence length | 339 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Catalytic activity | A phosphoprotein + H2O = a protein + phosphate. |
| Cofactor | Binds 2 magnesium or manganese ions per subunit By similarity. |
| Sequence similarities | Belongs to the PP2C family. Contains 1 PP2C-like domain. |
| Sequence caution | The sequence AAC16260.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AEC09017.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Ligand | Magnesium Manganese Metal-binding |
| Molecular function | Hydrolase Protein phosphatase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | metabolic process Inferred from electronic annotation. Source: GOC |
| Molecular_function | metal ion binding Inferred from electronic annotation. Source: UniProtKB-KW phosphoprotein phosphatase activityInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O64583-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O64583-2) The sequence of this isoform differs from the canonical sequence as follows: 292-339: MSNDEVWDQIKKRGNAEEAAKMLIDKALARGSKDDISCVVVSFLQWID → STYECHGTLLIGAPKDRTKS | ||||||
| Note: May be due to an intron retention. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 339 | 339 | Probable protein phosphatase 2C 28 | PRO_0000367957 | |||||
Regions | |||||||||
| Domain | 100 – 327 | 228 | PP2C-like | ||||||
| Compositional bias | 52 – 74 | 23 | Asp-rich | ||||||
Sites | |||||||||
| Metal binding | 124 | 1 | Manganese 1 By similarity | ||||||
| Metal binding | 124 | 1 | Manganese 2 By similarity | ||||||
| Metal binding | 125 | 1 | Manganese 1; via carbonyl oxygen By similarity | ||||||
| Metal binding | 286 | 1 | Manganese 2 By similarity | ||||||
| Metal binding | 325 | 1 | Manganese 2 By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 292 – 339 | 48 | MSNDE…LQWID → STYECHGTLLIGAPKDRTKS in isoform 2. | VSP_041311 | |||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AC003096 Genomic DNA. Translation: AAC16260.1. Sequence problems. CP002685 Genomic DNA. Translation: AEC09016.1. CP002685 Genomic DNA. Translation: AEC09017.1. Sequence problems. AK175603 mRNA. Translation: BAD43366.1. |
| IPI | IPI00532562. IPI00991656. |
| PIR | T01361. |
| RefSeq | NP_001189678.1. NM_001202749.1. NP_181021.4. NM_129028.4. |
| UniGene | At.12517. At.66356. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1A6Q based on UniProtKB P35813. |
| ProteinModelPortal | O64583. |
| SMR | O64583. Positions 119-334. |
| ModBase | Search... |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| GeneID | 818039. |
| KEGG | ath:AT2G34740. |
Organism-specific databases | |
| TAIR | At2g34740. |
Phylogenomic databases | |
| eggNOG | COG0631. |
| HOGENOM | HOG000233896. |
| InParanoid | O64583. |
| KO | K14803. |
| OMA | MSNDEVW. |
Gene expression databases | |
| ArrayExpress | O64583. |
| Genevestigator | O64583. |
Family and domain databases | |
| Gene3D | 3.60.40.10. 1 hit. |
| InterPro | IPR001932. PP2C-like. IPR015655. Protein_Pase_2C. [Graphical view] |
| PANTHER | PTHR13832. PTHR13832. 1 hit. |
| Pfam | PF00481. PP2C. 1 hit. [Graphical view] |
| SMART | SM00331. PP2C_SIG. 1 hit. SM00332. PP2Cc. 1 hit. [Graphical view] |
| SUPFAM | SSF81606. PP2C-related. 1 hit. |
| PROSITE | PS01032. PP2C. False negative. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | P2C28_ARATH | ||||||||
| Accession | Primary (citable) accession number: O64583 Secondary accession number(s): F4IIV1, F4IIV2, Q681L4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Plant Protein Annotation Program | ||||||||
Relevant documents
| Arabidopsis thaliana Arabidopsis thaliana: entries and gene names |
| SIMILARITY comments Index of protein domains and families |

Clusters with
