Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein lap1

Gene

let-413

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Critical role in assembling adherens junctions; adapter protein involved in polarizing protein trafficking in epithelial cells. Necessary to maintain, not establish, the entire terminal web (organelle-depleted, intermediate filament-rich layer of cytoplasm that underlies the apical microvilli of polarized epithelial cells) or brush border assembly at the apical surface gut cells. Required for correct localization of ifb-2 intermediate filaments in the terminal web.2 Publications

GO - Biological processi

  • actin filament-based process Source: WormBase
  • cell adhesion Source: UniProtKB-KW
  • cell-cell junction assembly Source: WormBase
  • embryo development ending in birth or egg hatching Source: WormBase
  • embryonic digestive tract morphogenesis Source: WormBase
  • establishment or maintenance of cell polarity Source: UniProtKB
  • maintenance of epithelial cell apical/basal polarity Source: WormBase
  • protein transport Source: UniProtKB
  • regulation of intermediate filament polymerization or depolymerization Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Enzyme and pathway databases

ReactomeiR-CEL-1227986. Signaling by ERBB2.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein lap1
Alternative name(s):
Lethal protein 413
Gene namesi
Name:let-413
ORF Names:F26D11.11
OrganismiCaenorhabditis elegans
Taxonomic identifieri6239 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
Proteomesi
  • UP000001940 Componenti: Chromosome V

Organism-specific databases

WormBaseiF26D11.11a; CE29778; WBGene00002632; let-413.
F26D11.11b; CE37008; WBGene00002632; let-413.

Subcellular locationi

GO - Cellular componenti

  • adherens junction Source: UniProtKB
  • basolateral plasma membrane Source: WormBase
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Disruption phenotypei

Worms display a severely affected epithelial integrity, leading to abnormal morphogenesis of the pharynx, intestine and embryo.1 Publication

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi305 – 3051P → L: Abolishes membrane localization. 2 Publications

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 699699Protein lap1PRO_0000188305Add
BLAST

Proteomic databases

EPDiO61967.
PaxDbiO61967.
PRIDEiO61967.

PTM databases

iPTMnetiO61967.

Expressioni

Tissue specificityi

All embryonic epithelial cells. Terminal web of the adult intestine.2 Publications

Interactioni

Protein-protein interaction databases

BioGridi44213. 10 interactions.
DIPiDIP-25349N.
IntActiO61967. 7 interactions.
MINTiMINT-1058604.
STRINGi6239.F26D11.11b.

Structurei

3D structure databases

ProteinModelPortaliO61967.
SMRiO61967. Positions 13-396, 569-658.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati37 – 5923LRR 1Add
BLAST
Repeati60 – 8122LRR 2Add
BLAST
Repeati83 – 10422LRR 3Add
BLAST
Repeati106 – 12722LRR 4Add
BLAST
Repeati129 – 15022LRR 5Add
BLAST
Repeati152 – 17423LRR 6Add
BLAST
Repeati175 – 19622LRR 7Add
BLAST
Repeati198 – 21922LRR 8Add
BLAST
Repeati221 – 24222LRR 9Add
BLAST
Repeati244 – 26522LRR 10Add
BLAST
Repeati267 – 28822LRR 11Add
BLAST
Repeati290 – 31122LRR 12Add
BLAST
Repeati313 – 33422LRR 13Add
BLAST
Repeati336 – 35722LRR 14Add
BLAST
Repeati359 – 38022LRR 15Add
BLAST
Repeati382 – 40322LRR 16Add
BLAST
Domaini584 – 66582PDZPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the LAP (LRR and PDZ) protein family.Curated
Contains 16 LRR (leucine-rich) repeats.Curated
Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

eggNOGiKOG0619. Eukaryota.
KOG3528. Eukaryota.
COG4886. LUCA.
GeneTreeiENSGT00840000129686.
HOGENOMiHOG000116557.
InParanoidiO61967.
OMAiFERHNTP.
OrthoDBiEOG7JQBMG.
PhylomeDBiO61967.

Family and domain databases

Gene3Di2.30.42.10. 1 hit.
3.80.10.10. 2 hits.
InterProiIPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
IPR003591. Leu-rich_rpt_typical-subtyp.
IPR001478. PDZ.
[Graphical view]
PfamiPF13855. LRR_8. 3 hits.
PF00595. PDZ. 1 hit.
[Graphical view]
SMARTiSM00369. LRR_TYP. 12 hits.
SM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 1 hit.
PROSITEiPS51450. LRR. 14 hits.
PS50106. PDZ. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform b (identifier: O61967-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPAFFCLPMA CQRQVDSIDR SQSNLQAIPS DIFRFRKLED LNLTMNNIKE
60 70 80 90 100
LDHRLFSLRH LRILDVSDNE LAVLPAEIGN LTQLIELNLN RNSIAKLPDT
110 120 130 140 150
MQNCKLLTTL NLSSNPFTRL PETICECSSI TILSLNETSL TLLPSNIGSL
160 170 180 190 200
TNLRVLEARD NLLRTIPLSI VELRKLEELD LGQNELEALP AEIGKLTSLR
210 220 230 240 250
EFYVDINSLT SLPDSISGCR MLDQLDVSEN QIIRLPENLG RMPNLTDLNI
260 270 280 290 300
SINEIIELPS SFGELKRLQM LKADRNSLHN LTSEIGKCQS LTELYLGQNF
310 320 330 340 350
LTDLPDTIGD LRQLTTLNVD CNNLSDIPDT IGNCKSLTVL SLRQNILTEL
360 370 380 390 400
PMTIGKCENL TVLDVASNKL PHLPFTVKVL YKLQALWLSE NQTQSILKLS
410 420 430 440 450
ETRDDRKGIK VVTCYLLPQV DAIDGEGRSG SAQHNTDRGA FLGGPKVHFH
460 470 480 490 500
DQADTTFEEN KEAEIHLGNF ERHNTPHPKT PKHKKGSIDG HMLPHEIDQP
510 520 530 540 550
RQLSLVSNHR TSTSSFGESS NSINRDLADI RAQNGVREAT LSPEREERMA
560 570 580 590 600
TSLSSLSNLA AGTQNMHTIR IQKDDTGKLG LSFAGGTSND PAPNSNGDSG
610 620 630 640 650
LFVTKVTPGS AAYRCGLREG DKLIRANDVN MINASQDNAM EAIKKRETVE
660 670 680 690
LVVLRRSPSP VSRTSEPSLN GSSHQLNHFD AGSPDSTMFV TSSTPVYAS
Note: No experimental confirmation available.
Length:699
Mass (Da):77,350
Last modified:September 27, 2005 - v3
Checksum:i2CE6478B5039F2DE
GO
Isoform a (identifier: O61967-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     531-531: R → RFIDAPAS
     666-699: EPSLNGSSHQLNHFDAGSPDSTMFVTSSTPVYAS → VSRPCEY

Show »
Length:679
Mass (Da):75,336
Checksum:i608B8EDF5AC0F947
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei531 – 5311R → RFIDAPAS in isoform a. 1 PublicationVSP_015673
Alternative sequencei666 – 69934EPSLN…PVYAS → VSRPCEY in isoform a. 1 PublicationVSP_015674Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ276590 mRNA. Translation: CAB91651.1.
FO081227 Genomic DNA. Translation: CCD70053.1.
FO081227 Genomic DNA. Translation: CCD70054.1.
PIRiT33295.
RefSeqiNP_001023850.1. NM_001028679.3. [O61967-2]
NP_001023851.1. NM_001028680.3. [O61967-1]
UniGeneiCel.6189.

Genome annotation databases

EnsemblMetazoaiF26D11.11b; F26D11.11b; WBGene00002632. [O61967-1]
GeneIDi179171.
KEGGicel:CELE_F26D11.11.
UCSCiF26D11.11a. c. elegans. [O61967-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ276590 mRNA. Translation: CAB91651.1.
FO081227 Genomic DNA. Translation: CCD70053.1.
FO081227 Genomic DNA. Translation: CCD70054.1.
PIRiT33295.
RefSeqiNP_001023850.1. NM_001028679.3. [O61967-2]
NP_001023851.1. NM_001028680.3. [O61967-1]
UniGeneiCel.6189.

3D structure databases

ProteinModelPortaliO61967.
SMRiO61967. Positions 13-396, 569-658.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi44213. 10 interactions.
DIPiDIP-25349N.
IntActiO61967. 7 interactions.
MINTiMINT-1058604.
STRINGi6239.F26D11.11b.

PTM databases

iPTMnetiO61967.

Proteomic databases

EPDiO61967.
PaxDbiO61967.
PRIDEiO61967.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiF26D11.11b; F26D11.11b; WBGene00002632. [O61967-1]
GeneIDi179171.
KEGGicel:CELE_F26D11.11.
UCSCiF26D11.11a. c. elegans. [O61967-1]

Organism-specific databases

CTDi179171.
WormBaseiF26D11.11a; CE29778; WBGene00002632; let-413.
F26D11.11b; CE37008; WBGene00002632; let-413.

Phylogenomic databases

eggNOGiKOG0619. Eukaryota.
KOG3528. Eukaryota.
COG4886. LUCA.
GeneTreeiENSGT00840000129686.
HOGENOMiHOG000116557.
InParanoidiO61967.
OMAiFERHNTP.
OrthoDBiEOG7JQBMG.
PhylomeDBiO61967.

Enzyme and pathway databases

ReactomeiR-CEL-1227986. Signaling by ERBB2.

Miscellaneous databases

NextBioi904226.
PROiO61967.

Family and domain databases

Gene3Di2.30.42.10. 1 hit.
3.80.10.10. 2 hits.
InterProiIPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
IPR003591. Leu-rich_rpt_typical-subtyp.
IPR001478. PDZ.
[Graphical view]
PfamiPF13855. LRR_8. 3 hits.
PF00595. PDZ. 1 hit.
[Graphical view]
SMARTiSM00369. LRR_TYP. 12 hits.
SM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 1 hit.
PROSITEiPS51450. LRR. 14 hits.
PS50106. PDZ. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "LET-413 is a basolateral protein required for the assembly of adherens junctions in Caenorhabditis elegans."
    Legouis R., Gansmuller A., Sookhareea S., Bosher J.M., Baillie D.L., Labouesse M.
    Nat. Cell Biol. 2:415-422(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, MUTAGENESIS OF PRO-305, DISRUPTION PHENOTYPE.
    Strain: Bristol N21 Publication.
  2. "Genome sequence of the nematode C. elegans: a platform for investigating biology."
    The C. elegans sequencing consortium
    Science 282:2012-2018(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING.
    Strain: Bristol N2.
  3. "Basolateral targeting by leucine-rich repeat domains in epithelial cells."
    Legouis R., Jaulin-Bastard F., Schott S., Navarro C., Borg J.-P., Labouesse M.
    EMBO Rep. 4:1096-1102(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, MUTAGENESIS OF PRO-305.
  4. "The apical disposition of the Caenorhabditis elegans intestinal terminal web is maintained by LET-413."
    Bossinger O., Fukushige T., Claeys M., Borgonie G., McGhee J.D.
    Dev. Biol. 268:448-456(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY.

Entry informationi

Entry nameiLAP1_CAEEL
AccessioniPrimary (citable) accession number: O61967
Secondary accession number(s): Q6A580, Q9NFN7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: September 27, 2005
Last modified: May 11, 2016
This is version 131 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.