Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein lap1

Gene

let-413

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Critical role in assembling adherens junctions; adapter protein involved in polarizing protein trafficking in epithelial cells. Necessary to maintain, not establish, the entire terminal web (organelle-depleted, intermediate filament-rich layer of cytoplasm that underlies the apical microvilli of polarized epithelial cells) or brush border assembly at the apical surface gut cells. Required for correct localization of ifb-2 intermediate filaments in the terminal web.2 Publications

GO - Biological processi

  • actin filament-based process Source: WormBase
  • cell adhesion Source: UniProtKB-KW
  • cell-cell junction assembly Source: WormBase
  • embryo development ending in birth or egg hatching Source: WormBase
  • embryonic digestive tract morphogenesis Source: WormBase
  • establishment or maintenance of cell polarity Source: UniProtKB
  • maintenance of epithelial cell apical/basal polarity Source: WormBase
  • protein transport Source: UniProtKB
  • regulation of intermediate filament polymerization or depolymerization Source: UniProtKB
  • signal transduction Source: GO_Central

Keywordsi

Biological processCell adhesion

Names & Taxonomyi

Protein namesi
Recommended name:
Protein lap1
Alternative name(s):
Lethal protein 413
Gene namesi
Name:let-413Imported
ORF Names:F26D11.11Imported
OrganismiCaenorhabditis elegans
Taxonomic identifieri6239 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
Proteomesi
  • UP000001940 Componenti: Chromosome V

Organism-specific databases

WormBaseiF26D11.11a; CE29778; WBGene00002632; let-413.
F26D11.11b; CE37008; WBGene00002632; let-413.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Disruption phenotypei

Worms display a severely affected epithelial integrity, leading to abnormal morphogenesis of the pharynx, intestine and embryo.1 Publication

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi305P → L: Abolishes membrane localization. 2 Publications1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001883051 – 699Protein lap1Add BLAST699

Proteomic databases

EPDiO61967.
PaxDbiO61967.
PeptideAtlasiO61967.

PTM databases

iPTMnetiO61967.

Expressioni

Tissue specificityi

Expressed in the terminal web of the intestine (PubMed:15063180, PubMed:27506200). Expressed in seam cells (PubMed:27506200).2 Publications

Developmental stagei

Expressed in all embryonic epithelial cells.1 Publication

Gene expression databases

BgeeiWBGene00002632.

Interactioni

Protein-protein interaction databases

BioGridi44213. 10 interactors.
DIPiDIP-25349N.
IntActiO61967. 7 interactors.
MINTiMINT-1058604.
STRINGi6239.F26D11.11b.

Structurei

3D structure databases

ProteinModelPortaliO61967.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati37 – 59LRR 1Add BLAST23
Repeati60 – 81LRR 2Add BLAST22
Repeati83 – 104LRR 3Add BLAST22
Repeati106 – 127LRR 4Add BLAST22
Repeati129 – 150LRR 5Add BLAST22
Repeati152 – 174LRR 6Add BLAST23
Repeati175 – 196LRR 7Add BLAST22
Repeati198 – 219LRR 8Add BLAST22
Repeati221 – 242LRR 9Add BLAST22
Repeati244 – 265LRR 10Add BLAST22
Repeati267 – 288LRR 11Add BLAST22
Repeati290 – 311LRR 12Add BLAST22
Repeati313 – 334LRR 13Add BLAST22
Repeati336 – 357LRR 14Add BLAST22
Repeati359 – 380LRR 15Add BLAST22
Repeati382 – 403LRR 16Add BLAST22
Domaini584 – 665PDZPROSITE-ProRule annotationAdd BLAST82

Sequence similaritiesi

Belongs to the LAP (LRR and PDZ) protein family.Curated

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

eggNOGiKOG0619. Eukaryota.
KOG3528. Eukaryota.
COG4886. LUCA.
GeneTreeiENSGT00840000129686.
HOGENOMiHOG000116557.
InParanoidiO61967.
OMAiNFERHNT.
OrthoDBiEOG091G01EF.
PhylomeDBiO61967.

Family and domain databases

Gene3Di3.80.10.10. 5 hits.
InterProiView protein in InterPro
IPR001611. Leu-rich_rpt.
IPR003591. Leu-rich_rpt_typical-subtyp.
IPR032675. LRR_dom_sf.
IPR001478. PDZ.
IPR036034. PDZ_sf.
PfamiView protein in Pfam
PF13855. LRR_8. 3 hits.
PF00595. PDZ. 1 hit.
SMARTiView protein in SMART
SM00369. LRR_TYP. 12 hits.
SM00228. PDZ. 1 hit.
SUPFAMiSSF50156. SSF50156. 1 hit.
PROSITEiView protein in PROSITE
PS51450. LRR. 14 hits.
PS50106. PDZ. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform b (identifier: O61967-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPAFFCLPMA CQRQVDSIDR SQSNLQAIPS DIFRFRKLED LNLTMNNIKE
60 70 80 90 100
LDHRLFSLRH LRILDVSDNE LAVLPAEIGN LTQLIELNLN RNSIAKLPDT
110 120 130 140 150
MQNCKLLTTL NLSSNPFTRL PETICECSSI TILSLNETSL TLLPSNIGSL
160 170 180 190 200
TNLRVLEARD NLLRTIPLSI VELRKLEELD LGQNELEALP AEIGKLTSLR
210 220 230 240 250
EFYVDINSLT SLPDSISGCR MLDQLDVSEN QIIRLPENLG RMPNLTDLNI
260 270 280 290 300
SINEIIELPS SFGELKRLQM LKADRNSLHN LTSEIGKCQS LTELYLGQNF
310 320 330 340 350
LTDLPDTIGD LRQLTTLNVD CNNLSDIPDT IGNCKSLTVL SLRQNILTEL
360 370 380 390 400
PMTIGKCENL TVLDVASNKL PHLPFTVKVL YKLQALWLSE NQTQSILKLS
410 420 430 440 450
ETRDDRKGIK VVTCYLLPQV DAIDGEGRSG SAQHNTDRGA FLGGPKVHFH
460 470 480 490 500
DQADTTFEEN KEAEIHLGNF ERHNTPHPKT PKHKKGSIDG HMLPHEIDQP
510 520 530 540 550
RQLSLVSNHR TSTSSFGESS NSINRDLADI RAQNGVREAT LSPEREERMA
560 570 580 590 600
TSLSSLSNLA AGTQNMHTIR IQKDDTGKLG LSFAGGTSND PAPNSNGDSG
610 620 630 640 650
LFVTKVTPGS AAYRCGLREG DKLIRANDVN MINASQDNAM EAIKKRETVE
660 670 680 690
LVVLRRSPSP VSRTSEPSLN GSSHQLNHFD AGSPDSTMFV TSSTPVYAS
Note: No experimental confirmation available.
Length:699
Mass (Da):77,350
Last modified:September 27, 2005 - v3
Checksum:i2CE6478B5039F2DE
GO
Isoform a (identifier: O61967-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     531-531: R → RFIDAPAS
     666-699: EPSLNGSSHQLNHFDAGSPDSTMFVTSSTPVYAS → VSRPCEY

Show »
Length:679
Mass (Da):75,336
Checksum:i608B8EDF5AC0F947
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_015673531R → RFIDAPAS in isoform a. 1 Publication1
Alternative sequenceiVSP_015674666 – 699EPSLN…PVYAS → VSRPCEY in isoform a. 1 PublicationAdd BLAST34

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ276590 mRNA. Translation: CAB91651.1.
FO081227 Genomic DNA. Translation: CCD70053.1.
FO081227 Genomic DNA. Translation: CCD70054.1.
PIRiT33295.
RefSeqiNP_001023850.1. NM_001028679.3. [O61967-2]
NP_001023851.1. NM_001028680.3. [O61967-1]
UniGeneiCel.6189.

Genome annotation databases

EnsemblMetazoaiF26D11.11b; F26D11.11b; WBGene00002632. [O61967-1]
GeneIDi179171.
KEGGicel:CELE_F26D11.11.
UCSCiF26D11.11a. c. elegans. [O61967-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiLAP1_CAEEL
AccessioniPrimary (citable) accession number: O61967
Secondary accession number(s): Q6A580, Q9NFN7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: September 27, 2005
Last modified: November 22, 2017
This is version 144 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
  2. SIMILARITY comments
    Index of protein domains and families