Reviewed,
UniProtKB/Swiss-Prot O61394 (GALT6_CAEEL)
Last modified
June 16, 2009.
Version 61.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Probable N-acetylgalactosaminyltransferase 6 EC=2.4.1.- Alternative name(s): Protein-UDP acetylgalactosaminyltransferase 6 UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 6 Short name=pp-GaNTase 6 | ||||
| Gene names |
| ||||
| Organism | Caenorhabditis elegans [Complete proteome] | ||||
| Taxonomic identifier | 6239 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Nematoda › Chromadorea › Rhabditida › Rhabditoidea › Rhabditidae › Peloderinae › Caenorhabditis |
Protein attributes
| Sequence length | 618 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Probable glycopeptide transferase involved in O-linked oligosaccharide biosynthesis. Glycopeptide transferases catalyze the transfer of an N-acetyl-D-galactosamine residue to an already glycosylated peptide By similarity. In contrast to other members of the family, it does not act as a peptide transferase that transfers GalNAc onto serine or threonine residue on peptides that have been tested. Some peptide transferase activity is however not excluded, considering that its appropriate peptide substrate may remain unidentified. |
| Cofactor | Manganese By similarity. Calcium By similarity. |
| Pathway | |
| Subcellular location | Golgi apparatus membrane; Single-pass type II membrane protein By similarity. |
| Domain | There are two conserved domains in the glycosyltransferase region: the N-terminal domain (domain A, also called GT1 motif), which is probably involved in manganese coordination and substrate binding and the C-terminal domain (domain B, also called Gal/GalNAc-T motif), which is probably involved in catalytic reaction and UDP-Gal binding By similarity. The ricin B-type lectin domain binds to GalNAc and contributes to the glycopeptide specificity By similarity. |
| Sequence similarities | Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily. Contains 1 ricin B-type lectin domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Golgi apparatus Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Signal-anchor Transmembrane |
| Ligand | Calcium Lectin Manganese |
| Molecular function | Glycosyltransferase Transferase |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Cellular component | Golgi membrane Inferred from electronic annotation. Source: UniProtKB-SubCell integral to membraneInferred from electronic annotation. Source: UniProtKB-KW |
| Molecular function | calcium ion binding Inferred from electronic annotation. Source: UniProtKB-KW manganese ion bindingInferred from electronic annotation. Source: UniProtKB-KW sugar bindingInferred from electronic annotation. Source: UniProtKB-KW transferase activity, transferring glycosyl groupsInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform a (identifier: O61394-1) Also known as: GLY6a; GLY-6a; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform b (identifier: O61394-2) Also known as: GLY6b; GLY-6b; The sequence of this isoform differs from the canonical sequence as follows: 479-512: TSSSNSSVCLAWTLRSSGIKTASTADCLKIFHKT → SNSNYCTAFRPGDTGPKNHRLLGSPCTMGFDLW | ||||||
| Isoform c (identifier: O61394-3) Also known as: GLY6c; GLY-6c; The sequence of this isoform differs from the canonical sequence as follows: 495-618: SGIKTASTAD...TEMSWLPEHP → CPTQTTAQPS...FTQLPIGKFN |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 618 | 618 | Probable N-acetylgalactosaminyltransferase 6 | PRO_0000059149 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 16 | 16 | Cytoplasmic Potential | ||||||||
| Transmembrane | 17 – 39 | 23 | Signal-anchor for type II membrane protein Potential | ||||||||
| Topological domain | 40 – 618 | 579 | Lumenal Potential | ||||||||
| Domain | 474 – 609 | 136 | Ricin B-type lectin | ||||||||
| Region | 156 – 267 | 112 | Catalytic subdomain A | ||||||||
| Region | 327 – 389 | 63 | Catalytic subdomain B | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 81 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 149 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 483 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 605 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 487 ↔ 505 | By similarity | |||||||||
| Disulfide bond | 530 ↔ 550 | By similarity | |||||||||
| Disulfide bond | 575 ↔ 597 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 479 – 512 | 34 | TSSSN…IFHKT → SNSNYCTAFRPGDTGPKNHR LLGSPCTMGFDLW in isoform b. | VSP_011240 | |||||||
| Alternative sequence | 495 – 618 | 124 | SGIKT…LPEHP → CPTQTTAQPSGQVTRVPKIT DCSDHPVLWDSTCGSCGSTL ATVEYVQMSIYAYQLFNFFT QLPIGKFN in isoform c. | VSP_011241 | |||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "cDNA cloning and expression of a family of UDP-N-acetyl-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase sequence homologs from Caenorhabditis elegans." Hagen F.K., Nehrke K. J. Biol. Chem. 273:8268-8277(1998) [PubMed: 9525933] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; B AND C). Strain: Bristol N2. |
| [2] | "Genome sequence of the nematode C. elegans: a platform for investigating biology." The C. elegans sequencing consortium Science 282:2012-2018(1998) [PubMed: 9851916] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: Bristol N2. |
Cross-references
Sequence databases | |
|---|---|
| AF031838 mRNA. Translation: AAC13674.1. AF031839 mRNA. Translation: AAC13675.1. AF031840 mRNA. Translation: AAC13676.1. AL024499 Genomic DNA. Translation: CAA19707.1. AL024499 Genomic DNA. Translation: CAC42317.1. AL024499 Genomic DNA. Translation: CAC42318.1. | |
| PIR | T42248. T42249. T42250. |
| RefSeq | NP_001022644.1. |
| UniGene | Cel.8088 |
3D structure databases | |
| ModBase | Search... |
Protein family/group databases | |
| CAZy | CBM13. Carbohydrate-Binding Module Family 13. GT27. Glycosyltransferase Family 27. |
Proteomic databases | |
| PRIDE | O61394. |
Genome annotation databases | |
| Ensembl | H38K22.5. Caenorhabditis elegans. [Contig view] |
| GeneID | 175558. |
| KEGG | cel:H38K22.5. |
Organism-specific databases | |
| WormBase | WBGene00001631. gly-6. |
| WormPep | H38K22.5a. CE18833. [WorfDB] H38K22.5b. CE28040. [WorfDB] H38K22.5c. CE28041. [WorfDB] |
Phylogenomic databases | |
| OMA | O61394. NLQFRWY. |
Gene expression databases | |
| ArrayExpress | O61394. |
Family and domain databases | |
| InterPro | IPR001173. Glyco_trans_2. IPR000772. Ricin_B_lectin. [Graphical view] |
| Pfam | PF00535. Glycos_transf_2. 1 hit. PF00652. Ricin_B_lectin. 1 hit. [Graphical view] |
| SMART | SM00458. RICIN. 1 hit. [Graphical view] |
| PROSITE | PS50231. RICIN_B_LECTIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 888666. |
Entry information
| Entry name | GALT6_CAEEL | ||||||||
| Accession | Primary (citable) accession number: O61394 Secondary accession number(s): O61395, O61396 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | Caenorhabditis annotation project | ||||||||
Relevant documents
| Caenorhabditis elegans Caenorhabditis elegans: entries, gene names and cross-references to WormPep |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with


