SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O60936

- NOL3_HUMAN

UniProt

O60936 - NOL3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Nucleolar protein 3
Gene
NOL3, ARC, NOP
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Isoform 1 may be involved in RNA splicing.
Isoform 2 may inhibit apoptosis.

GO - Molecular functioni

  1. RNA binding Source: ProtInc
  2. identical protein binding Source: IntAct
  3. protein binding Source: UniProtKB

GO - Biological processi

  1. RNA splicing Source: ProtInc
  2. apoptotic process Source: UniProtKB-KW
  3. mRNA processing Source: UniProtKB-KW
  4. negative regulation of apoptotic process Source: ProtInc
Complete GO annotation...

Keywords - Biological processi

Apoptosis, mRNA processing, mRNA splicing

Names & Taxonomyi

Protein namesi
Recommended name:
Nucleolar protein 3
Alternative name(s):
Apoptosis repressor with CARD
Muscle-enriched cytoplasmic protein
Short name:
Myp
Nucleolar protein of 30 kDa
Short name:
Nop30
Gene namesi
Name:NOL3
Synonyms:ARC, NOP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 16

Organism-specific databases

HGNCiHGNC:7869. NOL3.

Subcellular locationi

Isoform 1 : Nucleusnucleolus
Note: The SR-rich C-terminus mediates nuclear localization.1 Publication
Isoform 2 : Cytoplasm 1 Publication
Isoform 3 : Cytoplasm Inferred 1 Publication

GO - Cellular componenti

  1. cytosol Source: ProtInc
  2. mitochondrion Source: UniProtKB
  3. nucleolus Source: ProtInc
  4. sarcoplasm Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Involvement in diseasei

Myoclonus, familial cortical (FCM) [MIM:614937]: An autosomal dominant neurologic condition characterized by adult onset of cortical myoclonus manifest as involuntary jerks or movements affecting the face and limbs. Affected individuals can also experience falls without seizure activity or loss of consciousness.
Note: The disease is caused by mutations affecting the gene represented in this entry.1 Publication
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti21 – 211E → Q in FCM; the mutation may alter post-translational modification of the protein. 1 Publication
VAR_069731

Keywords - Diseasei

Disease mutation

Organism-specific databases

MIMi614937. phenotype.
Orphaneti319189. Familial cortical myoclonus.
PharmGKBiPA31673.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 219219Nucleolar protein 3
PRO_0000144099Add
BLAST

Proteomic databases

MaxQBiO60936.
PaxDbiO60936.
PeptideAtlasiO60936.
PRIDEiO60936.

Expressioni

Tissue specificityi

Highly expressed in heart and skeletal muscle. Detected at low levels in placenta, liver, kidney and pancreas.

Gene expression databases

ArrayExpressiO60936.
BgeeiO60936.
CleanExiHS_ARC.
HS_NOL3.
GenevestigatoriO60936.

Organism-specific databases

HPAiCAB009208.

Interactioni

Subunit structurei

Interacts with TFPT By similarity. Isoform 1 oligomerizes and binds to SFRS9/SRp30C and also interacts with NPM1. Isoform 2 binds CASP2/caspase-2 and CASP8/caspase-8 and inhibits caspase-8 activity.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
itself2EBI-740992,EBI-740992
CASP8Q147903EBI-740992,EBI-78060

Protein-protein interaction databases

BioGridi114477. 36 interactions.
DIPiDIP-29940N.
IntActiO60936. 5 interactions.
MINTiMINT-1462750.
STRINGi9606.ENSP00000268605.

Structurei

3D structure databases

ProteinModelPortaliO60936.
SMRiO60936. Positions 10-86.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini4 – 9592CARD
Add
BLAST

Sequence similaritiesi

Contains 1 CARD domain.

Phylogenomic databases

eggNOGiNOG44360.
HOGENOMiHOG000113820.
PhylomeDBiO60936.
TreeFamiTF336957.

Family and domain databases

Gene3Di1.10.533.10. 1 hit.
InterProiIPR001315. CARD.
IPR011029. DEATH-like_dom.
[Graphical view]
PfamiPF00619. CARD. 1 hit.
[Graphical view]
SMARTiSM00114. CARD. 1 hit.
[Graphical view]
SUPFAMiSSF47986. SSF47986. 1 hit.
PROSITEiPS50209. CARD. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O60936-1) [UniParc]FASTAAdd to Basket

Also known as: Nop30

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MGNAQERPSE TIDRERKRLV ETLQADSGLL LDALLARGVL TGPEYEALDA    50
LPDAERRVRR LLLLVQGKGE AACQELLRCA QRTAGAPDPA WDWQHATGTA 100
AMTLHAQATG RRRHPARGPH APGCPELQTL TRPGALRAPR RCNPGPRRSQ 150
SQSWKLRPLK RLNRSRSQSQ SWNPRLKQNQ SRNWSQNRTQ SPSPTSRKGT 200
SPKIPEGQSS DRRCPAHAG 219
Length:219
Mass (Da):24,327
Last modified:August 1, 1998 - v1
Checksum:iB1CCCB199D4FEE09
GO
Isoform 2 (identifier: O60936-2) [UniParc]FASTAAdd to Basket

Also known as: Myp

The sequence of this isoform differs from the canonical sequence as follows:
     96-219: ATGTAAMTLH...SDRRCPAHAG → VGPGYRDRSY...FEERDESEDS

Show »
Length:208
Mass (Da):22,629
Checksum:i239EF1A143EF6168
GO
Isoform 3 (identifier: O60936-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPVLGKAGEERRATADAWGQKEEPEEETGQSVWRGRRTPSSPCWPPGPVLAEPSGGWDRAPTM
     96-208: ATGTAAMTLH...GTSPKIPEGQ → VGPGYRDRSY...FEERDESEDS
     209-219: Missing.

Note: No experimental confirmation available.

Show »
Length:270
Mass (Da):29,355
Checksum:iACA253B5CD21348B
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti21 – 211E → Q in FCM; the mutation may alter post-translational modification of the protein. 1 Publication
VAR_069731

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MPVLGKAGEERRATADAWGQ KEEPEEETGQSVWRGRRTPS SPCWPPGPVLAEPSGGWDRA PTM in isoform 3.
VSP_054607
Alternative sequencei96 – 219124ATGTA…PAHAG → VGPGYRDRSYDPPCPGHWTP EAPGSGTTCPGLPRASDPDE AGGPEGSEAVQSGTPEEPEP ELEAEASKEAEPEPEPEPEL EPEAEAEPEPELEPEPDPEP EPDFEERDESEDS in isoform 2.
VSP_000789Add
BLAST
Alternative sequencei96 – 208113ATGTA…IPEGQ → VGPGYRDRSYDPPCPGHWTP EAPGSGTTCPGLPRASDPDE AGGPEGSEAVQSGTPEEPEP ELEAEASKEAEPEPEPEPEL EPEAEAEPEPELEPEPDPEP EPDFEERDESEDS in isoform 3.
VSP_054608Add
BLAST
Alternative sequencei209 – 21911Missing in isoform 3.
VSP_054609Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF043244 mRNA. Translation: AAC34993.1.
AF064598 Genomic DNA. Translation: AAC18590.1.
AF064598 Genomic DNA. Translation: AAC18591.1.
AF064599 mRNA. Translation: AAC18593.1.
AF064600 mRNA. Translation: AAC18594.1.
AK294145 mRNA. Translation: BAG57471.1.
AC074143 Genomic DNA. No translation available.
CH471092 Genomic DNA. Translation: EAW83087.1.
BC012798 mRNA. Translation: AAH12798.1.
CCDSiCCDS42176.1. [O60936-2]
CCDS58473.1. [O60936-1]
CCDS61960.1. [O60936-3]
RefSeqiNP_001171986.1. NM_001185057.2. [O60936-1]
NP_001263236.1. NM_001276307.1. [O60936-2]
NP_001263238.1. NM_001276309.1. [O60936-2]
NP_001263240.1. NM_001276311.1.
NP_001263241.1. NM_001276312.1. [O60936-2]
NP_001263248.1. NM_001276319.1. [O60936-3]
NP_003937.1. NM_003946.6. [O60936-2]
XP_006721385.1. XM_006721322.1. [O60936-3]
UniGeneiHs.513667.

Genome annotation databases

EnsembliENST00000268605; ENSP00000268605; ENSG00000140939. [O60936-2]
ENST00000432069; ENSP00000399831; ENSG00000140939. [O60936-2]
ENST00000564053; ENSP00000457243; ENSG00000140939.
ENST00000568146; ENSP00000454598; ENSG00000140939. [O60936-1]
GeneIDi8996.
KEGGihsa:8996.
UCSCiuc010vjd.3. human. [O60936-1]
uc031qwm.1. human.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF043244 mRNA. Translation: AAC34993.1 .
AF064598 Genomic DNA. Translation: AAC18590.1 .
AF064598 Genomic DNA. Translation: AAC18591.1 .
AF064599 mRNA. Translation: AAC18593.1 .
AF064600 mRNA. Translation: AAC18594.1 .
AK294145 mRNA. Translation: BAG57471.1 .
AC074143 Genomic DNA. No translation available.
CH471092 Genomic DNA. Translation: EAW83087.1 .
BC012798 mRNA. Translation: AAH12798.1 .
CCDSi CCDS42176.1. [O60936-2 ]
CCDS58473.1. [O60936-1 ]
CCDS61960.1. [O60936-3 ]
RefSeqi NP_001171986.1. NM_001185057.2. [O60936-1 ]
NP_001263236.1. NM_001276307.1. [O60936-2 ]
NP_001263238.1. NM_001276309.1. [O60936-2 ]
NP_001263240.1. NM_001276311.1.
NP_001263241.1. NM_001276312.1. [O60936-2 ]
NP_001263248.1. NM_001276319.1. [O60936-3 ]
NP_003937.1. NM_003946.6. [O60936-2 ]
XP_006721385.1. XM_006721322.1. [O60936-3 ]
UniGenei Hs.513667.

3D structure databases

ProteinModelPortali O60936.
SMRi O60936. Positions 10-86.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 114477. 36 interactions.
DIPi DIP-29940N.
IntActi O60936. 5 interactions.
MINTi MINT-1462750.
STRINGi 9606.ENSP00000268605.

Proteomic databases

MaxQBi O60936.
PaxDbi O60936.
PeptideAtlasi O60936.
PRIDEi O60936.

Protocols and materials databases

DNASUi 8996.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000268605 ; ENSP00000268605 ; ENSG00000140939 . [O60936-2 ]
ENST00000432069 ; ENSP00000399831 ; ENSG00000140939 . [O60936-2 ]
ENST00000564053 ; ENSP00000457243 ; ENSG00000140939 .
ENST00000568146 ; ENSP00000454598 ; ENSG00000140939 . [O60936-1 ]
GeneIDi 8996.
KEGGi hsa:8996.
UCSCi uc010vjd.3. human. [O60936-1 ]
uc031qwm.1. human.

Organism-specific databases

CTDi 8996.
GeneCardsi GC16P067207.
HGNCi HGNC:7869. NOL3.
HPAi CAB009208.
MIMi 605235. gene.
614937. phenotype.
neXtProti NX_O60936.
Orphaneti 319189. Familial cortical myoclonus.
PharmGKBi PA31673.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG44360.
HOGENOMi HOG000113820.
PhylomeDBi O60936.
TreeFami TF336957.

Miscellaneous databases

ChiTaRSi NOL3. human.
GeneWikii NOL3.
GenomeRNAii 8996.
NextBioi 33735.
PROi O60936.
SOURCEi Search...

Gene expression databases

ArrayExpressi O60936.
Bgeei O60936.
CleanExi HS_ARC.
HS_NOL3.
Genevestigatori O60936.

Family and domain databases

Gene3Di 1.10.533.10. 1 hit.
InterProi IPR001315. CARD.
IPR011029. DEATH-like_dom.
[Graphical view ]
Pfami PF00619. CARD. 1 hit.
[Graphical view ]
SMARTi SM00114. CARD. 1 hit.
[Graphical view ]
SUPFAMi SSF47986. SSF47986. 1 hit.
PROSITEi PS50209. CARD. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "ARC, an inhibitor of apoptosis expressed in skeletal muscle and heart that interacts selectively with caspases."
    Koseki T., Inohara N., Chen S., Nunez G.
    Proc. Natl. Acad. Sci. U.S.A. 95:5156-5160(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), INTERACTION WITH CASP2; CASP8; NPM1 AND SFRS9.
  2. "Alternative splicing determines the intracellular localization of the novel nuclear protein Nop30 and its interaction with the splicing factor SRp30c."
    Stoss O., Schwaiger F.-W., Cooper T.A., Stamm S.
    J. Biol. Chem. 274:10951-10962(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1 AND 2), SUBCELLULAR LOCATION, SUBUNIT, INTERACTION WITH SFRS9.
    Tissue: Cervix carcinoma.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Brain cortex.
  4. "The sequence and analysis of duplication-rich human chromosome 16."
    Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
    , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
    Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Kidney.
  7. Cited for: VARIANT FCM GLN-21, CHARACTERIZATION OF VARIANT FCM GLN-21.

Entry informationi

Entry nameiNOL3_HUMAN
AccessioniPrimary (citable) accession number: O60936
Secondary accession number(s): B4DFL0, O60937
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 2, 2002
Last sequence update: August 1, 1998
Last modified: September 3, 2014
This is version 120 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi