Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nucleolar protein 3

Gene

NOL3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Isoform 1: May be involved in RNA splicing.1 Publication
Isoform 2: Functions as an apoptosis repressor that blocks multiple modes of cell death. Inhibits extrinsic apoptotic pathways through two different ways. Firstly by interacting with FAS and FADD upon FAS activation blocking death-inducing signaling complex (DISC) assembly (By similarity). Secondly by interacting with CASP8 in a mitochondria localization- and phosphorylation-dependent manner, limiting the amount of soluble CASP8 available for DISC-mediated activation (By similarity). Inhibits intrinsic apoptotic pathway in response to a wide range of stresses, through its interaction with BAX resulting in BAX inactivation, preventing mitochondrial dysfunction and release of pro-apoptotic factors (PubMed:15004034). Inhibits calcium-mediated cell death by functionning as a cytosolic calcium buffer, dissociating its interaction with CASP8 and maintaining calcium homeostasis (PubMed:15509781). Negatively regulates oxidative stress-induced apoptosis by phosphorylation-dependent suppression of the mitochondria-mediated intrinsic pathway, by blocking CASP2 activation and BAX translocation (By similarity). Negatively regulates hypoxia-induced apoptosis in part by inhibiting the release of cytochrome c from mitochondria in a caspase-independent manner (By similarity). Also inhibits TNF-induced necrosis by preventing TNF-signaling pathway through TNFRSF1A interaction abrogating the recruitment of RIPK1 to complex I (By similarity). Finally through its role as apoptosis repressor, promotes vascular remodeling through inhibition of apoptosis and stimulation of proliferation, in response to hypoxia (By similarity). Inhibits too myoblast differentiation through caspase inhibition (By similarity).By similarity2 Publications

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Calcium bindingi99 – 2081101 PublicationAdd
BLAST

GO - Molecular functioni

  • calcium ion binding Source: UniProtKB
  • caspase binding Source: UniProtKB
  • cysteine-type endopeptidase inhibitor activity involved in apoptotic process Source: UniProtKB
  • identical protein binding Source: IntAct
  • RNA binding Source: ProtInc

GO - Biological processi

  • inhibition of cysteine-type endopeptidase activity involved in apoptotic process Source: UniProtKB
  • mRNA splice site selection Source: UniProtKB
  • negative regulation of apoptotic process Source: UniProtKB
  • negative regulation of extrinsic apoptotic signaling pathway Source: UniProtKB
  • negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway Source: UniProtKB
  • negative regulation of release of cytochrome c from mitochondria Source: UniProtKB
  • protein oligomerization Source: UniProtKB
  • release of sequestered calcium ion into cytosol by sarcoplasmic reticulum Source: UniProtKB
  • response to hypoxia Source: Ensembl
  • response to injury involved in regulation of muscle adaptation Source: Ensembl
  • RNA splicing Source: ProtInc
Complete GO annotation...

Keywords - Biological processi

Apoptosis, mRNA processing, mRNA splicing

Keywords - Ligandi

Calcium, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Nucleolar protein 3Imported
Alternative name(s):
Apoptosis repressor with CARD1 Publication
Muscle-enriched cytoplasmic protein1 Publication
Short name:
Myp1 Publication
Nucleolar protein of 30 kDa1 Publication
Short name:
Nop301 Publication
Gene namesi
Name:NOL3Imported
Synonyms:ARC1 Publication, NOP1 Publication
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:7869. NOL3.

Subcellular locationi

Isoform 1 :
  • Nucleusnucleolus 1 Publication

  • Note: The SR-rich C-terminus mediates nuclear localization.1 Publication
Isoform 2 :
  • Cytoplasm 1 Publication
  • Mitochondrion By similarity
  • Sarcoplasmic reticulum By similarity

  • Note: Phosphorylation at Thr-149 results in translocation to mithochondria. Colocalized with mitochondria in response to oxidative stress.By similarity

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • cytosol Source: ProtInc
  • mitochondrion Source: UniProtKB
  • nucleolus Source: UniProtKB
  • sarcoplasmic reticulum Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Mitochondrion, Nucleus, Sarcoplasmic reticulum

Pathology & Biotechi

Involvement in diseasei

Myoclonus, familial cortical (FCM)1 Publication

The disease is caused by mutations affecting the gene represented in this entry.

Disease descriptionAn autosomal dominant neurologic condition characterized by adult onset of cortical myoclonus manifest as involuntary jerks or movements affecting the face and limbs. Affected individuals can also experience falls without seizure activity or loss of consciousness.

See also OMIM:614937
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti21 – 211E → Q in FCM; the mutation may alter post-translational modification of the protein. 1 Publication
VAR_069731
Natural varianti80 – 801A → T in FCM. 1 Publication
VAR_072644

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi17 – 171K → R: Abolished ubiquitination in response to an apoptotic stimulus; when associated with R-68 and R-163. 1 Publication
Mutagenesisi31 – 311L → F: Did not reduce creatine kinase release or infarct size after myocardial ischemia/reperfusion. Causes loss of mitochondrial membrane potential and nuclear condensation. Failes to prevent the increase in Bax. Interacts with BAX. 1 Publication
Mutagenesisi68 – 681K → R: Abolished ubiquitination in response to an apoptotic stimulus; when associated with R-17 and R-163. 1 Publication
Mutagenesisi163 – 1631K → R: Abolished ubiquitination in response to an apoptotic stimulus; when associated with R-17 and R-68. 1 Publication

Keywords - Diseasei

Disease mutation

Organism-specific databases

MIMi614937. phenotype.
Orphaneti319189. Familial cortical myoclonus.
PharmGKBiPA31673.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 208208Nucleolar protein 3PRO_0000144099Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei149 – 1491Phosphothreonine; by CK2By similarity

Post-translational modificationi

Phosphorylation at Thr-149 is required for its antiapoptotic effect by blocking death-inducing signaling complex death-inducing signaling complex (DISC) activity through the control of interaction with CASP8. Phosphorylation at Thr-149 results in translocation to mithochondria and this translocation enables the binding to CASP8. Dephosphorylated at Thr-149 by calcineurin; doesn't inhibit the association between FADD and CASP8 and the consequent apoptosis.By similarity
Polyubiquitinated by MDM2; promoting proteasomal-dependent degradation in response to apoptotic stimuli.By similarity1 Publication

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiO60936.
PaxDbiO60936.
PeptideAtlasiO60936.
PRIDEiO60936.

Expressioni

Tissue specificityi

Highly expressed in heart and skeletal muscle. Detected at low levels in placenta, liver, kidney and pancreas.

Inductioni

Protein expression decreases in hearts failure patients (PubMed:16505176) and in response to oxidative stress (PubMed:17142452).2 Publications

Gene expression databases

BgeeiO60936.
CleanExiHS_ARC.
HS_NOL3.
ExpressionAtlasiO60936. baseline and differential.
GenevestigatoriO60936.

Organism-specific databases

HPAiCAB009208.

Interactioni

Subunit structurei

Oligomerizes (via CARD doamin). Interacts (via CARD domain) with CASP2; inhibits CASP2 activity in a phosphorylation-dependent manner. Interacts with CASP8; decreases CASP8 activity in a mitochondria localization- and phosphorylation-dependent manner and this interaction is dissociated by calcium. Interacts with TFPT; translocates NOL3 into the nucleus and negatively regulated TFPT-induced cell death (By similarity). Interacts directly (via CARD domain) with FAS and FADD (via DED domain); inhibits death-inducing signaling complex death-inducing signaling complex (DISC) assembly by inhibiting the increase in FAS-FADD binding induced by FAS activation (By similarity). Interacts (via CARD domain) with BAX (via a C-terminal 33 residues); inhibits BAX activation and translocation and consequently cytochrome c release from mitochondria. Interacts with PPM1G; may dephosphorylate NOL3 (By similarity). Interacts (via CARD domain) with BBC3 (via BH3 domain); preventing the association of BBC3 with BCL2 and resulting in activation of CASP8 (By similarity). Interacts (via CARD domain) with BAD(via BH3 domain); preventing the association of BAD with BCL2 (By similarity). Interacts directly (via CARD domain) with TNFRSF1A; inhibits TNF-signaling pathway (By similarity). Isoform 1 binds to SFRS9/SRp30C.By similarity4 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
itself2EBI-740992,EBI-740992
CASP8Q147903EBI-740992,EBI-78060

Protein-protein interaction databases

BioGridi114477. 36 interactions.
DIPiDIP-29940N.
IntActiO60936. 5 interactions.
MINTiMINT-1462750.
STRINGi9606.ENSP00000268605.

Structurei

3D structure databases

ProteinModelPortaliO60936.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini4 – 9592CARDPROSITE-ProRule annotationAdd
BLAST

Domaini

CARD is critical for both extrinsic and intrinsic apoptotic pathways (By similarity). CARD domain mediates a protective effect against myocardial ischemia/reperfusion, oxidative stress and TNF-induced necrosis (PubMed:15004034) (By similarity). The calcium binding domain plays a protective role in calcium-mediated cell death (PubMed:15509781).By similarity2 Publications

Sequence similaritiesi

Contains 1 CARD domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG44360.
GeneTreeiENSGT00510000049353.
HOGENOMiHOG000113820.
InParanoidiO60936.
OMAiAPTMGNA.
PhylomeDBiO60936.
TreeFamiTF336957.

Family and domain databases

Gene3Di1.10.533.10. 1 hit.
InterProiIPR001315. CARD.
IPR011029. DEATH-like_dom.
[Graphical view]
PfamiPF00619. CARD. 1 hit.
[Graphical view]
SMARTiSM00114. CARD. 1 hit.
[Graphical view]
SUPFAMiSSF47986. SSF47986. 1 hit.
PROSITEiPS50209. CARD. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 2Curated (identifier: O60936-2) [UniParc]FASTAAdd to basket

Also known as: Myp1 Publication

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGNAQERPSE TIDRERKRLV ETLQADSGLL LDALLARGVL TGPEYEALDA
60 70 80 90 100
LPDAERRVRR LLLLVQGKGE AACQELLRCA QRTAGAPDPA WDWQHVGPGY
110 120 130 140 150
RDRSYDPPCP GHWTPEAPGS GTTCPGLPRA SDPDEAGGPE GSEAVQSGTP
160 170 180 190 200
EEPEPELEAE ASKEAEPEPE PEPELEPEAE AEPEPELEPE PDPEPEPDFE

ERDESEDS
Length:208
Mass (Da):22,629
Last modified:April 1, 2015 - v2
Checksum:i239EF1A143EF6168
GO
Isoform 1Curated (identifier: O60936-1) [UniParc]FASTAAdd to basket

Also known as: Nop301 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     96-208: VGPGYRDRSY...FEERDESEDS → ATGTAAMTLH...SDRRCPAHAG

Show »
Length:219
Mass (Da):24,327
Checksum:iB1CCCB199D4FEE09
GO
Isoform 3Curated (identifier: O60936-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPVLGKAGEERRATADAWGQKEEPEEETGQSVWRGRRTPSSPCWPPGPVLAEPSGGWDRAPTM

Note: No experimental confirmation available.

Show »
Length:270
Mass (Da):29,355
Checksum:iACA253B5CD21348B
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti21 – 211E → Q in FCM; the mutation may alter post-translational modification of the protein. 1 Publication
VAR_069731
Natural varianti80 – 801A → T in FCM. 1 Publication
VAR_072644

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MPVLGKAGEERRATADAWGQ KEEPEEETGQSVWRGRRTPS SPCWPPGPVLAEPSGGWDRA PTM in isoform 3. 1 PublicationVSP_054607
Alternative sequencei96 – 208113VGPGY…ESEDS → ATGTAAMTLHAQATGRRRHP ARGPHAPGCPELQTLTRPGA LRAPRRCNPGPRRSQSQSWK LRPLKRLNRSRSQSQSWNPR LKQNQSRNWSQNRTQSPSPT SRKGTSPKIPEGQSSDRRCP AHAG in isoform 1. 1 PublicationVSP_057515Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF043244 mRNA. Translation: AAC34993.1.
AF064598 Genomic DNA. Translation: AAC18590.1.
AF064598 Genomic DNA. Translation: AAC18591.1.
AF064599 mRNA. Translation: AAC18593.1.
AF064600 mRNA. Translation: AAC18594.1.
AK294145 mRNA. Translation: BAG57471.1.
AC074143 Genomic DNA. No translation available.
CH471092 Genomic DNA. Translation: EAW83087.1.
BC012798 mRNA. Translation: AAH12798.1.
CCDSiCCDS42176.1. [O60936-2]
CCDS58473.1. [O60936-2]
CCDS61960.1. [O60936-3]
RefSeqiNP_001171986.1. NM_001185057.2. [O60936-1]
NP_001263236.1. NM_001276307.1. [O60936-2]
NP_001263238.1. NM_001276309.1. [O60936-2]
NP_001263240.1. NM_001276311.1.
NP_001263241.1. NM_001276312.1. [O60936-2]
NP_001263248.1. NM_001276319.1. [O60936-3]
NP_003937.1. NM_003946.6. [O60936-2]
XP_006721385.1. XM_006721322.2. [O60936-3]
UniGeneiHs.513667.

Genome annotation databases

EnsembliENST00000268605; ENSP00000268605; ENSG00000140939. [O60936-2]
ENST00000564053; ENSP00000457243; ENSG00000140939. [O60936-3]
ENST00000568146; ENSP00000454598; ENSG00000140939. [O60936-1]
GeneIDi8996.
KEGGihsa:8996.
UCSCiuc010vjd.3. human. [O60936-2]
uc031qwm.1. human.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF043244 mRNA. Translation: AAC34993.1.
AF064598 Genomic DNA. Translation: AAC18590.1.
AF064598 Genomic DNA. Translation: AAC18591.1.
AF064599 mRNA. Translation: AAC18593.1.
AF064600 mRNA. Translation: AAC18594.1.
AK294145 mRNA. Translation: BAG57471.1.
AC074143 Genomic DNA. No translation available.
CH471092 Genomic DNA. Translation: EAW83087.1.
BC012798 mRNA. Translation: AAH12798.1.
CCDSiCCDS42176.1. [O60936-2]
CCDS58473.1. [O60936-2]
CCDS61960.1. [O60936-3]
RefSeqiNP_001171986.1. NM_001185057.2. [O60936-1]
NP_001263236.1. NM_001276307.1. [O60936-2]
NP_001263238.1. NM_001276309.1. [O60936-2]
NP_001263240.1. NM_001276311.1.
NP_001263241.1. NM_001276312.1. [O60936-2]
NP_001263248.1. NM_001276319.1. [O60936-3]
NP_003937.1. NM_003946.6. [O60936-2]
XP_006721385.1. XM_006721322.2. [O60936-3]
UniGeneiHs.513667.

3D structure databases

ProteinModelPortaliO60936.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114477. 36 interactions.
DIPiDIP-29940N.
IntActiO60936. 5 interactions.
MINTiMINT-1462750.
STRINGi9606.ENSP00000268605.

Proteomic databases

MaxQBiO60936.
PaxDbiO60936.
PeptideAtlasiO60936.
PRIDEiO60936.

Protocols and materials databases

DNASUi8996.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000268605; ENSP00000268605; ENSG00000140939. [O60936-2]
ENST00000564053; ENSP00000457243; ENSG00000140939. [O60936-3]
ENST00000568146; ENSP00000454598; ENSG00000140939. [O60936-1]
GeneIDi8996.
KEGGihsa:8996.
UCSCiuc010vjd.3. human. [O60936-2]
uc031qwm.1. human.

Organism-specific databases

CTDi8996.
GeneCardsiGC16P067207.
HGNCiHGNC:7869. NOL3.
HPAiCAB009208.
MIMi605235. gene.
614937. phenotype.
neXtProtiNX_O60936.
Orphaneti319189. Familial cortical myoclonus.
PharmGKBiPA31673.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG44360.
GeneTreeiENSGT00510000049353.
HOGENOMiHOG000113820.
InParanoidiO60936.
OMAiAPTMGNA.
PhylomeDBiO60936.
TreeFamiTF336957.

Miscellaneous databases

ChiTaRSiNOL3. human.
GeneWikiiNOL3.
GenomeRNAii8996.
NextBioi33735.
PROiO60936.
SOURCEiSearch...

Gene expression databases

BgeeiO60936.
CleanExiHS_ARC.
HS_NOL3.
ExpressionAtlasiO60936. baseline and differential.
GenevestigatoriO60936.

Family and domain databases

Gene3Di1.10.533.10. 1 hit.
InterProiIPR001315. CARD.
IPR011029. DEATH-like_dom.
[Graphical view]
PfamiPF00619. CARD. 1 hit.
[Graphical view]
SMARTiSM00114. CARD. 1 hit.
[Graphical view]
SUPFAMiSSF47986. SSF47986. 1 hit.
PROSITEiPS50209. CARD. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "ARC, an inhibitor of apoptosis expressed in skeletal muscle and heart that interacts selectively with caspases."
    Koseki T., Inohara N., Chen S., Nunez G.
    Proc. Natl. Acad. Sci. U.S.A. 95:5156-5160(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), INTERACTION WITH CASP2 AND CASP8.
  2. "Alternative splicing determines the intracellular localization of the novel nuclear protein Nop30 and its interaction with the splicing factor SRp30c."
    Stoss O., Schwaiger F.-W., Cooper T.A., Stamm S.
    J. Biol. Chem. 274:10951-10962(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1 AND 2), SUBCELLULAR LOCATION, SUBUNIT, INTERACTION WITH SFRS9, FUNCTION (ISOFORM 1).
    Tissue: Cervix carcinoma.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Brain cortex.
  4. "The sequence and analysis of duplication-rich human chromosome 16."
    Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
    , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
    Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Kidney.
  7. "Apoptosis repressor with caspase recruitment domain protects against cell death by interfering with Bax activation."
    Gustafsson A.B., Tsai J.G., Logue S.E., Crow M.T., Gottlieb R.A.
    J. Biol. Chem. 279:21233-21238(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION (ISOFORM 2), INTERACTION WITH BAX, DOMAIN.
  8. "Calcium binding of ARC mediates regulation of caspase 8 and cell death."
    Jo D.G., Jun J.I., Chang J.W., Hong Y.M., Song S., Cho D.H., Shim S.M., Lee H.J., Cho C., Kim D.H., Jung Y.K.
    Mol. Cell. Biol. 24:9763-9770(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION (ISOFORM 2), DOMAIN, INTERACTION WITH CASP8.
  9. "Apoptosis repressor with caspase recruitment domain is required for cardioprotection in response to biomechanical and ischemic stress."
    Donath S., Li P., Willenbockel C., Al-Saadi N., Gross V., Willnow T., Bader M., Martin U., Bauersachs J., Wollert K.C., Dietz R., von Harsdorf R.
    Circulation 113:1203-1212(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: INDUCTION.
  10. "The apoptosis inhibitor ARC undergoes ubiquitin-proteasomal-mediated degradation in response to death stimuli: identification of a degradation-resistant mutant."
    Nam Y.J., Mani K., Wu L., Peng C.F., Calvert J.W., Foo R.S., Krishnamurthy B., Miao W., Ashton A.W., Lefer D.J., Kitsis R.N.
    J. Biol. Chem. 282:5522-5528(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: INDUCTION, UBIQUITINATION, MUTAGENESIS OF LYS-17; LYS-68 AND LYS-163.
  11. Cited for: VARIANT FCM GLN-21, CHARACTERIZATION OF VARIANT FCM GLN-21.
  12. Cited for: VARIANT FCM THR-80.

Entry informationi

Entry nameiNOL3_HUMAN
AccessioniPrimary (citable) accession number: O60936
Secondary accession number(s): B4DFL0, O60937
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 2, 2002
Last sequence update: April 1, 2015
Last modified: May 27, 2015
This is version 127 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.