O60909 (B4GT2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 121.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Beta-1,4-galactosyltransferase 2 Short name=Beta-1,4-GalTase 2 Short name=Beta4Gal-T2 Short name=b4Gal-T2 EC=2.4.1.- Alternative name(s): UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 2 UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 2 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 372 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Responsible for the synthesis of complex-type N-linked oligosaccharides in many glycoproteins as well as the carbohydrate moieties of glycolipids. Can produce lactose. |
| Catalytic activity | UDP-alpha-D-galactose + D-glucose = UDP + lactose. UDP-alpha-D-galactose + N-acetyl-beta-D-glucosaminylglycopeptide = UDP + beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminylglycopeptide. UDP-alpha-D-galactose + N-acetyl-D-glucosamine = UDP + N-acetyllactosamine. |
| Cofactor | Manganese By similarity. |
| Pathway | |
| Subcellular location | Golgi apparatus › Golgi stack membrane; Single-pass type II membrane protein. Note: Trans cisternae of Golgi stack. |
| Tissue specificity | Weakly expressed in various tissues. Highest expression in prostate, testis, ovary, intestine, muscle, and in fetal brain. |
| Sequence similarities | Belongs to the glycosyltransferase 7 family. |
| Biophysicochemical properties | Kinetic parameters: KM=71 µM for GlcNAc-B-S-pNP Ref.3 |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O60909-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O60909-2) The sequence of this isoform differs from the canonical sequence as follows: 1-118: Missing. 119-119: E → MPSTQLLAAAAAAATAPGPTPPPLAPGSLRSPVPCPVPRLPRCHPVLTRHLVL | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: O60909-3) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MAVEVQEQWPCLPAAGCPGPLGGPVAACGM | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 372 | 372 | Beta-1,4-galactosyltransferase 2 | PRO_0000080533 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 15 | 15 | Cytoplasmic Potential | ||||||||
| Transmembrane | 16 – 36 | 21 | Helical; Signal-anchor for type II membrane protein; Potential | ||||||||
| Topological domain | 37 – 372 | 336 | Lumenal Potential | ||||||||
Sites | |||||||||||
| Metal binding | 218 | 1 | Manganese By similarity | ||||||||
| Metal binding | 311 | 1 | Manganese By similarity | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 66 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 71 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 357 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 97 ↔ 139 | By similarity | |||||||||
| Disulfide bond | 211 ↔ 230 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 118 | 118 | Missing in isoform 2. | VSP_014103 | |||||||
| Alternative sequence | 1 | 1 | M → MAVEVQEQWPCLPAAGCPGP LGGPVAACGM in isoform 3. | VSP_043010 | |||||||
| Alternative sequence | 119 | 1 | E → MPSTQLLAAAAAAATAPGPT PPPLAPGSLRSPVPCPVPRL PRCHPVLTRHLVL in isoform 2. | VSP_014104 | |||||||
| Natural variant | 122 | 1 | Q → H. Ref.7 Corresponds to variant rs1859728 [ dbSNP | Ensembl ]. | VAR_020487 | |||||||
| Natural variant | 338 | 1 | G → R. Corresponds to variant rs35904809 [ dbSNP | Ensembl ]. | VAR_054021 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 100 | 1 | S → TS Ref.2 | ||||||||
| Sequence conflict | 136 | 1 | P → S in AAC39733. Ref.2 | ||||||||
| Sequence conflict | 177 | 1 | G → C in AAC39733. Ref.2 | ||||||||
| Sequence conflict | 315 – 316 | 2 | KH → ND in AAC39733. Ref.2 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A family of human beta4-galactosyltransferases. Cloning and expression of two novel UDP-galactose:beta-n-acetylglucosamine beta1, 4-galactosyltransferases, beta4Gal-T2 and beta4Gal-T3." Almeida R., Amado M., David L., Levery S.B., Holmes E.H., Merkx G., van Kessel A.G., Rygaard E., Hassan H., Bennett E., Clausen H. J. Biol. Chem. 272:31979-31991(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "The expanding beta 4-galactosyltransferase gene family: messages from the databanks." Lo N.-W., Shaper J.H., Pevsner J., Shaper N.L. Glycobiology 8:517-526(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "Galactosylation of N-linked oligosaccharides by human beta-1,4-galactosyltransferases I, II, III, IV, V, and VI expressed in Sf-9 cells." Guo S., Sato T., Shirane K., Furukawa K. Glycobiology 11:813-820(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), BIOPHYSICOCHEMICAL PROPERTIES. Tissue: Erythroleukemia. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). |
| [5] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT HIS-122. Tissue: Chondrosarcoma. |
| [8] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 149-372 (ISOFORMS 1/2). Tissue: Uterus. |
| [9] | "Identification and characterization of large galactosyltransferase gene families: galactosyltransferases for all functions." Amado M., Almeida R., Schwientek T., Clausen H. Biochim. Biophys. Acta 1473:35-53(1999) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW. |
| + | Additional computationally mapped references. |
Web resources
| GGDB GlycoGene database |
| Functional Glycomics Gateway - GTase Beta-1,4-galactosyltransferase 2 |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | Y12510 mRNA. Translation: CAA73112.1. AF038660 mRNA. Translation: AAC39733.1. AB024434 mRNA. Translation: BAA75819.1. AK095873 mRNA. Translation: BAG53152.1. AK293418 mRNA. Translation: BAG56925.1. AL139220, AL357079 Genomic DNA. Translation: CAI19431.1. AL139220, AL357079 Genomic DNA. Translation: CAI19432.1. AL357079, AL139220 Genomic DNA. Translation: CAI16802.1. AL357079, AL139220 Genomic DNA. Translation: CAI16803.1. CH471059 Genomic DNA. Translation: EAX07062.1. CH471059 Genomic DNA. Translation: EAX07063.1. CH471059 Genomic DNA. Translation: EAX07064.1. CH471059 Genomic DNA. Translation: EAX07065.1. BC096821 mRNA. Translation: AAH96821.1. AL137647 mRNA. Translation: CAB70857.1. |
| IPI | IPI00033031. IPI00386793. IPI00941315. |
| PIR | T46511. |
| RefSeq | NP_001005417.1. NM_001005417.2. NP_003771.1. NM_003780.4. NP_085076.2. NM_030587.2. |
| UniGene | Hs.632403. Hs.736507. |
3D structure databases | |
| ProteinModelPortal | O60909. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O60909. 1 interaction. |
| STRING | 9606.ENSP00000349293. |
Protein family/group databases | |
| CAZy | GT7. Glycosyltransferase Family 7. |
PTM databases | |
| PhosphoSite | O60909. |
Proteomic databases | |
| PaxDb | O60909. |
| PRIDE | O60909. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000309519; ENSP00000310696; ENSG00000117411. ENST00000356836; ENSP00000349293; ENSG00000117411. ENST00000372324; ENSP00000361399; ENSG00000117411. ENST00000434555; ENSP00000407468; ENSG00000117411. |
| GeneID | 8704. |
| KEGG | hsa:8704. |
| UCSC | uc001clg.3. human. uc001clh.3. human. |
Organism-specific databases | |
| CTD | 8704. |
| GeneCards | GC01P044444. |
| HGNC | HGNC:925. B4GALT2. |
| HPA | HPA047739. |
| MIM | 604013. gene. |
| neXtProt | NX_O60909. |
| PharmGKB | PA25224. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG327897. |
| HOGENOM | HOG000231027. |
| HOVERGEN | HBG058334. |
| InParanoid | O60909. |
| KO | K07967. |
| OMA | TNCSRPN. |
| OrthoDB | EOG4B2SXC. |
Enzyme and pathway databases | |
| Reactome | REACT_111217. Metabolism. REACT_116125. Disease. REACT_17015. Metabolism of proteins. |
| UniPathway | UPA00378. |
Gene expression databases | |
| ArrayExpress | O60909. |
| Bgee | O60909. |
| CleanEx | HS_B4GALT2. |
| Genevestigator | O60909. |
| GermOnline | ENSG00000117411. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR003859. Galactosyl_T_2_met. [Graphical view] |
| PANTHER | PTHR19300. PTHR19300. 1 hit. |
| Pfam | PF02709. Glyco_transf_7C. 1 hit. [Graphical view] |
| PRINTS | PR02050. B14GALTRFASE. |
| ProtoNet | Search... |
Other | |
| DrugBank | DB00141. N-Acetyl-D-glucosamine. |
| GenomeRNAi | 8704. |
| NextBio | 32635. |
| SOURCE | Search... |
Entry information
| Entry name | B4GT2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O60909 Secondary accession number(s): B3KTP0 Q9NSY7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with
