O60888 (CUTA_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 107.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein CutA Alternative name(s): Acetylcholinesterase-associated protein Brain acetylcholinesterase putative membrane anchor | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 179 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May form part of a complex of membrane proteins attached to acetylcholinesterase (AChE). Ref.1 |
| Subunit structure | Homotrimer. |
| Tissue specificity | Ubiquitous. Widely expressed in brain. Ref.1 |
| Post-translational modification | O-glycosylated. Ref.7 |
| Sequence similarities | Belongs to the CutA family. |
| Sequence caution | The sequence AAF61220.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Domain | Signal |
| PTM | Glycoprotein |
| Technical term | 3D-structure Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | protein localization Inferred from direct assay Ref.1. Source: UniProtKB response to metal ionInferred from electronic annotation. Source: InterPro |
| Cellular_component | membrane Inferred from direct assay Ref.1. Source: UniProtKB |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| NR4A1 | P22736 | 2 | EBI-1051556,EBI-721550 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform B (identifier: O60888-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform A (identifier: O60888-2) The sequence of this isoform differs from the canonical sequence as follows: 1-14: MSGGRAPAVLLGGV → MIGSGLAGSGGAGGPSSTVTWCALFSNHVAATQ | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform C (identifier: O60888-3) The sequence of this isoform differs from the canonical sequence as follows: 1-23: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 32 | 32 | Potential | |||||||||||||||||||||
| Chain | 33 – 179 | 147 | Protein CutA | PRO_0000006379 | ||||||||||||||||||||
Regions | ||||||||||||||||||||||||
| Region | 168 – 176 | 9 | O-glycosylated at one site | |||||||||||||||||||||
| Compositional bias | 34 – 37 | 4 | Poly-Leu | |||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||
| Alternative sequence | 1 – 23 | 23 | Missing in isoform C. | VSP_013226 | ||||||||||||||||||||
| Alternative sequence | 1 – 14 | 14 | MSGGR…LLGGV → MIGSGLAGSGGAGGPSSTVT WCALFSNHVAATQ in isoform A. | VSP_013225 | ||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||
| Beta strand | 67 – 77 | 11 | ||||||||||||||||||||||
| Helix | 78 – 90 | 13 | ||||||||||||||||||||||
| Beta strand | 95 – 109 | 15 | ||||||||||||||||||||||
| Beta strand | 112 – 126 | 15 | ||||||||||||||||||||||
| Helix | 127 – 129 | 3 | ||||||||||||||||||||||
| Helix | 130 – 140 | 11 | ||||||||||||||||||||||
| Beta strand | 142 – 145 | 4 | ||||||||||||||||||||||
| Beta strand | 148 – 153 | 6 | ||||||||||||||||||||||
| Helix | 158 – 166 | 9 | ||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Hydrophobic protein that copurifies with human brain acetylcholinesterase: amino acid sequence, genomic organization, and chromosomal localization." Navaratnam D.S., Fernando F.S., Priddle J.D., Giles K., Clegg S.M., Pappin D.J.C., Craig I., Smith A.D. J. Neurochem. 74:2146-2153(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM C), PROTEIN SEQUENCE OF 70-74 AND 84-178, TISSUE SPECIFICITY, PUTATIVE FUNCTION. |
| [2] | "Cloning and isolating human CUTA cDNA." Luo W.Q., Chen J.H., Huan X.W., Zhou Y., Yuan J.G., Qiang B.Q. Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM C). |
| [3] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM C). Tissue: Placenta. |
| [5] | "Two distinct proteins are associated with tetrameric acetylcholinesterase on the cell surface." Perrier A.L., Cousin X., Boschetti N., Haas R., Chatel J.-M., Bon S., Roberts W.L., Pickett S.R., Massoulie J., Rosenberry T.L., Krejci E. J. Biol. Chem. 275:34260-34265(2000) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORMS A; B AND C). |
| [6] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [7] | "LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins." Halim A., Ruetschi U., Larson G., Nilsson J. J. Proteome Res. 12:573-584(2013) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION, MASS SPECTROMETRY. |
| [8] | "Divalent cation tolerant protein CUTA from Homo sapiens O60888." Southeast collaboratory for structural genomics (SECSG) Submitted (SEP-2004) to the PDB data bank Cited for: X-RAY CRYSTALLOGRAPHY (2.7 ANGSTROMS) OF 44-179. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF230924 mRNA. Translation: AAF61220.1. Different initiation. AF106943 mRNA. Translation: AAD21026.1. AL050332 Genomic DNA. Translation: CAB63779.1. AL021366 Genomic DNA. Translation: CAA16160.1. AL662799 Genomic DNA. Translation: CAI18273.2. AL662799 Genomic DNA. Translation: CAM25571.1. BX088650 Genomic DNA. Translation: CAM26302.1. BX088650 Genomic DNA. Translation: CAM26303.1. BC005890 mRNA. Translation: AAH05890.1. BC107751 mRNA. Translation: AAI07752.1. | ||||||||||||||||||
| IPI | IPI00034319. IPI00554556. IPI00554634. | ||||||||||||||||||
| RefSeq | NP_001014433.1. NM_001014433.2. NP_001014837.1. NM_001014837.1. NP_001014838.1. NM_001014838.1. NP_001014840.1. NM_001014840.1. NP_057005.1. NM_015921.2. | ||||||||||||||||||
| UniGene | Hs.520070. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | O60888. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | O60888. 7 interactions. | ||||||||||||||||||
| STRING | 9606.ENSP00000363624. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | O60888. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | O60888. | ||||||||||||||||||
| PRIDE | O60888. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000374496; ENSP00000363620; ENSG00000112514. ENST00000374500; ENSP00000363624; ENSG00000112514. ENST00000435267; ENSP00000391509; ENSG00000226492. ENST00000440279; ENSP00000403268; ENSG00000112514. ENST00000440930; ENSP00000400114; ENSG00000226492. ENST00000487148; ENSP00000432744; ENSG00000226492. ENST00000488034; ENSP00000417544; ENSG00000112514. | ||||||||||||||||||
| GeneID | 51596. | ||||||||||||||||||
| KEGG | hsa:51596. | ||||||||||||||||||
| UCSC | uc003oej.1. human. uc003oen.1. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 51596. | ||||||||||||||||||
| GeneCards | GC06M033384. | ||||||||||||||||||
| HGNC | HGNC:21101. CUTA. | ||||||||||||||||||
| HPA | CAB016787. | ||||||||||||||||||
| neXtProt | NX_O60888. | ||||||||||||||||||
| PharmGKB | PA134928220. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | COG1324. | ||||||||||||||||||
| HOVERGEN | HBG051265. | ||||||||||||||||||
| KO | K03926. | ||||||||||||||||||
| OMA | PVEQGNS. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | O60888. | ||||||||||||||||||
| Bgee | O60888. | ||||||||||||||||||
| CleanEx | HS_CUTA. | ||||||||||||||||||
| Genevestigator | O60888. | ||||||||||||||||||
| GermOnline | ENSG00000112514. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR004323. Ion_tolerance_CutA. IPR011322. N-reg_PII-like_a/b. [Graphical view] | ||||||||||||||||||
| PANTHER | PTHR23419. PTHR23419. 1 hit. | ||||||||||||||||||
| Pfam | PF03091. CutA1. 1 hit. [Graphical view] | ||||||||||||||||||
| SUPFAM | SSF54913. N-reg_PII-like_a/b. 1 hit. | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| ChiTaRS | CUTA. human. | ||||||||||||||||||
| EvolutionaryTrace | O60888. | ||||||||||||||||||
| GenomeRNAi | 51596. | ||||||||||||||||||
| NextBio | 55447. | ||||||||||||||||||
Entry information
| Entry name | CUTA_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O60888 Secondary accession number(s): A2AB26 Q9NYQ9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
