Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein CutA

Gene

CUTA

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May form part of a complex of membrane proteins attached to acetylcholinesterase (AChE).

GO - Molecular functioni

  • copper ion binding Source: GO_Central
  • enzyme binding Source: UniProtKB

GO - Biological processi

  • protein localization Source: UniProtKB
  • response to metal ion Source: InterPro
Complete GO annotation...

Enzyme and pathway databases

BioCyciZFISH:ENSG00000112514-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein CutA
Alternative name(s):
Acetylcholinesterase-associated protein
Brain acetylcholinesterase putative membrane anchor
Gene namesi
Name:CUTA
Synonyms:ACHAP, C6orf82
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:21101. CUTA.

Subcellular locationi

GO - Cellular componenti

  • extracellular exosome Source: UniProtKB
  • membrane Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

DisGeNETi51596.
OpenTargetsiENSG00000112514.
ENSG00000226492.
PharmGKBiPA134928220.

Polymorphism and mutation databases

BioMutaiCUTA.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 32Sequence analysisAdd BLAST32
ChainiPRO_000000637933 – 179Protein CutAAdd BLAST147

Post-translational modificationi

O-glycosylated.1 Publication

Keywords - PTMi

Glycoprotein

Proteomic databases

EPDiO60888.
MaxQBiO60888.
PaxDbiO60888.
PeptideAtlasiO60888.
PRIDEiO60888.

PTM databases

iPTMnetiO60888.
PhosphoSitePlusiO60888.
SwissPalmiO60888.

Expressioni

Tissue specificityi

Ubiquitous. Widely expressed in brain.1 Publication

Gene expression databases

BgeeiENSG00000112514.
CleanExiHS_CUTA.
ExpressionAtlasiO60888. baseline and differential.
GenevisibleiO60888. HS.

Organism-specific databases

HPAiCAB016787.
HPA064369.

Interactioni

Subunit structurei

Homotrimer.

Binary interactionsi

WithEntry#Exp.IntActNotes
FBLIM1Q8WUP23EBI-1051556,EBI-3864120
NR4A1P227362EBI-1051556,EBI-721550

GO - Molecular functioni

  • enzyme binding Source: UniProtKB

Protein-protein interaction databases

BioGridi119628. 22 interactors.
IntActiO60888. 10 interactors.
STRINGi9606.ENSP00000363624.

Structurei

Secondary structure

1179
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi67 – 77Combined sources11
Helixi78 – 90Combined sources13
Beta strandi95 – 109Combined sources15
Beta strandi112 – 126Combined sources15
Helixi127 – 129Combined sources3
Helixi130 – 140Combined sources11
Beta strandi142 – 145Combined sources4
Beta strandi148 – 153Combined sources6
Helixi158 – 166Combined sources9

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1XK8X-ray2.70A/B/C/D/E/F44-179[»]
2ZFHX-ray2.05A/B/C/D/E/F1-179[»]
ProteinModelPortaliO60888.
SMRiO60888.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO60888.

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni168 – 176O-glycosylated at one site9

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi34 – 37Poly-Leu4

Sequence similaritiesi

Belongs to the CutA family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG3338. Eukaryota.
COG1324. LUCA.
GeneTreeiENSGT00390000017030.
HOVERGENiHBG051265.
InParanoidiO60888.
KOiK03926.
OMAiPVEQGNS.
OrthoDBiEOG091G0ZCC.
PhylomeDBiO60888.
TreeFamiTF313269.

Family and domain databases

InterProiIPR004323. Ion_tolerance_CutA.
IPR011322. N-reg_PII-like_a/b.
[Graphical view]
PANTHERiPTHR23419. PTHR23419. 1 hit.
PfamiPF03091. CutA1. 1 hit.
[Graphical view]
SUPFAMiSSF54913. SSF54913. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform B (identifier: O60888-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSGGRAPAVL LGGVASLLLS FVWMPALLPV ASRLLLLPRV LLTMASGSPP
60 70 80 90 100
TQPSPASDSG SGYVPGSVSA AFVTCPNEKV AKEIARAVVE KRLAACVNLI
110 120 130 140 150
PQITSIYEWK GKIEEDSEVL MMIKTQSSLV PALTDFVRSV HPYEVAEVIA
160 170
LPVEQGNFPY LQWVRQVTES VSDSITVLP
Note: No experimental confirmation available.
Length:179
Mass (Da):19,116
Last modified:March 29, 2005 - v2
Checksum:iB8EBD7F8C069862A
GO
Isoform A (identifier: O60888-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MSGGRAPAVLLGGV → MIGSGLAGSGGAGGPSSTVTWCALFSNHVAATQ

Note: No experimental confirmation available.
Show »
Length:198
Mass (Da):20,925
Checksum:i6FF4D190577FBA1A
GO
Isoform C (identifier: O60888-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-23: Missing.

Show »
Length:156
Mass (Da):16,833
Checksum:i9438E6E87D96F3EF
GO

Sequence cautioni

The sequence AAF61220 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0132261 – 23Missing in isoform C. 3 PublicationsAdd BLAST23
Alternative sequenceiVSP_0132251 – 14MSGGR…LLGGV → MIGSGLAGSGGAGGPSSTVT WCALFSNHVAATQ in isoform A. CuratedAdd BLAST14

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF230924 mRNA. Translation: AAF61220.1. Different initiation.
AF106943 mRNA. Translation: AAD21026.1.
AL050332 Genomic DNA. Translation: CAB63779.1.
AL021366 Genomic DNA. Translation: CAA16160.1.
AL662799 Genomic DNA. Translation: CAI18273.2.
AL662799 Genomic DNA. Translation: CAM25571.1.
BX088650 Genomic DNA. Translation: CAM26302.1.
BX088650 Genomic DNA. Translation: CAM26303.1.
BC005890 mRNA. Translation: AAH05890.1.
BC107751 mRNA. Translation: AAI07752.1.
CCDSiCCDS34432.1. [O60888-2]
CCDS34433.1. [O60888-1]
CCDS4779.1. [O60888-3]
RefSeqiNP_001014433.1. NM_001014433.2. [O60888-2]
NP_001014837.1. NM_001014837.1. [O60888-3]
NP_001014838.1. NM_001014838.1. [O60888-3]
NP_001014840.1. NM_001014840.1. [O60888-1]
NP_057005.1. NM_015921.2. [O60888-3]
UniGeneiHs.520070.

Genome annotation databases

EnsembliENST00000374496; ENSP00000363620; ENSG00000112514. [O60888-3]
ENST00000374500; ENSP00000363624; ENSG00000112514. [O60888-2]
ENST00000435267; ENSP00000391509; ENSG00000226492. [O60888-2]
ENST00000440279; ENSP00000403268; ENSG00000112514. [O60888-3]
ENST00000440930; ENSP00000400114; ENSG00000226492. [O60888-1]
ENST00000487148; ENSP00000432744; ENSG00000226492. [O60888-3]
ENST00000488034; ENSP00000417544; ENSG00000112514. [O60888-1]
ENST00000607266; ENSP00000475963; ENSG00000112514. [O60888-3]
ENST00000611509; ENSP00000480360; ENSG00000112514. [O60888-3]
GeneIDi51596.
KEGGihsa:51596.
UCSCiuc003oej.2. human. [O60888-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF230924 mRNA. Translation: AAF61220.1. Different initiation.
AF106943 mRNA. Translation: AAD21026.1.
AL050332 Genomic DNA. Translation: CAB63779.1.
AL021366 Genomic DNA. Translation: CAA16160.1.
AL662799 Genomic DNA. Translation: CAI18273.2.
AL662799 Genomic DNA. Translation: CAM25571.1.
BX088650 Genomic DNA. Translation: CAM26302.1.
BX088650 Genomic DNA. Translation: CAM26303.1.
BC005890 mRNA. Translation: AAH05890.1.
BC107751 mRNA. Translation: AAI07752.1.
CCDSiCCDS34432.1. [O60888-2]
CCDS34433.1. [O60888-1]
CCDS4779.1. [O60888-3]
RefSeqiNP_001014433.1. NM_001014433.2. [O60888-2]
NP_001014837.1. NM_001014837.1. [O60888-3]
NP_001014838.1. NM_001014838.1. [O60888-3]
NP_001014840.1. NM_001014840.1. [O60888-1]
NP_057005.1. NM_015921.2. [O60888-3]
UniGeneiHs.520070.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1XK8X-ray2.70A/B/C/D/E/F44-179[»]
2ZFHX-ray2.05A/B/C/D/E/F1-179[»]
ProteinModelPortaliO60888.
SMRiO60888.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119628. 22 interactors.
IntActiO60888. 10 interactors.
STRINGi9606.ENSP00000363624.

PTM databases

iPTMnetiO60888.
PhosphoSitePlusiO60888.
SwissPalmiO60888.

Polymorphism and mutation databases

BioMutaiCUTA.

Proteomic databases

EPDiO60888.
MaxQBiO60888.
PaxDbiO60888.
PeptideAtlasiO60888.
PRIDEiO60888.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000374496; ENSP00000363620; ENSG00000112514. [O60888-3]
ENST00000374500; ENSP00000363624; ENSG00000112514. [O60888-2]
ENST00000435267; ENSP00000391509; ENSG00000226492. [O60888-2]
ENST00000440279; ENSP00000403268; ENSG00000112514. [O60888-3]
ENST00000440930; ENSP00000400114; ENSG00000226492. [O60888-1]
ENST00000487148; ENSP00000432744; ENSG00000226492. [O60888-3]
ENST00000488034; ENSP00000417544; ENSG00000112514. [O60888-1]
ENST00000607266; ENSP00000475963; ENSG00000112514. [O60888-3]
ENST00000611509; ENSP00000480360; ENSG00000112514. [O60888-3]
GeneIDi51596.
KEGGihsa:51596.
UCSCiuc003oej.2. human. [O60888-1]

Organism-specific databases

CTDi51596.
DisGeNETi51596.
GeneCardsiCUTA.
HGNCiHGNC:21101. CUTA.
HPAiCAB016787.
HPA064369.
neXtProtiNX_O60888.
OpenTargetsiENSG00000112514.
ENSG00000226492.
PharmGKBiPA134928220.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3338. Eukaryota.
COG1324. LUCA.
GeneTreeiENSGT00390000017030.
HOVERGENiHBG051265.
InParanoidiO60888.
KOiK03926.
OMAiPVEQGNS.
OrthoDBiEOG091G0ZCC.
PhylomeDBiO60888.
TreeFamiTF313269.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000112514-MONOMER.

Miscellaneous databases

ChiTaRSiCUTA. human.
EvolutionaryTraceiO60888.
GenomeRNAii51596.
PROiO60888.

Gene expression databases

BgeeiENSG00000112514.
CleanExiHS_CUTA.
ExpressionAtlasiO60888. baseline and differential.
GenevisibleiO60888. HS.

Family and domain databases

InterProiIPR004323. Ion_tolerance_CutA.
IPR011322. N-reg_PII-like_a/b.
[Graphical view]
PANTHERiPTHR23419. PTHR23419. 1 hit.
PfamiPF03091. CutA1. 1 hit.
[Graphical view]
SUPFAMiSSF54913. SSF54913. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiCUTA_HUMAN
AccessioniPrimary (citable) accession number: O60888
Secondary accession number(s): A2AB26
, A2BEL4, Q3B784, Q5JXM9, Q5SU05, Q9NYQ9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 15, 2005
Last sequence update: March 29, 2005
Last modified: November 2, 2016
This is version 140 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.