Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

SH2 domain-containing protein 1A

Gene

SH2D1A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Cytoplasmic adapter regulating receptors of the signaling lymphocytic activation molecule (SLAM) family such as SLAMF1, CD244, LY9, CD84, SLAMF6 and SLAMF7. In SLAM signaling seems to cooperate with SH2D1B/EAT-2. Initially it has been proposed that association with SLAMF1 prevents SLAMF1 binding to inhibitory effectors including INPP5D/SHIP1 and PTPN11/SHP-2 (PubMed:11806999). However, by simultaneous interactions, recruits FYN which subsequently phosphorylates and activates SLAMF1 (PubMed:12458214). Positively regulates CD244/2B4- and CD84-mediated natural killer (NK) cell functions. Can also promote CD48-, SLAMF6 -, LY9-, and SLAMF7-mediated NK cell activation. In the context of NK cell-mediated cytotoxicity enhances conjugate formation with target cells (By similarity). May also regulate the activity of the neurotrophin receptors NTRK1, NTRK2 and NTRK3.By similarity1 Publication2 Publications

GO - Molecular functioni

  • SH3/SH2 adaptor activity Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Adaptive immunity, Immunity, Innate immunity

Enzyme and pathway databases

BioCyciZFISH:ENSG00000027869-MONOMER.
ReactomeiR-HSA-198933. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
SignaLinkiO60880.

Names & Taxonomyi

Protein namesi
Recommended name:
SH2 domain-containing protein 1A
Alternative name(s):
Duncan disease SH2-protein
Signaling lymphocytic activation molecule-associated protein
Short name:
SLAM-associated protein
T-cell signal transduction molecule SAP
Gene namesi
Name:SH2D1A
Synonyms:DSHP, SAP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

HGNCiHGNC:10820. SH2D1A.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • cytosol Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Involvement in diseasei

Lymphoproliferative syndrome, X-linked, 1 (XLP1)7 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus (EBV). Symptoms include severe or fatal mononucleosis, acquired hypogammaglobulinemia, pancytopenia and malignant lymphoma.
See also OMIM:308240
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0480057Y → C in XLP1; reduced protein stability and reduced affinity for SLAMF1, decreases interaction with FYN. 4 Publications1
Natural variantiVAR_0480068H → D in XLP1. 1 Publication1
Natural variantiVAR_04800716G → D in XLP1; abolishes interaction with SLAMF1. 1 Publication1
Natural variantiVAR_04800827G → S in XLP1. 1 Publication1
Natural variantiVAR_04800928S → R in XLP1; reduced protein stability. 3 Publications1
Natural variantiVAR_04801031L → P in XLP1; reduced protein stability and reduced affinity for SLAMF1 and FYN. 2 Publications1
Natural variantiVAR_00561232R → T in XLP1. 2 PublicationsCorresponds to variant rs111033624dbSNPEnsembl.1
Natural variantiVAR_04801133D → Y in XLP1. 1 Publication1
Natural variantiVAR_04801242C → W in XLP1; loss of interaction with CD84 and reduced affinity for SLAMF1. 2 Publications1
Natural variantiVAR_04801349G → V in XLP1. 1 Publication1
Natural variantiVAR_04801453T → I in XLP1; loss of interaction with CD84; loss of interaction with non-phosphorylated SLAMF1. 3 Publications1
Natural variantiVAR_04801554Y → C in XLP1; reduced protein stability and reduced affinity for SLAMF1 and FYN. 3 Publications1
Natural variantiVAR_01830755R → L in XLP1; reduced affinity for SLAMF1 and FYN. 2 PublicationsCorresponds to variant rs111033630dbSNPEnsembl.1
Natural variantiVAR_04801657S → P in one XLP1 patient; unknown pathological significance. 1 Publication1
Natural variantiVAR_00561368T → I in XLP1; loss of interaction with CD84; strongly reduced affinity for SLAMF1. 3 PublicationsCorresponds to variant rs111033627dbSNPEnsembl.1
Natural variantiVAR_04801784I → T in XLP1; reduced protein stability. 1 Publication1
Natural variantiVAR_04801887F → S in XLP1; reduced protein stability and reduced affinity for SLAMF1 and FYN. 3 Publications1
Natural variantiVAR_04801999Q → P in XLP1; reduced protein stability and strongly reduced affinity for SLAMF1, disrupts interaction with FYN. 4 Publications1
Natural variantiVAR_005614101P → L in XLP1; reduced protein stability and reduced affinity for SLAMF1, decreases interaction with FYN. 4 PublicationsCorresponds to variant rs28935184dbSNPEnsembl.1
Natural variantiVAR_048020102V → G in XLP1; reduced protein stability and strongly reduced affinity for SLAMF1, decreases interaction with FYN. 4 Publications1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi32R → Q: Strongly reduced affinity for SLAMF1. 1 Publication1
Mutagenesisi78R → E: Disrupts interaction with FYN. 1 Publication1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNETi4068.
MalaCardsiSH2D1A.
MIMi308240. phenotype.
OpenTargetsiENSG00000183918.
Orphaneti2442. X-linked lymphoproliferative disease.
PharmGKBiPA35728.

Chemistry databases

ChEMBLiCHEMBL2321636.

Polymorphism and mutation databases

BioMutaiSH2D1A.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000977221 – 128SH2 domain-containing protein 1AAdd BLAST128

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei89N6-acetyllysineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

PaxDbiO60880.
PeptideAtlasiO60880.
PRIDEiO60880.

PTM databases

iPTMnetiO60880.
PhosphoSitePlusiO60880.

Expressioni

Tissue specificityi

Expressed at a high level in thymus and lung, with a lower level of expression in spleen and liver. Expressed in peripheral blood leukocytes, including T-lymphocytes. Tends to be expressed at lower levels in peripheral blood leukocytes in patients with rheumatoid arthritis.1 Publication

Gene expression databases

BgeeiENSG00000183918.
CleanExiHS_SH2D1A.
GenevisibleiO60880. HS.

Organism-specific databases

HPAiCAB034146.

Interactioni

Subunit structurei

Interacts with NTRK1, NTRK2 and NTRK3 (By similarity). Interacts with CD84, CD244, LY9, SLAMF1 and FYN.By similarity7 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
ARHGEF6Q150522EBI-6983382,EBI-1642523
ARHGEF7Q141557EBI-6983382,EBI-717515
CD244Q9BZW87EBI-6983382,EBI-1580565
FYNP062413EBI-6983382,EBI-515315
LHX4Q969G24EBI-6983382,EBI-2865388
METP085813EBI-6983382,EBI-1039152
SLAMF1Q1329112EBI-6983382,EBI-4315002
TNK2Q079123EBI-6983382,EBI-603457

GO - Molecular functioni

  • SH3/SH2 adaptor activity Source: UniProtKB

Protein-protein interaction databases

BioGridi110246. 23 interactors.
DIPiDIP-40768N.
IntActiO60880. 29 interactors.
MINTiMINT-113697.
STRINGi9606.ENSP00000360181.

Chemistry databases

BindingDBiO60880.

Structurei

Secondary structure

1128
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi5 – 7Combined sources3
Helixi13 – 23Combined sources11
Beta strandi28 – 33Combined sources6
Beta strandi35 – 37Combined sources3
Beta strandi41 – 47Combined sources7
Beta strandi50 – 58Combined sources9
Beta strandi64 – 66Combined sources3
Beta strandi77 – 79Combined sources3
Helixi80 – 87Combined sources8
Beta strandi89 – 96Combined sources8

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1D1ZX-ray1.40A/B/C/D1-104[»]
1D4TX-ray1.10A1-104[»]
1D4WX-ray1.80A/B1-104[»]
1KA6NMR-A1-128[»]
1KA7NMR-A1-128[»]
1M27X-ray2.50A1-104[»]
ProteinModelPortaliO60880.
SMRiO60880.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO60880.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini6 – 104SH2PROSITE-ProRule annotationAdd BLAST99

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni67 – 92Interaction with FYN SH3 domainBy similarityAdd BLAST26

Sequence similaritiesi

Contains 1 SH2 domain.PROSITE-ProRule annotation

Keywords - Domaini

SH2 domain

Phylogenomic databases

eggNOGiENOG410IRBY. Eukaryota.
ENOG4111YH5. LUCA.
GeneTreeiENSGT00510000046904.
HOVERGENiHBG003702.
InParanoidiO60880.
KOiK07990.
OMAiCLCVLCK.
OrthoDBiEOG091G0ULG.
PhylomeDBiO60880.
TreeFamiTF343096.

Family and domain databases

Gene3Di3.30.505.10. 1 hit.
InterProiIPR000980. SH2.
IPR017289. SH2_prot_1A.
[Graphical view]
PfamiPF00017. SH2. 1 hit.
[Graphical view]
PIRSFiPIRSF037828. SH2_p1A. 1 hit.
PRINTSiPR00401. SH2DOMAIN.
SMARTiSM00252. SH2. 1 hit.
[Graphical view]
SUPFAMiSSF55550. SSF55550. 1 hit.
PROSITEiPS50001. SH2. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform A (identifier: O60880-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDAVAVYHGK ISRETGEKLL LATGLDGSYL LRDSESVPGV YCLCVLYHGY
60 70 80 90 100
IYTYRVSQTE TGSWSAETAP GVHKRYFRKI KNLISAFQKP DQGIVIPLQY
110 120
PVEKKSSARS TQGTTGIRED PDVCLKAP
Length:128
Mass (Da):14,187
Last modified:August 1, 1998 - v1
Checksum:i90234E7A6614EE3D
GO
Isoform B (identifier: O60880-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     68-128: TAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP → HFRSQIKA

Show »
Length:75
Mass (Da):8,392
Checksum:i49A81B180192072A
GO
Isoform C (identifier: O60880-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     47-128: YHGYIYTYRV...EDPDVCLKAP → QHLGYIKDISGK

Show »
Length:58
Mass (Da):6,284
Checksum:i39720893ACB3518A
GO
Isoform D (identifier: O60880-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     114-116: Missing.

Show »
Length:125
Mass (Da):13,928
Checksum:i1E5EE8978D67E5D6
GO
Isoform E (identifier: O60880-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-128: VYCLCVLYHG...EDPDVCLKAP → ITVTFIHTEC...RHCNTSAVSS

Show »
Length:76
Mass (Da):8,188
Checksum:i5BA2292A94518C00
GO
Isoform F (identifier: O60880-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     47-128: YHGYIYTYRV...EDPDVCLKAP → ISEARSRHCNTSAVSS

Show »
Length:62
Mass (Da):6,631
Checksum:i51B125509F7EB9C4
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0480057Y → C in XLP1; reduced protein stability and reduced affinity for SLAMF1, decreases interaction with FYN. 4 Publications1
Natural variantiVAR_0480068H → D in XLP1. 1 Publication1
Natural variantiVAR_04800716G → D in XLP1; abolishes interaction with SLAMF1. 1 Publication1
Natural variantiVAR_04800827G → S in XLP1. 1 Publication1
Natural variantiVAR_04800928S → R in XLP1; reduced protein stability. 3 Publications1
Natural variantiVAR_04801031L → P in XLP1; reduced protein stability and reduced affinity for SLAMF1 and FYN. 2 Publications1
Natural variantiVAR_00561232R → T in XLP1. 2 PublicationsCorresponds to variant rs111033624dbSNPEnsembl.1
Natural variantiVAR_04801133D → Y in XLP1. 1 Publication1
Natural variantiVAR_04801242C → W in XLP1; loss of interaction with CD84 and reduced affinity for SLAMF1. 2 Publications1
Natural variantiVAR_04801349G → V in XLP1. 1 Publication1
Natural variantiVAR_04801453T → I in XLP1; loss of interaction with CD84; loss of interaction with non-phosphorylated SLAMF1. 3 Publications1
Natural variantiVAR_04801554Y → C in XLP1; reduced protein stability and reduced affinity for SLAMF1 and FYN. 3 Publications1
Natural variantiVAR_01830755R → L in XLP1; reduced affinity for SLAMF1 and FYN. 2 PublicationsCorresponds to variant rs111033630dbSNPEnsembl.1
Natural variantiVAR_04801657S → P in one XLP1 patient; unknown pathological significance. 1 Publication1
Natural variantiVAR_00561368T → I in XLP1; loss of interaction with CD84; strongly reduced affinity for SLAMF1. 3 PublicationsCorresponds to variant rs111033627dbSNPEnsembl.1
Natural variantiVAR_04801784I → T in XLP1; reduced protein stability. 1 Publication1
Natural variantiVAR_04801887F → S in XLP1; reduced protein stability and reduced affinity for SLAMF1 and FYN. 3 Publications1
Natural variantiVAR_04801999Q → P in XLP1; reduced protein stability and strongly reduced affinity for SLAMF1, disrupts interaction with FYN. 4 Publications1
Natural variantiVAR_005614101P → L in XLP1; reduced protein stability and reduced affinity for SLAMF1, decreases interaction with FYN. 4 PublicationsCorresponds to variant rs28935184dbSNPEnsembl.1
Natural variantiVAR_048020102V → G in XLP1; reduced protein stability and strongly reduced affinity for SLAMF1, decreases interaction with FYN. 4 Publications1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_00438840 – 128VYCLC…CLKAP → ITVTFIHTECPRQKQVLGVL SISEARSRHCNTSAVSS in isoform E. CuratedAdd BLAST89
Alternative sequenceiVSP_00438747 – 128YHGYI…CLKAP → QHLGYIKDISGK in isoform C. CuratedAdd BLAST82
Alternative sequenceiVSP_00438947 – 128YHGYI…CLKAP → ISEARSRHCNTSAVSS in isoform F. CuratedAdd BLAST82
Alternative sequenceiVSP_00438668 – 128TAPGV…CLKAP → HFRSQIKA in isoform B. CuratedAdd BLAST61
Alternative sequenceiVSP_004390114 – 116Missing in isoform D. Curated3

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL023657 mRNA. Translation: CAA19222.1.
AF073019 mRNA. Translation: AAC62631.1.
AF072930 mRNA. Translation: AAC62630.1.
AB586694 mRNA. Translation: BAJ19023.1.
AF100539 mRNA. Translation: AAC79712.1.
AF100540 mRNA. Translation: AAC79713.1.
AF100541 mRNA. Translation: AAC79714.1.
AF100542 mRNA. Translation: AAC79715.1.
AF100543 mRNA. Translation: AAC79716.1.
AK311911 mRNA. Translation: BAG34852.1.
CR542031 mRNA. Translation: CAG46828.1.
CR542043 mRNA. Translation: CAG46840.1.
AL022718 Genomic DNA. Translation: CAA18777.1.
CH471107 Genomic DNA. Translation: EAX11848.1.
CH471107 Genomic DNA. Translation: EAX11849.1.
BC020732 mRNA. Translation: AAH20732.1.
CCDSiCCDS14608.1. [O60880-1]
CCDS48162.1. [O60880-4]
RefSeqiNP_001108409.1. NM_001114937.2. [O60880-4]
NP_002342.1. NM_002351.4. [O60880-1]
UniGeneiHs.349094.

Genome annotation databases

EnsembliENST00000360027; ENSP00000353126; ENSG00000183918. [O60880-4]
ENST00000371139; ENSP00000360181; ENSG00000183918. [O60880-1]
ENST00000477673; ENSP00000477094; ENSG00000183918. [O60880-5]
GeneIDi4068.
KEGGihsa:4068.
UCSCiuc004euf.6. human. [O60880-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

SH2D1Abase

SH2D1A mutation db

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL023657 mRNA. Translation: CAA19222.1.
AF073019 mRNA. Translation: AAC62631.1.
AF072930 mRNA. Translation: AAC62630.1.
AB586694 mRNA. Translation: BAJ19023.1.
AF100539 mRNA. Translation: AAC79712.1.
AF100540 mRNA. Translation: AAC79713.1.
AF100541 mRNA. Translation: AAC79714.1.
AF100542 mRNA. Translation: AAC79715.1.
AF100543 mRNA. Translation: AAC79716.1.
AK311911 mRNA. Translation: BAG34852.1.
CR542031 mRNA. Translation: CAG46828.1.
CR542043 mRNA. Translation: CAG46840.1.
AL022718 Genomic DNA. Translation: CAA18777.1.
CH471107 Genomic DNA. Translation: EAX11848.1.
CH471107 Genomic DNA. Translation: EAX11849.1.
BC020732 mRNA. Translation: AAH20732.1.
CCDSiCCDS14608.1. [O60880-1]
CCDS48162.1. [O60880-4]
RefSeqiNP_001108409.1. NM_001114937.2. [O60880-4]
NP_002342.1. NM_002351.4. [O60880-1]
UniGeneiHs.349094.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1D1ZX-ray1.40A/B/C/D1-104[»]
1D4TX-ray1.10A1-104[»]
1D4WX-ray1.80A/B1-104[»]
1KA6NMR-A1-128[»]
1KA7NMR-A1-128[»]
1M27X-ray2.50A1-104[»]
ProteinModelPortaliO60880.
SMRiO60880.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110246. 23 interactors.
DIPiDIP-40768N.
IntActiO60880. 29 interactors.
MINTiMINT-113697.
STRINGi9606.ENSP00000360181.

Chemistry databases

BindingDBiO60880.
ChEMBLiCHEMBL2321636.

PTM databases

iPTMnetiO60880.
PhosphoSitePlusiO60880.

Polymorphism and mutation databases

BioMutaiSH2D1A.

Proteomic databases

PaxDbiO60880.
PeptideAtlasiO60880.
PRIDEiO60880.

Protocols and materials databases

DNASUi4068.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000360027; ENSP00000353126; ENSG00000183918. [O60880-4]
ENST00000371139; ENSP00000360181; ENSG00000183918. [O60880-1]
ENST00000477673; ENSP00000477094; ENSG00000183918. [O60880-5]
GeneIDi4068.
KEGGihsa:4068.
UCSCiuc004euf.6. human. [O60880-1]

Organism-specific databases

CTDi4068.
DisGeNETi4068.
GeneCardsiSH2D1A.
GeneReviewsiSH2D1A.
HGNCiHGNC:10820. SH2D1A.
HPAiCAB034146.
MalaCardsiSH2D1A.
MIMi300490. gene.
308240. phenotype.
neXtProtiNX_O60880.
OpenTargetsiENSG00000183918.
Orphaneti2442. X-linked lymphoproliferative disease.
PharmGKBiPA35728.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IRBY. Eukaryota.
ENOG4111YH5. LUCA.
GeneTreeiENSGT00510000046904.
HOVERGENiHBG003702.
InParanoidiO60880.
KOiK07990.
OMAiCLCVLCK.
OrthoDBiEOG091G0ULG.
PhylomeDBiO60880.
TreeFamiTF343096.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000027869-MONOMER.
ReactomeiR-HSA-198933. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
SignaLinkiO60880.

Miscellaneous databases

EvolutionaryTraceiO60880.
GeneWikiiSH2D1A.
GenomeRNAii4068.
PROiO60880.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000183918.
CleanExiHS_SH2D1A.
GenevisibleiO60880. HS.

Family and domain databases

Gene3Di3.30.505.10. 1 hit.
InterProiIPR000980. SH2.
IPR017289. SH2_prot_1A.
[Graphical view]
PfamiPF00017. SH2. 1 hit.
[Graphical view]
PIRSFiPIRSF037828. SH2_p1A. 1 hit.
PRINTSiPR00401. SH2DOMAIN.
SMARTiSM00252. SH2. 1 hit.
[Graphical view]
SUPFAMiSSF55550. SSF55550. 1 hit.
PROSITEiPS50001. SH2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSH21A_HUMAN
AccessioniPrimary (citable) accession number: O60880
Secondary accession number(s): A8MSW0
, O95383, O95384, O95385, O95386, Q6FGS6, Q9UNR0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: August 1, 1998
Last modified: November 30, 2016
This is version 150 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.