O60880 (SH21A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 114.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: SH2 domain-containing protein 1A Alternative name(s): Duncan disease SH2-protein Signaling lymphocytic activation molecule-associated protein Short name=SLAM-associated protein T-cell signal transduction molecule SAP | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 128 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Inhibitor of the SLAM self-association. Acts by blocking recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to a docking site in the SLAM cytoplasmic region. Mediates interaction between FYN and SLAMF1. May also regulate the activity of the neurotrophin receptors NTRK1, NTRK2 and NTRK3. |
| Subunit structure | Interacts with NTRK1, NTRK2 and NTRK3 By similarity. Interacts with CD84, CD244, LY9, SLAMF1 and FYN. Ref.10 Ref.11 Ref.20 |
| Subcellular location | Cytoplasm Probable. |
| Tissue specificity | Expressed at a high level in thymus and lung, with a lower level of expression in spleen and liver. Expressed in peripheral blood leukocytes, including T lymphocytes. Tends to be expressed at lower levels in peripheral blood leukocytes in patients with rheumatoid arthritis. Ref.3 |
| Involvement in disease | Lymphoproliferative syndrome, X-linked, 1 (XLP1) [MIM:308240]: A rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus (EBV). Symptoms include severe or fatal mononucleosis, acquired hypogammaglobulinemia, pancytopenia and malignant lymphoma. |
| Sequence similarities | Contains 1 SH2 domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Disease mutation |
| Domain | SH2 domain |
| PTM | Acetylation |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cell-cell signaling Inferred from direct assay Ref.2. Source: UniProtKB cellular defense responseNon-traceable author statement Ref.2. Source: UniProtKB humoral immune responseInferred from electronic annotation. Source: Compara positive regulation of natural killer cell mediated cytotoxicityInferred from electronic annotation. Source: Compara |
| Cellular_component | cytoplasm Inferred from direct assay Ref.2. Source: UniProtKB |
| Molecular_function | SH3/SH2 adaptor activity Non-traceable author statement Ref.2. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform A (identifier: O60880-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform B (identifier: O60880-2) The sequence of this isoform differs from the canonical sequence as follows: 68-128: TAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP → HFRSQIKA | ||||||
| Isoform C (identifier: O60880-3) The sequence of this isoform differs from the canonical sequence as follows: 47-128: YHGYIYTYRV...EDPDVCLKAP → QHLGYIKDISGK | ||||||
| Isoform D (identifier: O60880-4) The sequence of this isoform differs from the canonical sequence as follows: 114-116: Missing. | ||||||
| Isoform E (identifier: O60880-5) The sequence of this isoform differs from the canonical sequence as follows: 40-128: VYCLCVLYHG...EDPDVCLKAP → ITVTFIHTEC...RHCNTSAVSS | ||||||
| Isoform F (identifier: O60880-6) The sequence of this isoform differs from the canonical sequence as follows: 47-128: YHGYIYTYRV...EDPDVCLKAP → ISEARSRHCNTSAVSS |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 128 | 128 | SH2 domain-containing protein 1A | PRO_0000097722 | ||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||
| Domain | 6 – 104 | 99 | SH2 | |||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||
| Modified residue | 89 | 1 | N6-acetyllysine Ref.12 | |||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||
| Alternative sequence | 40 – 128 | 89 | VYCLC…CLKAP → ITVTFIHTECPRQKQVLGVL SISEARSRHCNTSAVSS in isoform E. | VSP_004388 | ||||||||||||||||||||||||
| Alternative sequence | 47 – 128 | 82 | YHGYI…CLKAP → QHLGYIKDISGK in isoform C. | VSP_004387 | ||||||||||||||||||||||||
| Alternative sequence | 47 – 128 | 82 | YHGYI…CLKAP → ISEARSRHCNTSAVSS in isoform F. | VSP_004389 | ||||||||||||||||||||||||
| Alternative sequence | 68 – 128 | 61 | TAPGV…CLKAP → HFRSQIKA in isoform B. | VSP_004386 | ||||||||||||||||||||||||
| Alternative sequence | 114 – 116 | 3 | Missing in isoform D. | VSP_004390 | ||||||||||||||||||||||||
| Natural variant | 7 | 1 | Y → C in XLP1; reduced protein stability and reduced affinity for SLAMF1. Ref.14 Ref.17 Ref.20 | VAR_048005 | ||||||||||||||||||||||||
| Natural variant | 8 | 1 | H → D in XLP1. Ref.19 | VAR_048006 | ||||||||||||||||||||||||
| Natural variant | 16 | 1 | G → D in XLP1; abolishes interaction with SLAMF1. Ref.23 | VAR_048007 | ||||||||||||||||||||||||
| Natural variant | 27 | 1 | G → S in XLP1. Ref.19 | VAR_048008 | ||||||||||||||||||||||||
| Natural variant | 28 | 1 | S → R in XLP1; reduced protein stability. Ref.14 Ref.17 Ref.20 | VAR_048009 | ||||||||||||||||||||||||
| Natural variant | 31 | 1 | L → P in XLP1; reduced protein stability and reduced affinity for SLAMF1 and FYN. Ref.17 Ref.21 | VAR_048010 | ||||||||||||||||||||||||
| Natural variant | 32 | 1 | R → T in XLP1. Ref.1 Ref.16 | VAR_005612 | ||||||||||||||||||||||||
| Natural variant | 33 | 1 | D → Y in XLP1. Ref.19 | VAR_048011 | ||||||||||||||||||||||||
| Natural variant | 42 | 1 | C → W in XLP1; loss of interaction with CD84 and reduced affinity for SLAMF1. Ref.17 Ref.20 | VAR_048012 | ||||||||||||||||||||||||
| Natural variant | 49 | 1 | G → V in XLP1. Ref.19 | VAR_048013 | ||||||||||||||||||||||||
| Natural variant | 53 | 1 | T → I in XLP1; loss of interaction with CD48 and reduced affinity for SLAMF1 and loss of interaction with non-phosphorylated SLAMF1. Ref.14 Ref.17 Ref.20 | VAR_048014 | ||||||||||||||||||||||||
| Natural variant | 54 | 1 | Y → C in XLP1; reduced protein stability and reduced affinity for SLAMF1 and FYN. Ref.17 Ref.21 Ref.24 | VAR_048015 | ||||||||||||||||||||||||
| Natural variant | 55 | 1 | R → L in XLP1; reduced affinity for SLAMF1 and FYN. Ref.18 Ref.21 | VAR_018307 | ||||||||||||||||||||||||
| Natural variant | 57 | 1 | S → P in one XLP1 patient; unknown pathological significance. Ref.22 | VAR_048016 | ||||||||||||||||||||||||
| Natural variant | 68 | 1 | T → I in XLP1; loss of interaction with CD48 and strongly reduced affinity for SLAMF1. Ref.1 Ref.14 Ref.20 | VAR_005613 | ||||||||||||||||||||||||
| Natural variant | 84 | 1 | I → T in XLP1; reduced protein stability. Ref.24 | VAR_048017 | ||||||||||||||||||||||||
| Natural variant | 87 | 1 | F → S in XLP1; reduced protein stability and reduced affinity for SLAMF1 and FYN. Ref.17 Ref.21 Ref.24 | VAR_048018 | ||||||||||||||||||||||||
| Natural variant | 99 | 1 | Q → P in XLP1; reduced protein stability and strongly reduced affinity for SLAMF1. Ref.14 Ref.17 Ref.20 | VAR_048019 | ||||||||||||||||||||||||
| Natural variant | 101 | 1 | P → L in XLP1; reduced protein stability and reduced affinity for SLAMF1. Ref.1 Ref.14 Ref.20 Corresponds to variant rs28935184 [ dbSNP | Ensembl ]. | VAR_005614 | ||||||||||||||||||||||||
| Natural variant | 102 | 1 | V → G in XLP1; reduced protein stability and strongly reduced affinity for SLAMF1. Ref.14 Ref.17 Ref.20 | VAR_048020 | ||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||
| Mutagenesis | 32 | 1 | R → Q: Strongly reduced affinity for SLAMF1. Ref.14 | |||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||
| Beta strand | 5 – 7 | 3 | ||||||||||||||||||||||||||
| Helix | 13 – 23 | 11 | ||||||||||||||||||||||||||
| Beta strand | 28 – 33 | 6 | ||||||||||||||||||||||||||
| Beta strand | 35 – 37 | 3 | ||||||||||||||||||||||||||
| Beta strand | 41 – 47 | 7 | ||||||||||||||||||||||||||
| Beta strand | 50 – 58 | 9 | ||||||||||||||||||||||||||
| Beta strand | 64 – 66 | 3 | ||||||||||||||||||||||||||
| Beta strand | 77 – 79 | 3 | ||||||||||||||||||||||||||
| Helix | 80 – 87 | 8 | ||||||||||||||||||||||||||
| Beta strand | 89 – 96 | 8 | ||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Host response to EBV infection in X-linked lymphoproliferative disease results from mutations in an SH2-domain encoding gene." Coffey A.J., Brooksbank R.A., Brandau O., Oohashi T., Howell G.R., Bye J.M., Cahn A.P., Durham J., Heath P., Wray P., Pavitt R., Wilkinson J., Leversha M., Huckle E., Shaw-Smith C.J., Dunham A., Rhodes S., Schuster V. Bentley D.R.Nat. Genet. 20:129-135(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], VARIANTS XLP1 THR-32; ILE-68 AND LEU-101. |
| [2] | "The X-linked lymphoproliferative-disease gene product SAP regulates signals induced through the co-receptor SLAM." Sayos J., Wu C., Morra M., Wang N., Zhang X., Allen D., van Schaik S., Notarangelo L., Geha R., Roncarolo M.G., Oettgen H., de Vries J.E., Aversa G., Terhorst C. Nature 395:462-469(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. |
| [3] | "Decreased expression of signaling lymphocytic-activation molecule-associated protein (SAP) transcripts in T cells from patients with rheumatoid arthritis." Takei M., Ishiwata T., Mitamura K., Fujiwara S., Sasaki K., Nishi T., Kuga T., Ookubo T., Horie T., Ryu J., Ohi H., Sawada S. Int. Immunol. 13:559-565(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], TISSUE SPECIFICITY. |
| [4] | "The Duncan's disease gene is preferentially expressed in lymphoid cell lineages and undergoes high levels of alternative splicing." Amemiya C.T., Halevi A. Submitted (OCT-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING. |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. |
| [6] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. |
| [7] | "The DNA sequence of the human X chromosome." Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. Bentley D.R.Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A). Tissue: Lung. |
| [10] | "Cell surface receptors Ly-9 and CD84 recruit the X-linked lymphoproliferative disease gene product SAP." Sayos J., Martin M., Chen A., Simarro M., Howie D., Morra M., Engel P., Terhorst C. Blood 97:3867-3874(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CD84. |
| [11] | "CD84 is up-regulated on a major population of human memory B cells and recruits the SH2 domain containing proteins SAP and EAT-2." Tangye S.G., van de Weerdt B.C.M., Avery D.T., Hodgkin P.D. Eur. J. Immunol. 32:1640-1649(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CD84. |
| [12] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-89, MASS SPECTROMETRY. |
| [13] | "Crystal structures of the XLP protein SAP reveal a class of SH2 domains with extended, phosphotyrosine-independent sequence recognition." Poy F., Yaffe M.B., Sayos J., Saxena K., Morra M., Sumegi J., Cantley L.C., Terhorst C., Eck M.J. Mol. Cell 4:555-561(1999) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.1 ANGSTROMS) OF 1-104. |
| [14] | "A 'three-pronged' binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome." Hwang P.M., Li C., Morra M., Lillywhite J., Muhandiram D.R., Gertler F., Terhorst C., Kay L.E., Pawson T., Forman-Kay J.D., Li S.-C. EMBO J. 21:314-323(2002) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR IN COMPLEX WITH SLAMF1, CHARACTERIZATION OF VARIANTS XLP1 CYS-7; ARG-28; ILE-53; ILE-68; PRO-99; LEU-101 AND GLY-102, MUTAGENESIS OF ARG-32. |
| [15] | "SAP couples Fyn to SLAM immune receptors." Chan B., Lanyi A., Song H.K., Griesbach J., Simarro-Grande M., Poy F., Howie D., Sumegi J., Terhorst C., Eck M.J. Nat. Cell Biol. 5:155-160(2003) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.5 ANGSTROMS) OF 1-104 IN COMPLEX WITH SLAMF1 AND FYN. |
| [16] | "SH2D1A mutation analysis for diagnosis of XLP in typical and atypical patients." Yin L., Ferrand V., Lavoue M.-F., Hayoz D., Philippe N., Souillet G., Seri M., Giacchino R., Castagnola E., Hodgson S., Sylla B.S., Romeo G. Hum. Genet. 105:501-505(1999) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT XLP1 THR-32. |
| [17] | "Correlation of mutations of the SH2D1A gene and Epstein-Barr virus infection with clinical phenotype and outcome in X-linked lymphoproliferative disease." Sumegi J., Huang D., Lanyi A., Davis J.D., Seemayer T.A., Maeda A., Klein G., Seri M., Wakiguchi H., Purtilo D.T., Gross T.G. Blood 96:3118-3125(2000) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS XLP1 CYS-7; ARG-28; PRO-31; TRP-42; ILE-53; CYS-54; SER-87; PRO-99 AND GLY-102. |
| [18] | "Defective NK cell activation in X-linked lymphoproliferative disease." Benoit L., Wang X., Pabst H.F., Dutz J., Tan R. J. Immunol. 165:3549-3553(2000) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT XLP1 LEU-55. |
| [19] | "SH2D1A mutations in Japanese males with severe Epstein-Barr virus-associated illnesses." Sumazaki R., Kanegane H., Osaki M., Fukushima T., Tsuchida M., Matsukura H., Shinozaki K., Kimura H., Matsui A., Miyawaki T. Blood 98:1268-1270(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS XLP1 ASP-8; SER-27; TYR-33 AND VAL-49. |
| [20] | "Characterization of SH2D1A missense mutations identified in X-linked lymphoproliferative disease patients." Morra M., Simarro-Grande M., Martin M., Chen A.S.-I., Lanyi A., Silander O., Calpe S., Davis J., Pawson T., Eck M.J., Sumegi J., Engel P., Li S.-C., Terhorst C. J. Biol. Chem. 276:36809-36816(2001) [PubMed] [Europe PMC] [Abstract] Cited for: CHARACTERIZATION OF VARIANTS XLP1 CYS-7; ARG-28; TRP-42; ILE-53; ILE-68; PRO-99; LEU-101 AND GLY-102, INTERACTION WITH CD244; SLAMF1; CD48 AND LY9. |
| [21] | "Disease-causing SAP mutants are defective in ligand binding and protein folding." Li C., Iosef C., Jia C.Y.H., Gkourasas T., Han V.K.M., Li S.-C. Biochemistry 42:14885-14892(2003) [PubMed] [Europe PMC] [Abstract] Cited for: CHARACTERIZATION OF VARIANTS XLP1 PRO-31; CYS-54; LEU-55 AND SER-87. |
| [22] | "Fatal hemophagocytic lymphohistiocytosis associated with Epstein-Barr virus infection in a patient with a novel mutation in the signaling lymphocytic activation molecule-associated protein." Halasa N.B., Whitlock J.A., McCurley T.L., Smith J.A., Zhu Q., Ochs H., Dermody T.S., Crowe J.E. Jr. Clin. Infect. Dis. 37:E136-E141(2003) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT PRO-57. |
| [23] | "Characterization of a new disease-causing mutation of SH2D1A in a family with X-linked lymphoproliferative disease." Erdos M., Uzvoelgyi E., Nemes Z., Toeroek O., Rakoczi E., Went-Suemegi N., Suemegi J., Marodi L. Hum. Mutat. 25:506-506(2005) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT XLP1 ASP-16, CHARACTERIZATION OF VARIANT XLP1 ASP-16. |
| [24] | "Missense mutations in SH2D1A identified in patients with X-linked lymphoproliferative disease differentially affect the expression and function of SAP." Hare N.J., Ma C.S., Alvaro F., Nichols K.E., Tangye S.G. Int. Immunol. 18:1055-1065(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS XLP1 CYS-54; THR-84 AND SER-87, CHARACTERIZATION OF VARIANTS XLP1 CYS-54; THR-84 AND SER-87. |
| + | Additional computationally mapped references. |
Web resources
| SH2D1Abase SH2D1A mutation db |
| GeneReviews |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AL023657 mRNA. Translation: CAA19222.1. AF073019 mRNA. Translation: AAC62631.1. AF072930 mRNA. Translation: AAC62630.1. AB586694 mRNA. Translation: BAJ19023.1. AF100539 mRNA. Translation: AAC79712.1. AF100540 mRNA. Translation: AAC79713.1. AF100541 mRNA. Translation: AAC79714.1. AF100542 mRNA. Translation: AAC79715.1. AF100543 mRNA. Translation: AAC79716.1. AK311911 mRNA. Translation: BAG34852.1. CR542031 mRNA. Translation: CAG46828.1. CR542043 mRNA. Translation: CAG46840.1. AL022718 Genomic DNA. Translation: CAA18777.1. CH471107 Genomic DNA. Translation: EAX11848.1. CH471107 Genomic DNA. Translation: EAX11849.1. BC020732 mRNA. Translation: AAH20732.1. | ||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00032401. IPI00216635. IPI00216636. IPI00216637. IPI00216639. IPI00873008. | ||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001108409.1. NM_001114937.2. NP_002342.1. NM_002351.4. | ||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.349094. | ||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | O60880. | ||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-113697. | ||||||||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000360181. | ||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | O60880. | ||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||
| PaxDb | O60880. | ||||||||||||||||||||||||||||||||||||||||||
| PRIDE | O60880. | ||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||
| DNASU | 4068. | ||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000360027; ENSP00000353126; ENSG00000183918. ENST00000371139; ENSP00000360181; ENSG00000183918. | ||||||||||||||||||||||||||||||||||||||||||
| GeneID | 4068. | ||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:4068. | ||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc004euf.4. human. uc004euh.4. human. | ||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||
| CTD | 4068. | ||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC0XP123480. | ||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:10820. SH2D1A. | ||||||||||||||||||||||||||||||||||||||||||
| MIM | 300490. gene. 308240. phenotype. | ||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_O60880. | ||||||||||||||||||||||||||||||||||||||||||
| Orphanet | 2442. X-linked lymphoproliferative disease. | ||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA35728. | ||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||
| eggNOG | NOG298713. | ||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG003702. | ||||||||||||||||||||||||||||||||||||||||||
| InParanoid | O60880. | ||||||||||||||||||||||||||||||||||||||||||
| KO | K07990. | ||||||||||||||||||||||||||||||||||||||||||
| OMA | TQGTTGR. | ||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4HHP3S. | ||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | O60880. | ||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||
| Bgee | O60880. | ||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_SH2D1A. | ||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | O60880. | ||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000183918. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||
| Gene3D | 3.30.505.10. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR000980. SH2. IPR017289. SH2_prot_1A. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| PANTHER | PTHR11200:SF1. PTHR11200:SF1. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00017. SH2. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| PIRSF | PIRSF037828. SH2_p1A. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR00401. SH2DOMAIN. | ||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00252. SH2. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS50001. SH2. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | O60880. | ||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 4068. | ||||||||||||||||||||||||||||||||||||||||||
| NextBio | 15948. | ||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | SH21A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O60880 Secondary accession number(s): A8MSW0 Q9UNR0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
