Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O60830

- TI17B_HUMAN

UniProt

O60830 - TI17B_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Mitochondrial import inner membrane translocase subunit Tim17-B

Gene

TIMM17B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli

Functioni

Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.

GO - Molecular functioni

  1. P-P-bond-hydrolysis-driven protein transmembrane transporter activity Source: InterPro

GO - Biological processi

  1. cellular protein metabolic process Source: Reactome
  2. protein targeting to mitochondrion Source: Reactome
Complete GO annotation...

Keywords - Biological processi

Protein transport, Translocation, Transport

Enzyme and pathway databases

ReactomeiREACT_118595. Mitochondrial protein import.

Names & Taxonomyi

Protein namesi
Recommended name:
Mitochondrial import inner membrane translocase subunit Tim17-B
Gene namesi
Name:TIMM17B
Synonyms:TIM17B
ORF Names:JM3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome X

Organism-specific databases

HGNCiHGNC:17310. TIMM17B.

Subcellular locationi

GO - Cellular componenti

  1. integral component of mitochondrial inner membrane Source: BHF-UCL
  2. mitochondrial inner membrane presequence translocase complex Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA38226.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 172172Mitochondrial import inner membrane translocase subunit Tim17-BPRO_0000210287Add
BLAST

Proteomic databases

MaxQBiO60830.
PaxDbiO60830.
PeptideAtlasiO60830.
PRIDEiO60830.

PTM databases

PhosphoSiteiO60830.

Expressioni

Tissue specificityi

Expression is abundant in heart and skeletal muscle, intermediate in brain, and weak in pancreas, placenta, kidney and liver.

Gene expression databases

BgeeiO60830.
CleanExiHS_TIMM17B.
ExpressionAtlasiO60830. baseline and differential.
GenevestigatoriO60830.

Organism-specific databases

HPAiHPA029093.

Interactioni

Subunit structurei

Component of the TIM23 complex at least composed of TIMM23, TIMM17 (TIMM17A or TIMM17B) and TIMM50. The complex interacts with the TIMM44 component of the PAM complex and with DNAJC15.1 Publication

Protein-protein interaction databases

BioGridi115539. 8 interactions.
IntActiO60830. 2 interactions.
STRINGi9606.ENSP00000365766.

Structurei

3D structure databases

ProteinModelPortaliO60830.
ModBaseiSearch...
MobiDBiSearch...

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei17 – 3721HelicalSequence AnalysisAdd
BLAST
Transmembranei61 – 8121HelicalSequence AnalysisAdd
BLAST
Transmembranei113 – 13321HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Sequence similaritiesi

Belongs to the Tim17/Tim22/Tim23 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG5596.
GeneTreeiENSGT00390000017780.
HOGENOMiHOG000183190.
HOVERGENiHBG054233.
InParanoidiO60830.
KOiK17795.
OMAiFSTFDCG.
OrthoDBiEOG7JX35C.
PhylomeDBiO60830.
TreeFamiTF106195.

Family and domain databases

InterProiIPR005678. Tim17.
IPR003397. Tim17/Tim22/Tim23/PMP24.
[Graphical view]
PfamiPF02466. Tim17. 1 hit.
[Graphical view]
TIGRFAMsiTIGR00980. 3a0801so1tim17. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O60830-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEEYAREPCP WRIVDDCGGA FTMGVIGGGV FQAIKGFRNA PVGIRHRLRG
60 70 80 90 100
SANAVRIRAP QIGGSFAVWG GLFSTIDCGL VRLRGKEDPW NSITSGALTG
110 120 130 140 150
AVLAARSGPL AMVGSAMMGG ILLALIEGVG ILLTRYTAQQ FRNAPPFLED
160 170
PSQLPPKDGT PAPGYPSYQQ YH
Length:172
Mass (Da):18,273
Last modified:August 1, 1998 - v1
Checksum:i5DF3926F815E835A
GO
Isoform 2 (identifier: O60830-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     42-42: V → VCRLLSEAPLFIYSCSRSVSPTVNVSSERAESRPTLFMAVSLHMAWCLAHI

Note: No experimental confirmation available.

Show »
Length:222
Mass (Da):23,824
Checksum:iCD7DB6DA57E615BE
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei42 – 421V → VCRLLSEAPLFIYSCSRSVS PTVNVSSERAESRPTLFMAV SLHMAWCLAHI in isoform 2. 1 PublicationVSP_047215

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF034790 mRNA. Translation: AAC24694.1.
AJ005895 mRNA. Translation: CAA06752.1.
AF077039 mRNA. Translation: AAD27772.1.
AK290207 mRNA. Translation: BAF82896.1.
AF196971 Genomic DNA. No translation available.
AF207550 Genomic DNA. No translation available.
CH471224 Genomic DNA. Translation: EAW50741.1.
BC010142 mRNA. Translation: AAH10142.1.
BC091473 mRNA. No translation available.
CCDSiCCDS14308.1. [O60830-1]
CCDS55411.1. [O60830-2]
RefSeqiNP_001161419.1. NM_001167947.2. [O60830-2]
NP_005825.1. NM_005834.4. [O60830-1]
UniGeneiHs.30570.

Genome annotation databases

EnsembliENST00000376582; ENSP00000365766; ENSG00000126768. [O60830-1]
ENST00000396779; ENSP00000379999; ENSG00000126768. [O60830-2]
ENST00000465150; ENSP00000477073; ENSG00000126768. [O60830-2]
GeneIDi10245.
KEGGihsa:10245.
UCSCiuc004dlc.2. human. [O60830-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF034790 mRNA. Translation: AAC24694.1 .
AJ005895 mRNA. Translation: CAA06752.1 .
AF077039 mRNA. Translation: AAD27772.1 .
AK290207 mRNA. Translation: BAF82896.1 .
AF196971 Genomic DNA. No translation available.
AF207550 Genomic DNA. No translation available.
CH471224 Genomic DNA. Translation: EAW50741.1 .
BC010142 mRNA. Translation: AAH10142.1 .
BC091473 mRNA. No translation available.
CCDSi CCDS14308.1. [O60830-1 ]
CCDS55411.1. [O60830-2 ]
RefSeqi NP_001161419.1. NM_001167947.2. [O60830-2 ]
NP_005825.1. NM_005834.4. [O60830-1 ]
UniGenei Hs.30570.

3D structure databases

ProteinModelPortali O60830.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 115539. 8 interactions.
IntActi O60830. 2 interactions.
STRINGi 9606.ENSP00000365766.

PTM databases

PhosphoSitei O60830.

Proteomic databases

MaxQBi O60830.
PaxDbi O60830.
PeptideAtlasi O60830.
PRIDEi O60830.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000376582 ; ENSP00000365766 ; ENSG00000126768 . [O60830-1 ]
ENST00000396779 ; ENSP00000379999 ; ENSG00000126768 . [O60830-2 ]
ENST00000465150 ; ENSP00000477073 ; ENSG00000126768 . [O60830-2 ]
GeneIDi 10245.
KEGGi hsa:10245.
UCSCi uc004dlc.2. human. [O60830-1 ]

Organism-specific databases

CTDi 10245.
GeneCardsi GC0XM048750.
HGNCi HGNC:17310. TIMM17B.
HPAi HPA029093.
MIMi 300249. gene.
neXtProti NX_O60830.
PharmGKBi PA38226.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5596.
GeneTreei ENSGT00390000017780.
HOGENOMi HOG000183190.
HOVERGENi HBG054233.
InParanoidi O60830.
KOi K17795.
OMAi FSTFDCG.
OrthoDBi EOG7JX35C.
PhylomeDBi O60830.
TreeFami TF106195.

Enzyme and pathway databases

Reactomei REACT_118595. Mitochondrial protein import.

Miscellaneous databases

ChiTaRSi TIMM17B. human.
GenomeRNAii 10245.
NextBioi 35535213.
PROi O60830.
SOURCEi Search...

Gene expression databases

Bgeei O60830.
CleanExi HS_TIMM17B.
ExpressionAtlasi O60830. baseline and differential.
Genevestigatori O60830.

Family and domain databases

InterProi IPR005678. Tim17.
IPR003397. Tim17/Tim22/Tim23/PMP24.
[Graphical view ]
Pfami PF02466. Tim17. 1 hit.
[Graphical view ]
TIGRFAMsi TIGR00980. 3a0801so1tim17. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Genetic and structural characterization of the human mitochondrial inner membrane translocase."
    Bauer M.F., Gempel K., Reichert A.S., Rappold G.A., Lichtner P., Gerbitz K.-D., Neupert W., Brunner M., Hofmann S.
    J. Mol. Biol. 289:69-82(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Transcription map in Xp11.23."
    Strom T.M., Nyakatura G., Hellebrand H., Drescher B., Rosenthal A., Meindl A.
    Submitted (APR-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Peripheral blood leukocyte.
  3. "Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells."
    Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X.
    , Gu J., Chen S.-J., Chen Z.
    Genome Res. 10:1546-1560(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Umbilical cord blood.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Thalamus.
  5. "The DNA sequence of the human X chromosome."
    Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
    , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
    Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Placenta and Uterus.
  8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  9. "Methylation-controlled J-protein MCJ acts in the import of proteins into human mitochondria."
    Schusdziarra C., Blamowska M., Azem A., Hell K.
    Hum. Mol. Genet. 22:1348-1357(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH DNAJC15.

Entry informationi

Entry nameiTI17B_HUMAN
AccessioniPrimary (citable) accession number: O60830
Secondary accession number(s): A8K2E2, J3KPV3, Q9UJV0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: August 1, 1998
Last modified: October 29, 2014
This is version 121 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3