Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O60830

- TI17B_HUMAN

UniProt

O60830 - TI17B_HUMAN

Protein

Mitochondrial import inner membrane translocase subunit Tim17-B

Gene

TIMM17B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 120 (01 Oct 2014)
      Sequence version 1 (01 Aug 1998)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.

    GO - Molecular functioni

    1. P-P-bond-hydrolysis-driven protein transmembrane transporter activity Source: InterPro

    GO - Biological processi

    1. cellular protein metabolic process Source: Reactome
    2. protein targeting to mitochondrion Source: Reactome

    Keywords - Biological processi

    Protein transport, Translocation, Transport

    Enzyme and pathway databases

    ReactomeiREACT_118595. Mitochondrial protein import.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Mitochondrial import inner membrane translocase subunit Tim17-B
    Gene namesi
    Name:TIMM17B
    Synonyms:TIM17B
    ORF Names:JM3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome X

    Organism-specific databases

    HGNCiHGNC:17310. TIMM17B.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of mitochondrial inner membrane Source: BHF-UCL
    2. mitochondrial inner membrane presequence translocase complex Source: BHF-UCL

    Keywords - Cellular componenti

    Membrane, Mitochondrion, Mitochondrion inner membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA38226.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 172172Mitochondrial import inner membrane translocase subunit Tim17-BPRO_0000210287Add
    BLAST

    Proteomic databases

    MaxQBiO60830.
    PaxDbiO60830.
    PeptideAtlasiO60830.
    PRIDEiO60830.

    PTM databases

    PhosphoSiteiO60830.

    Expressioni

    Tissue specificityi

    Expression is abundant in heart and skeletal muscle, intermediate in brain, and weak in pancreas, placenta, kidney and liver.

    Gene expression databases

    ArrayExpressiO60830.
    BgeeiO60830.
    CleanExiHS_TIMM17B.
    GenevestigatoriO60830.

    Organism-specific databases

    HPAiHPA029093.

    Interactioni

    Subunit structurei

    Component of the TIM23 complex at least composed of TIMM23, TIMM17 (TIMM17A or TIMM17B) and TIMM50. The complex interacts with the TIMM44 component of the PAM complex and with DNAJC15.1 Publication

    Protein-protein interaction databases

    BioGridi115539. 8 interactions.
    IntActiO60830. 2 interactions.
    STRINGi9606.ENSP00000365766.

    Structurei

    3D structure databases

    ProteinModelPortaliO60830.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei17 – 3721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei61 – 8121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei113 – 13321HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the Tim17/Tim22/Tim23 family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG5596.
    HOGENOMiHOG000183190.
    HOVERGENiHBG054233.
    InParanoidiO60830.
    KOiK17795.
    OMAiFSTFDCG.
    OrthoDBiEOG7JX35C.
    PhylomeDBiO60830.
    TreeFamiTF106195.

    Family and domain databases

    InterProiIPR005678. Tim17.
    IPR003397. Tim17/Tim22/Tim23/PMP24.
    [Graphical view]
    PfamiPF02466. Tim17. 1 hit.
    [Graphical view]
    TIGRFAMsiTIGR00980. 3a0801so1tim17. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O60830-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEEYAREPCP WRIVDDCGGA FTMGVIGGGV FQAIKGFRNA PVGIRHRLRG    50
    SANAVRIRAP QIGGSFAVWG GLFSTIDCGL VRLRGKEDPW NSITSGALTG 100
    AVLAARSGPL AMVGSAMMGG ILLALIEGVG ILLTRYTAQQ FRNAPPFLED 150
    PSQLPPKDGT PAPGYPSYQQ YH 172
    Length:172
    Mass (Da):18,273
    Last modified:August 1, 1998 - v1
    Checksum:i5DF3926F815E835A
    GO
    Isoform 2 (identifier: O60830-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         42-42: V → VCRLLSEAPLFIYSCSRSVSPTVNVSSERAESRPTLFMAVSLHMAWCLAHI

    Note: No experimental confirmation available.

    Show »
    Length:222
    Mass (Da):23,824
    Checksum:iCD7DB6DA57E615BE
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei42 – 421V → VCRLLSEAPLFIYSCSRSVS PTVNVSSERAESRPTLFMAV SLHMAWCLAHI in isoform 2. 1 PublicationVSP_047215

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF034790 mRNA. Translation: AAC24694.1.
    AJ005895 mRNA. Translation: CAA06752.1.
    AF077039 mRNA. Translation: AAD27772.1.
    AK290207 mRNA. Translation: BAF82896.1.
    AF196971 Genomic DNA. No translation available.
    AF207550 Genomic DNA. No translation available.
    CH471224 Genomic DNA. Translation: EAW50741.1.
    BC010142 mRNA. Translation: AAH10142.1.
    BC091473 mRNA. No translation available.
    CCDSiCCDS14308.1. [O60830-1]
    CCDS55411.1. [O60830-2]
    RefSeqiNP_001161419.1. NM_001167947.2. [O60830-2]
    NP_005825.1. NM_005834.4. [O60830-1]
    UniGeneiHs.30570.

    Genome annotation databases

    EnsembliENST00000376582; ENSP00000365766; ENSG00000126768. [O60830-1]
    ENST00000396779; ENSP00000379999; ENSG00000126768. [O60830-2]
    ENST00000465150; ENSP00000477073; ENSG00000126768. [O60830-2]
    GeneIDi10245.
    KEGGihsa:10245.
    UCSCiuc004dlc.2. human. [O60830-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF034790 mRNA. Translation: AAC24694.1 .
    AJ005895 mRNA. Translation: CAA06752.1 .
    AF077039 mRNA. Translation: AAD27772.1 .
    AK290207 mRNA. Translation: BAF82896.1 .
    AF196971 Genomic DNA. No translation available.
    AF207550 Genomic DNA. No translation available.
    CH471224 Genomic DNA. Translation: EAW50741.1 .
    BC010142 mRNA. Translation: AAH10142.1 .
    BC091473 mRNA. No translation available.
    CCDSi CCDS14308.1. [O60830-1 ]
    CCDS55411.1. [O60830-2 ]
    RefSeqi NP_001161419.1. NM_001167947.2. [O60830-2 ]
    NP_005825.1. NM_005834.4. [O60830-1 ]
    UniGenei Hs.30570.

    3D structure databases

    ProteinModelPortali O60830.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 115539. 8 interactions.
    IntActi O60830. 2 interactions.
    STRINGi 9606.ENSP00000365766.

    PTM databases

    PhosphoSitei O60830.

    Proteomic databases

    MaxQBi O60830.
    PaxDbi O60830.
    PeptideAtlasi O60830.
    PRIDEi O60830.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000376582 ; ENSP00000365766 ; ENSG00000126768 . [O60830-1 ]
    ENST00000396779 ; ENSP00000379999 ; ENSG00000126768 . [O60830-2 ]
    ENST00000465150 ; ENSP00000477073 ; ENSG00000126768 . [O60830-2 ]
    GeneIDi 10245.
    KEGGi hsa:10245.
    UCSCi uc004dlc.2. human. [O60830-1 ]

    Organism-specific databases

    CTDi 10245.
    GeneCardsi GC0XM048750.
    HGNCi HGNC:17310. TIMM17B.
    HPAi HPA029093.
    MIMi 300249. gene.
    neXtProti NX_O60830.
    PharmGKBi PA38226.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5596.
    HOGENOMi HOG000183190.
    HOVERGENi HBG054233.
    InParanoidi O60830.
    KOi K17795.
    OMAi FSTFDCG.
    OrthoDBi EOG7JX35C.
    PhylomeDBi O60830.
    TreeFami TF106195.

    Enzyme and pathway databases

    Reactomei REACT_118595. Mitochondrial protein import.

    Miscellaneous databases

    ChiTaRSi TIMM17B. human.
    GenomeRNAii 10245.
    NextBioi 35535213.
    PROi O60830.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O60830.
    Bgeei O60830.
    CleanExi HS_TIMM17B.
    Genevestigatori O60830.

    Family and domain databases

    InterProi IPR005678. Tim17.
    IPR003397. Tim17/Tim22/Tim23/PMP24.
    [Graphical view ]
    Pfami PF02466. Tim17. 1 hit.
    [Graphical view ]
    TIGRFAMsi TIGR00980. 3a0801so1tim17. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Genetic and structural characterization of the human mitochondrial inner membrane translocase."
      Bauer M.F., Gempel K., Reichert A.S., Rappold G.A., Lichtner P., Gerbitz K.-D., Neupert W., Brunner M., Hofmann S.
      J. Mol. Biol. 289:69-82(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "Transcription map in Xp11.23."
      Strom T.M., Nyakatura G., Hellebrand H., Drescher B., Rosenthal A., Meindl A.
      Submitted (APR-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Peripheral blood leukocyte.
    3. "Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells."
      Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X.
      , Gu J., Chen S.-J., Chen Z.
      Genome Res. 10:1546-1560(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Umbilical cord blood.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Thalamus.
    5. "The DNA sequence of the human X chromosome."
      Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
      , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
      Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Placenta and Uterus.
    8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    9. "Methylation-controlled J-protein MCJ acts in the import of proteins into human mitochondria."
      Schusdziarra C., Blamowska M., Azem A., Hell K.
      Hum. Mol. Genet. 22:1348-1357(2013) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH DNAJC15.

    Entry informationi

    Entry nameiTI17B_HUMAN
    AccessioniPrimary (citable) accession number: O60830
    Secondary accession number(s): A8K2E2, J3KPV3, Q9UJV0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 11, 2001
    Last sequence update: August 1, 1998
    Last modified: October 1, 2014
    This is version 120 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome X
      Human chromosome X: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3