O60828 (PQBP1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 115.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Polyglutamine-binding protein 1 Short name=PQBP-1 Alternative name(s): 38 kDa nuclear protein containing a WW domain Short name=Npw38 Polyglutamine tract-binding protein 1 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 265 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May suppress the ability of POU3F2 to transactivate the DRD1 gene in a POU3F2 dependent manner. Can activate transcription directly or via association with the transcription machinery. May be involved in ATXN1 mutant-induced cell death. The interaction with ATXN1 mutant reduces levels of phosphorylated RNA polymerase II large subunit. Ref.1 Ref.2 Ref.10 |
| Subunit structure | Interacts with POU3F2/Brn-2, ATXN1, TXNL4A, HTT and AR. Interaction with ATXN1 correlates positively with the length of the polyglutamine tract. Interacts with RNA polymerase II large subunit in a phosphorylation-dependent manner. Forms a ternary complex with ATXN1 mutant and phosphorylated RNA polymerase II. Ref.1 Ref.8 Ref.9 Ref.10 |
| Subcellular location | Nucleus. Note: Co-localized with POU3F2. Co-localized with ATXN1 in nuclear inclusion bodies. Ref.1 Ref.2 Ref.10 |
| Tissue specificity | Widely expressed with high level in heart, skeletal muscle, pancreas, spleen, thymus, prostate, ovary, small intestine and peripheral blood leukocytes. Ref.1 Ref.2 |
| Domain | The WW domain may play a role as a transcriptional activator directly or via association with the transcription machinery. The WW domain mediates interaction with C-terminal domain of RNA polymerase II large subunit. |
| Involvement in disease | Renpenning syndrome 1 (RENS1) [MIM:309500]: A X-linked mental retardation syndrome characterized by mental retardation, microcephaly, short stature, and small testes. The craniofacies tends to be narrow and tall with upslanting palpebral fissures, abnormal nasal configuration, cupped ears, and short philtrum. The nose may appear long or bulbous, with overhanging columella. Less consistent manifestations include ocular colobomas, cardiac malformations, cleft palate, and anal anomalies. |
| Sequence similarities | Contains 1 WW domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Mental retardation |
| Domain | Coiled coil Repeat |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | regulation of transcription, DNA-dependent Traceable author statement Ref.2. Source: ProtInc transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | cytoplasm Inferred from direct assay. Source: HPA cytoplasmic stress granuleInferred from electronic annotation. Source: Compara neuronal ribonucleoprotein granuleInferred from electronic annotation. Source: Compara nucleusInferred from direct assay. Source: HPA |
| Molecular_function | DNA binding Traceable author statement Ref.8. Source: ProtInc transcription coactivator activityTraceable author statement Ref.2. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 10 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O60828-1) Also known as: PQBP-1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O60828-2) The sequence of this isoform differs from the canonical sequence as follows: 193-193: Missing. | ||||||
| Isoform 3 (identifier: O60828-3) Also known as: PQBP-1b/c; The sequence of this isoform differs from the canonical sequence as follows: 193-224: AVSRKDEELDPMDPSSYSDAPRGTWSTGLPKR → GKLGRMGLGETNKVQGALREEAFPQKDAWTWG 225-265: Missing. | ||||||
| Isoform 4 (identifier: O60828-4) Also known as: PQBP-1d; The sequence of this isoform differs from the canonical sequence as follows: 98-192: Missing. | ||||||
| Isoform 5 (identifier: O60828-5) The sequence of this isoform differs from the canonical sequence as follows: 68-167: Missing. | ||||||
| Isoform 6 (identifier: O60828-6) The sequence of this isoform differs from the canonical sequence as follows: 149-149: V → Q 150-265: Missing. | ||||||
| Isoform 7 (identifier: O60828-7) The sequence of this isoform differs from the canonical sequence as follows: 99-128: AEEKLDRSHDKSDRGHDKSDRSHEKLDRGH → LCPQMLKKSWTGAMTSRTGAMTSRTAAMRN 129-265: Missing. | ||||||
| Isoform 8 (identifier: O60828-8) Also known as: PQBP-1a; The sequence of this isoform differs from the canonical sequence as follows: 55-73: VFDPSCGLPYYWNADTDLV → RAPLLLECRHRPCILALPT 74-265: Missing. | ||||||
| Isoform 9 (identifier: O60828-9) The sequence of this isoform differs from the canonical sequence as follows: 61-67: GLPYYWN → PGWSAMV 68-265: Missing. | ||||||
| Isoform 10 (identifier: O60828-10) The sequence of this isoform differs from the canonical sequence as follows: 60-60: C → W 61-265: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed Ref.7 | ||||||
| Chain | 2 – 265 | 264 | Polyglutamine-binding protein 1 | PRO_0000076089 | |||||
Regions | |||||||||
| Domain | 46 – 80 | 35 | WW | ||||||
| Repeat | 104 – 110 | 7 | 1-1 | ||||||
| Repeat | 111 – 117 | 7 | 1-2 | ||||||
| Repeat | 118 – 124 | 7 | 1-3 | ||||||
| Repeat | 125 – 131 | 7 | 1-4 | ||||||
| Repeat | 132 – 138 | 7 | 1-5 | ||||||
| Repeat | 139 – 140 | 2 | 2-1 | ||||||
| Repeat | 141 – 142 | 2 | 2-2 | ||||||
| Repeat | 143 – 144 | 2 | 2-3 | ||||||
| Repeat | 150 – 151 | 2 | 3-1 | ||||||
| Repeat | 152 – 153 | 2 | 3-2 | ||||||
| Repeat | 154 – 155 | 2 | 3-3 | ||||||
| Repeat | 156 – 157 | 2 | 3-4 | ||||||
| Repeat | 158 – 159 | 2 | 3-5 | ||||||
| Repeat | 160 – 161 | 2 | 3-6 | ||||||
| Repeat | 162 – 163 | 2 | 3-7 | ||||||
| Region | 104 – 138 | 35 | 5 X 7 AA approximate tandem repeats of D-R-[SG]-H-D-K-S | ||||||
| Region | 139 – 144 | 6 | 3 X 2 AA tandem repeats of [DE]-R | ||||||
| Region | 150 – 163 | 14 | 7 X 2 AA tandem repeats of [DE]-R | ||||||
| Coiled coil | 84 – 109 | 26 | Potential | ||||||
| Compositional bias | 140 – 181 | 42 | Arg-rich | ||||||
Sites | |||||||||
| Site | 2 | 1 | Not acetylated | ||||||
Amino acid modifications | |||||||||
| Modified residue | 94 | 1 | Phosphoserine Ref.14 | ||||||
| Modified residue | 247 | 1 | Phosphoserine Ref.13 | ||||||
Natural variations | |||||||||
| Alternative sequence | 55 – 73 | 19 | VFDPS…DTDLV → RAPLLLECRHRPCILALPT in isoform 8. | VSP_015896 | |||||
| Alternative sequence | 60 | 1 | C → W in isoform 10. | VSP_015897 | |||||
| Alternative sequence | 61 – 265 | 205 | Missing in isoform 10. | VSP_015898 | |||||
| Alternative sequence | 61 – 67 | 7 | GLPYYWN → PGWSAMV in isoform 9. | VSP_015899 | |||||
| Alternative sequence | 68 – 265 | 198 | Missing in isoform 9. | VSP_015901 | |||||
| Alternative sequence | 68 – 167 | 100 | Missing in isoform 5. | VSP_015900 | |||||
| Alternative sequence | 74 – 265 | 192 | Missing in isoform 8. | VSP_015902 | |||||
| Alternative sequence | 98 – 192 | 95 | Missing in isoform 4. | VSP_015903 | |||||
| Alternative sequence | 99 – 128 | 30 | AEEKL…LDRGH → LCPQMLKKSWTGAMTSRTGA MTSRTAAMRN in isoform 7. | VSP_015904 | |||||
| Alternative sequence | 129 – 265 | 137 | Missing in isoform 7. | VSP_015905 | |||||
| Alternative sequence | 149 | 1 | V → Q in isoform 6. | VSP_015906 | |||||
| Alternative sequence | 150 – 265 | 116 | Missing in isoform 6. | VSP_015907 | |||||
| Alternative sequence | 193 – 224 | 32 | AVSRK…GLPKR → GKLGRMGLGETNKVQGALRE EAFPQKDAWTWG in isoform 3. | VSP_015908 | |||||
| Alternative sequence | 193 | 1 | Missing in isoform 2. | VSP_015909 | |||||
| Alternative sequence | 225 – 265 | 41 | Missing in isoform 3. | VSP_015910 | |||||
| Natural variant | 224 | 1 | R → W in a colorectal cancer sample; somatic mutation. Ref.16 | VAR_036357 | |||||
Experimental info | |||||||||
| Mutagenesis | 52 | 1 | W → A: Enhances activity. Reduces activity; when associated with A-75. Markedly reduced activity; when associated with A-64; A-65 and A-66. Abolishes activity; when associated with A-64; A-65; A-66 and A-75. Ref.2 | ||||||
| Mutagenesis | 64 | 1 | Y → A: No effect on activity; when associated with A-65 and A-66. Markedly reduced activity; when associated with A-52; A-65 and A-66. Abolishes activity; when associated with A-52; A-65; A-66 and A-75. Ref.2 | ||||||
| Mutagenesis | 65 | 1 | Y → A: No effect on activity; when associated with A-64 and A-66. Markedly reduced activity; when associated with A-52; A-64 and A-66. Abolishes activity; when associated with A-52; A-64; A-66 and A-75. Ref.2 | ||||||
| Mutagenesis | 66 | 1 | W → A: No effect on activity; when associated with A-64 and A-65. Markedly reduced activity; when associated with A-52; A-64 and A-65. Abolishes activity; when associated with A-52; A-64; A-65 and A-75. Ref.2 | ||||||
| Mutagenesis | 75 | 1 | W → A: No effect on activity. Reduces activity; when associated with A-52. Abolishes activity; when associated with A-52; A-64; A-65 and A-66. Ref.2 | ||||||
| Mutagenesis | 78 | 1 | P → G: No effect on activity. Ref.2 | ||||||
| Sequence conflict | 8 | 1 | Q → L in CAJ00539. Ref.4 | ||||||
| Sequence conflict | 57 | 1 | D → N in CAJ00548. Ref.4 | ||||||
| Sequence conflict | 107 – 113 | 7 | Missing in CAJ00538. Ref.4 | ||||||
| Sequence conflict | 107 – 113 | 7 | Missing in CAJ00539. Ref.4 | ||||||
| Sequence conflict | 107 – 113 | 7 | Missing in CAJ00540. Ref.4 | ||||||
| Sequence conflict | 107 – 113 | 7 | Missing in CAJ00541. Ref.4 | ||||||
| Sequence conflict | 107 | 1 | H → Q in CAJ00549. Ref.4 | ||||||
| Sequence conflict | 147 | 1 | D → G in CAJ00549. Ref.4 | ||||||
| Sequence conflict | 198 | 1 | D → G in CAJ00549. Ref.4 | ||||||
| Sequence conflict | 236 | 1 | A → V in CAJ00548. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "PQBP-1, a novel polyglutamine tract binding protein, inhibits transcription activation by Brn-2 and affects cell survival." Waragai M., Lammers C.-H., Takeuchi S., Imafuku I., Udagawa Y., Kanazawa I., Kawabata M., Mouradian M.M., Okazawa H. Hum. Mol. Genet. 8:977-987(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, INTERACTION WITH POU3F2; HTT AND AR, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Tissue: Brain. |
| [2] | "Npw38, a novel nuclear protein possessing a WW domain capable of activating basal transcription." Komuro A., Saeki M., Kato S. Nucleic Acids Res. 27:1957-1965(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, MUTAGENESIS OF TRP-52; TYR-64; TYR-65; TRP-66; TRP-75 AND PRO-78. Tissue: Gastric adenocarcinoma. |
| [3] | "Genomic organization and alternative transcripts of the human PQBP-1 gene." Iwamoto K., Huang Y.-T., Ueda S. Gene 259:69-73(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1; 3; 4 AND 7). |
| [4] | "Detailed sampling of cloned cDNA samples identifies additional PQBP1 transcript variants." Eades T.L., Huckle E.L., Ross M.T. Submitted (JUN-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 8; 9 AND 10). Tissue: Adrenal gland, Kidney, Small intestine and Thymus. |
| [5] | "Transcription map in Xp11.23." Strom T.M., Nyakatura G., Hellebrand H., Drescher B., Rosenthal A., Meindl A. Submitted (APR-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lung. |
| [7] | Bienvenut W.V., Lilla S., von Kriegsheim A., Lempens A., Kolch W. Submitted (DEC-2008) to UniProtKB Cited for: PROTEIN SEQUENCE OF 2-10 AND 229-243, CLEAVAGE OF INITIATOR METHIONINE, LACK OF N-TERMINAL ACETYLATION, MASS SPECTROMETRY. Tissue: Ovarian carcinoma. |
| [8] | "Polar amino acid-rich sequences bind to polyglutamine tracts." Imafuku I., Waragai M., Takeuchi S., Kanazawa I., Kawabata M., Mouradian M.M., Okazawa H. Biochem. Biophys. Res. Commun. 253:16-20(1998) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH POU3F2. |
| [9] | "PQBP-1/Npw38, a nuclear protein binding to the polyglutamine tract, interacts with U5-15kD/dim1p via the carboxyl-terminal domain." Waragai M., Junn E., Kajikawa M., Takeuchi S., Kanazawa I., Shibata M., Mouradian M.M., Okazawa H. Biochem. Biophys. Res. Commun. 273:592-595(2000) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TXNL4A. |
| [10] | "Interaction between mutant ataxin-1 and PQBP-1 affects transcription and cell death." Okazawa H., Rich T., Chang A., Lin X., Waragai M., Kajikawa M., Enokido Y., Komuro A., Kato S., Shibata M., Hatanaka H., Mouradian M.M., Sudol M., Kanazawa I. Neuron 34:701-713(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH ATXN1 AND RNA POLYMERASE II LARGE SUBUNIT, SUBCELLULAR LOCATION. |
| [11] | "Renpenning syndrome comes into focus." Stevenson R.E., Bennett C.W., Abidi F., Kleefstra T., Porteous M., Simensen R.J., Lubs H.A., Hamel B.C.J., Schwartz C.E. Am. J. Med. Genet. A 134:415-421(2005) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON RENS1. |
| [12] | "Mutations in the polyglutamine binding protein 1 gene cause X-linked mental retardation." Kalscheuer V.M., Freude K., Musante L., Jensen L.R., Yntema H.G., Gecz J., Sefiani A., Hoffmann K., Moser B., Haas S., Gurok U., Haesler S., Aranda B., Nshedjan A., Tzschach A., Hartmann N., Roloff T.C., Shoichet S. Ropers H.-H.Nat. Genet. 35:313-315(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN RENS1. |
| [13] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-247, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [14] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-94, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [15] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [16] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] TRP-224. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ242829 mRNA. Translation: CAB44309.1. AB016533 mRNA. Translation: BAA76400.1. AB041832 Genomic DNA. Translation: BAB16702.1. AB041832 Genomic DNA. Translation: BAB16703.1. AB041832 Genomic DNA. Translation: BAB16704.1. AB041832 Genomic DNA. Translation: BAB16705.1. AB041833 mRNA. Translation: BAB16706.1. AB041834 mRNA. Translation: BAB16707.1. AB041835 mRNA. Translation: BAB16708.1. AB041836 mRNA. Translation: BAB16709.1. AJ973593 mRNA. Translation: CAJ00537.1. AJ973594 mRNA. Translation: CAJ00538.1. AJ973595 mRNA. Translation: CAJ00539.1. AJ973596 mRNA. Translation: CAJ00540.1. AJ973597 mRNA. Translation: CAJ00541.1. AJ973598 mRNA. Translation: CAJ00542.1. AJ973599 mRNA. Translation: CAJ00543.1. AJ973600 mRNA. Translation: CAJ00544.1. AJ973601 mRNA. Translation: CAJ00545.1. AJ973602 mRNA. Translation: CAJ00546.1. AJ973603 mRNA. Translation: CAJ00547.1. AJ973605 mRNA. Translation: CAJ00548.1. AJ973606 mRNA. Translation: CAJ00549.1. AJ973607 mRNA. Translation: CAJ00550.1. AJ005893 mRNA. Translation: CAA06750.1. BC012358 mRNA. Translation: AAH12358.1. |
| IPI | IPI00024698. IPI00030216. IPI00386483. IPI00386509. IPI00607789. IPI00607805. IPI00607824. IPI00644888. IPI00654565. IPI00654698. |
| RefSeq | NP_001027553.1. NM_001032381.1. NP_001027554.1. NM_001032382.1. NP_001027555.1. NM_001032383.1. NP_001027556.1. NM_001032384.1. NP_001161461.1. NM_001167989.1. NP_001161462.1. NM_001167990.1. NP_001161464.1. NM_001167992.1. NP_005701.1. NM_005710.2. NP_652766.1. NM_144495.2. |
| UniGene | Hs.534384. |
3D structure databases | |
| ProteinModelPortal | O60828. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O60828. 8 interactions. |
| MINT | MINT-112545. |
PTM databases | |
| PhosphoSite | O60828. |
Proteomic databases | |
| PaxDb | O60828. |
| PRIDE | O60828. |
Protocols and materials databases | |
| DNASU | 10084. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000218224; ENSP00000218224; ENSG00000102103. ENST00000247140; ENSP00000247140; ENSG00000102103. ENST00000376548; ENSP00000365731; ENSG00000102103. ENST00000376563; ENSP00000365747; ENSG00000102103. ENST00000376566; ENSP00000365750; ENSG00000102103. ENST00000396763; ENSP00000379985; ENSG00000102103. ENST00000447146; ENSP00000391759; ENSG00000102103. ENST00000593464; ENSP00000472506; ENSG00000268142. ENST00000594868; ENSP00000469772; ENSG00000268142. ENST00000597699; ENSP00000472009; ENSG00000268142. ENST00000597809; ENSP00000470666; ENSG00000268142. ENST00000600107; ENSP00000471461; ENSG00000268142. ENST00000600640; ENSP00000469504; ENSG00000268142. ENST00000601234; ENSP00000472437; ENSG00000268142. |
| GeneID | 10084. |
| KEGG | hsa:10084. |
| UCSC | uc004dle.3. human. uc004dlj.1. human. uc004dlk.3. human. uc004dln.3. human. uc010nij.3. human. |
Organism-specific databases | |
| CTD | 10084. |
| GeneCards | GC0XP048755. |
| HGNC | HGNC:9330. PQBP1. |
| HPA | HPA001880. |
| MIM | 300463. gene. 309500. phenotype. |
| neXtProt | NX_O60828. |
| Orphanet | 93946. Hamel cerebro-palato-cardiac syndrome. 93947. X-linked intellectual deficit, Golabi-Ito-Hall type. 93945. X-linked intellectual deficit, Porteous type. 93950. X-linked intellectual deficit, Sutherland-Haan type. |
| PharmGKB | PA33693. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG265480. |
| HOVERGEN | HBG053064. |
| InParanoid | O60828. |
| KO | K12865. |
| OMA | SHEKSDR. |
| OrthoDB | EOG4NCMF0. |
| PhylomeDB | O60828. |
Enzyme and pathway databases | |
| SignaLink | O60828. |
Gene expression databases | |
| ArrayExpress | O60828. |
| Bgee | O60828. |
| Genevestigator | O60828. |
| GermOnline | ENSG00000102103. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR001202. WW_dom. [Graphical view] |
| Pfam | PF00397. WW. 1 hit. [Graphical view] |
| SMART | SM00456. WW. 1 hit. [Graphical view] |
| SUPFAM | SSF51045. WW_Rsp5_WWP. 1 hit. |
| PROSITE | PS01159. WW_DOMAIN_1. False negative. PS50020. WW_DOMAIN_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | PQBP1. human. |
| GenomeRNAi | 10084. |
| NextBio | 38125. |
| PMAP-CutDB | O60828. |
| SOURCE | Search... |
Entry information
| Entry name | PQBP1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O60828 Secondary accession number(s): Q4VY25 Q9GZZ4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
