Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

85/88 kDa calcium-independent phospholipase A2

Gene

PLA2G6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Catalyzes the release of fatty acids from phospholipids. It has been implicated in normal phospholipid remodeling, nitric oxide-induced or vasopressin-induced arachidonic acid release and in leukotriene and prostaglandin production. May participate in fas mediated apoptosis and in regulating transmembrane ion flux in glucose-stimulated B-cells. Has a role in cardiolipin (CL) deacylation. Required for both speed and directionality of monocyte MCP1/CCL2-induced chemotaxis through regulation of F-actin polymerization at the pseudopods.
Isoform ankyrin-iPLA2-1 and isoform ankyrin-iPLA2-2, which lack the catalytic domain, are probably involved in the negative regulation of iPLA2 activity.

Catalytic activityi

Phosphatidylcholine + H2O = 1-acylglycerophosphocholine + a carboxylate.

Enzyme regulationi

Inhibited by calcium-activated calmodulin.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei519NucleophilePROSITE-ProRule annotation1
Active sitei652Proton acceptorPROSITE-ProRule annotation1

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Biological processi

Chemotaxis, Lipid degradation, Lipid metabolism

Keywords - Ligandi

Calmodulin-binding

Enzyme and pathway databases

BioCyciZFISH:HS00055-MONOMER.
BRENDAi3.1.1.4. 2681.
ReactomeiR-HSA-1482788. Acyl chain remodelling of PC.
R-HSA-1482798. Acyl chain remodeling of CL.
R-HSA-1482839. Acyl chain remodelling of PE.
R-HSA-2029485. Role of phospholipids in phagocytosis.
R-HSA-6811436. COPI-independent Golgi-to-ER retrograde traffic.

Chemistry databases

SwissLipidsiSLP:000000618.

Names & Taxonomyi

Protein namesi
Recommended name:
85/88 kDa calcium-independent phospholipase A2 (EC:3.1.1.4)
Short name:
CaI-PLA2
Alternative name(s):
Group VI phospholipase A2
Short name:
GVI PLA2
Intracellular membrane-associated calcium-independent phospholipase A2 beta
Short name:
iPLA2-beta
Patatin-like phospholipase domain-containing protein 9
Short name:
PNPLA9
Gene namesi
Name:PLA2G6
Synonyms:PLPLA9
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 22

Organism-specific databases

HGNCiHGNC:9039. PLA2G6.

Subcellular locationi

Isoform LH-iPLA2 :

GO - Cellular componenti

  • cytoplasm Source: HPA
  • cytosol Source: Reactome
  • extracellular space Source: UniProtKB
  • membrane Source: UniProtKB-SubCell
  • microtubule organizing center Source: HPA
  • mitochondrion Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Membrane

Pathology & Biotechi

Involvement in diseasei

Neurodegeneration with brain iron accumulation 2B (NBIA2B)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA neurodegenerative disorder associated with iron accumulation in the brain, primarily in the basal ganglia. It is characterized by progressive extrapyramidal dysfunction leading to rigidity, dystonia, dysarthria and sensorimotor impairment.
See also OMIM:610217
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_029372545K → T in NBIA2B. 1 PublicationCorresponds to variant rs121908681dbSNPEnsembl.1
Natural variantiVAR_029373632R → W in NBIA2B. 1 PublicationCorresponds to variant rs121908683dbSNPEnsembl.1
Neurodegeneration with brain iron accumulation 2A (NBIA2A)3 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA neurodegenerative disease characterized by pathologic axonal swelling and spheroid bodies in the central nervous system. Onset is within the first 2 years of life with death by age 10 years.
See also OMIM:256600
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_029371310V → E in NBIA2A. 1 PublicationCorresponds to variant rs121908682dbSNPEnsembl.1
Natural variantiVAR_070600484D → G in NBIA2A. 1 Publication1
Natural variantiVAR_070601661T → M in NBIA2A. 1 PublicationCorresponds to variant rs767689496dbSNPEnsembl.1
Natural variantiVAR_029374691Missing in NBIA2A. 2 Publications1
Parkinson disease 14 (PARK14)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn adult-onset progressive neurodegenerative disorder characterized by parkinsonism, dystonia, severe cognitive decline, cerebral and cerebellar atrophy and absent iron in the basal ganglia on magnetic resonance imaging.
See also OMIM:612953
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_062530741R → Q in PARK14. 1 PublicationCorresponds to variant rs121908686dbSNPEnsembl.1
Natural variantiVAR_062531747R → W in PARK14. 1 PublicationCorresponds to variant rs121908687dbSNPEnsembl.1

Pharmaceutical usei

Potential target for therapeutic intervention of Barth syndrome.

Keywords - Diseasei

Disease mutation, Dystonia, Neurodegeneration, Parkinsonism

Organism-specific databases

DisGeNETi8398.
MalaCardsiPLA2G6.
MIMi256600. phenotype.
610217. phenotype.
612953. phenotype.
OpenTargetsiENSG00000184381.
Orphaneti199351. Adult-onset dystonia-parkinsonism.
35069. Infantile neuroaxonal dystrophy.
PharmGKBiPA33367.

Chemistry databases

ChEMBLiCHEMBL3213.
DrugBankiDB01103. Quinacrine.

Polymorphism and mutation databases

BioMutaiPLA2G6.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000670371 – 80685/88 kDa calcium-independent phospholipase A2Add BLAST806

Proteomic databases

MaxQBiO60733.
PaxDbiO60733.
PeptideAtlasiO60733.
PRIDEiO60733.

PTM databases

iPTMnetiO60733.
PhosphoSitePlusiO60733.

Miscellaneous databases

PMAP-CutDBO60733.

Expressioni

Tissue specificityi

Four different transcripts were found to be expressed in a distinct tissue distribution.

Gene expression databases

BgeeiENSG00000184381.
CleanExiHS_PLA2G6.
ExpressionAtlasiO60733. baseline and differential.
GenevisibleiO60733. HS.

Organism-specific databases

HPAiHPA001171.

Interactioni

Subunit structurei

Forms large oligomeric 270-350 kDa structures.

Protein-protein interaction databases

BioGridi113986. 2 interactors.
IntActiO60733. 6 interactors.
STRINGi9606.ENSP00000333142.

Chemistry databases

BindingDBiO60733.

Structurei

3D structure databases

ProteinModelPortaliO60733.
SMRiO60733.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati151 – 181ANK 1Add BLAST31
Repeati185 – 215ANK 2Add BLAST31
Repeati219 – 248ANK 3Add BLAST30
Repeati251 – 281ANK 4Add BLAST31
Repeati286 – 312ANK 5Add BLAST27
Repeati316 – 345ANK 6Add BLAST30
Repeati349 – 378ANK 7Add BLAST30
Domaini481 – 665PNPLAPROSITE-ProRule annotationAdd BLAST185

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni677 – 696Calmodulin-bindingBy similarityAdd BLAST20
Regioni748 – 759Calmodulin-bindingBy similarityAdd BLAST12

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi485 – 490GXGXXGPROSITE-ProRule annotation6
Motifi517 – 521GXSXGPROSITE-ProRule annotation5
Motifi652 – 654DGA/GPROSITE-ProRule annotation3

Sequence similaritiesi

Contains 7 ANK repeats.PROSITE-ProRule annotation
Contains 1 PNPLA (patatin-like phospholipase) domain.PROSITE-ProRule annotation

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

eggNOGiKOG0513. Eukaryota.
COG0666. LUCA.
COG3621. LUCA.
GeneTreeiENSGT00530000063645.
HOVERGENiHBG053482.
InParanoidiO60733.
KOiK16343.
OMAiKEDMVRS.
OrthoDBiEOG091G042U.
PhylomeDBiO60733.
TreeFamiTF319230.

Family and domain databases

Gene3Di1.25.40.20. 2 hits.
InterProiIPR016035. Acyl_Trfase/lysoPLipase.
IPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR002641. Patatin/PLipase_A2-rel.
[Graphical view]
PfamiPF12796. Ank_2. 1 hit.
PF01734. Patatin. 1 hit.
[Graphical view]
PRINTSiPR01415. ANKYRIN.
SMARTiSM00248. ANK. 6 hits.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 1 hit.
SSF52151. SSF52151. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 4 hits.
PS51635. PNPLA. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform LH-iPLA2 (identifier: O60733-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQFFGRLVNT FSGVTNLFSN PFRVKEVAVA DYTSSDRVRE EGQLILFQNT
60 70 80 90 100
PNRTWDCVLV NPRNSQSGFR LFQLELEADA LVNFHQYSSQ LLPFYESSPQ
110 120 130 140 150
VLHTEVLQHL TDLIRNHPSW SVAHLAVELG IRECFHHSRI ISCANCAENE
160 170 180 190 200
EGCTPLHLAC RKGDGEILVE LVQYCHTQMD VTDYKGETVF HYAVQGDNSQ
210 220 230 240 250
VLQLLGRNAV AGLNQVNNQG LTPLHLACQL GKQEMVRVLL LCNARCNIMG
260 270 280 290 300
PNGYPIHSAM KFSQKGCAEM IISMDSSQIH SKDPRYGASP LHWAKNAEMA
310 320 330 340 350
RMLLKRGCNV NSTSSAGNTA LHVAVMRNRF DCAIVLLTHG ANADARGEHG
360 370 380 390 400
NTPLHLAMSK DNVEMIKALI VFGAEVDTPN DFGETPTFLA SKIGRLVTRK
410 420 430 440 450
AILTLLRTVG AEYCFPPIHG VPAEQGSAAP HHPFSLERAQ PPPISLNNLE
460 470 480 490 500
LQDLMHISRA RKPAFILGSM RDEKRTHDHL LCLDGGGVKG LIIIQLLIAI
510 520 530 540 550
EKASGVATKD LFDWVAGTST GGILALAILH SKSMAYMRGM YFRMKDEVFR
560 570 580 590 600
GSRPYESGPL EEFLKREFGE HTKMTDVRKP KVMLTGTLSD RQPAELHLFR
610 620 630 640 650
NYDAPETVRE PRFNQNVNLR PPAQPSDQLV WRAARSSGAA PTYFRPNGRF
660 670 680 690 700
LDGGLLANNP TLDAMTEIHE YNQDLIRKGQ ANKVKKLSIV VSLGTGRSPQ
710 720 730 740 750
VPVTCVDVFR PSNPWELAKT VFGAKELGKM VVDCCTDPDG RAVDRARAWC
760 770 780 790 800
EMVGIQYFRL NPQLGTDIML DEVSDTVLVN ALWETEVYIY EHREEFQKLI

QLLLSP
Length:806
Mass (Da):89,903
Last modified:May 30, 2000 - v2
Checksum:i8E55CD4EB9ACAD8B
GO
Isoform SH-iPLA2 (identifier: O60733-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     396-450: LVTRKAILTLLRTVGAEYCFPPIHGVPAEQGSAAPHHPFSLERAQPPPISLNNLE → Q

Show »
Length:752
Mass (Da):84,093
Checksum:iF1C46C9380332E1D
GO
Isoform Ankyrin-iPLA2-1 (identifier: O60733-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     477-479: HDH → CRT
     480-806: Missing.

Show »
Length:479
Mass (Da):53,216
Checksum:i2C849808049DD065
GO
Isoform Ankyrin-iPLA2-2 (identifier: O60733-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     71-142: Missing.
     450-499: ELQDLMHISR...GLIIIQLLIA → GSHPSQAGWW...READMQNLSP
     500-806: Missing.

Show »
Length:427
Mass (Da):46,484
Checksum:i52DAEBA2EDDC4C31
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti11F → S in AAD30424 (PubMed:10336645).Curated1
Sequence conflicti64N → D in AAD41722 (PubMed:10092647).Curated1
Sequence conflicti64N → D in AAD41723 (PubMed:10092647).Curated1
Sequence conflicti579K → I in AAD30424 (PubMed:10336645).Curated1
Sequence conflicti686K → I in AAD30424 (PubMed:10336645).Curated1
Sequence conflicti801Q → H in AAC97486 (PubMed:9417066).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01896158V → I.1 PublicationCorresponds to variant rs11570605dbSNPEnsembl.1
Natural variantiVAR_01896263R → G.1 PublicationCorresponds to variant rs11570606dbSNPEnsembl.1
Natural variantiVAR_01896370R → Q.1 PublicationCorresponds to variant rs11570607dbSNPEnsembl.1
Natural variantiVAR_018964183D → N.1 PublicationCorresponds to variant rs11570646dbSNPEnsembl.1
Natural variantiVAR_029371310V → E in NBIA2A. 1 PublicationCorresponds to variant rs121908682dbSNPEnsembl.1
Natural variantiVAR_018965343A → T.1 PublicationCorresponds to variant rs11570680dbSNPEnsembl.1
Natural variantiVAR_070600484D → G in NBIA2A. 1 Publication1
Natural variantiVAR_029372545K → T in NBIA2B. 1 PublicationCorresponds to variant rs121908681dbSNPEnsembl.1
Natural variantiVAR_029373632R → W in NBIA2B. 1 PublicationCorresponds to variant rs121908683dbSNPEnsembl.1
Natural variantiVAR_070601661T → M in NBIA2A. 1 PublicationCorresponds to variant rs767689496dbSNPEnsembl.1
Natural variantiVAR_029374691Missing in NBIA2A. 2 Publications1
Natural variantiVAR_062530741R → Q in PARK14. 1 PublicationCorresponds to variant rs121908686dbSNPEnsembl.1
Natural variantiVAR_062531747R → W in PARK14. 1 PublicationCorresponds to variant rs121908687dbSNPEnsembl.1
Natural variantiVAR_037903774S → T.Corresponds to variant rs34184838dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_00027771 – 142Missing in isoform Ankyrin-iPLA2-2. 1 PublicationAdd BLAST72
Alternative sequenceiVSP_000278396 – 450LVTRK…LNNLE → Q in isoform SH-iPLA2. 2 PublicationsAdd BLAST55
Alternative sequenceiVSP_000279450 – 499ELQDL…QLLIA → GSHPSQAGWWAWGAVSDGTT GSHAHLTGPEASVHPGLHEG READMQNLSP in isoform Ankyrin-iPLA2-2. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_000281477 – 479HDH → CRT in isoform Ankyrin-iPLA2-1. 1 Publication3
Alternative sequenceiVSP_000282480 – 806Missing in isoform Ankyrin-iPLA2-1. 1 PublicationAdd BLAST327
Alternative sequenceiVSP_000280500 – 806Missing in isoform Ankyrin-iPLA2-2. 1 PublicationAdd BLAST307

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF064594 mRNA. Translation: AAC97486.1.
AF102988 mRNA. Translation: AAD41722.1.
AF102989 mRNA. Translation: AAD41723.1.
AF117692
, AF117677, AF117678, AF117679, AF117680, AF117681, AF117682, AF117683, AF117684, AF117685, AF117686, AF117687, AF117688, AF117689, AF117690, AF117691 Genomic DNA. Translation: AAD30424.1.
AF116267
, AF116252, AF116253, AF116254, AF116255, AF116256, AF116257, AF116258, AF116259, AF116260, AF116261, AF116262, AF116263, AF116264, AF116265, AF116266 Genomic DNA. Translation: AAF34728.1.
AL080187 mRNA. Translation: CAB45768.2.
CR456543 mRNA. Translation: CAG30429.1.
AY522921 Genomic DNA. Translation: AAR92478.1.
AK291212 mRNA. Translation: BAF83901.1.
AL022322 Genomic DNA. Translation: CAA18446.1.
AL022322 Genomic DNA. Translation: CAQ10446.1.
CH471095 Genomic DNA. Translation: EAW60219.1.
CH471095 Genomic DNA. Translation: EAW60220.1.
BC036742 mRNA. Translation: AAH36742.2.
BC051904 mRNA. Translation: AAH51904.1.
CCDSiCCDS13967.1. [O60733-1]
CCDS33645.1. [O60733-2]
RefSeqiNP_001004426.1. NM_001004426.1. [O60733-2]
NP_001186491.1. NM_001199562.1. [O60733-2]
NP_003551.2. NM_003560.2. [O60733-1]
XP_005261821.1. XM_005261764.2. [O60733-1]
XP_005261822.1. XM_005261765.1. [O60733-1]
XP_005261823.1. XM_005261766.1. [O60733-1]
XP_006724395.1. XM_006724332.3. [O60733-1]
XP_016884470.1. XM_017028981.1. [O60733-2]
XP_016884471.1. XM_017028982.1. [O60733-2]
XP_016884477.1. XM_017028988.1. [O60733-3]
UniGeneiHs.170479.

Genome annotation databases

EnsembliENST00000332509; ENSP00000333142; ENSG00000184381. [O60733-1]
ENST00000335539; ENSP00000335149; ENSG00000184381. [O60733-2]
ENST00000402064; ENSP00000386100; ENSG00000184381. [O60733-2]
GeneIDi8398.
KEGGihsa:8398.
UCSCiuc003auy.2. human. [O60733-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF064594 mRNA. Translation: AAC97486.1.
AF102988 mRNA. Translation: AAD41722.1.
AF102989 mRNA. Translation: AAD41723.1.
AF117692
, AF117677, AF117678, AF117679, AF117680, AF117681, AF117682, AF117683, AF117684, AF117685, AF117686, AF117687, AF117688, AF117689, AF117690, AF117691 Genomic DNA. Translation: AAD30424.1.
AF116267
, AF116252, AF116253, AF116254, AF116255, AF116256, AF116257, AF116258, AF116259, AF116260, AF116261, AF116262, AF116263, AF116264, AF116265, AF116266 Genomic DNA. Translation: AAF34728.1.
AL080187 mRNA. Translation: CAB45768.2.
CR456543 mRNA. Translation: CAG30429.1.
AY522921 Genomic DNA. Translation: AAR92478.1.
AK291212 mRNA. Translation: BAF83901.1.
AL022322 Genomic DNA. Translation: CAA18446.1.
AL022322 Genomic DNA. Translation: CAQ10446.1.
CH471095 Genomic DNA. Translation: EAW60219.1.
CH471095 Genomic DNA. Translation: EAW60220.1.
BC036742 mRNA. Translation: AAH36742.2.
BC051904 mRNA. Translation: AAH51904.1.
CCDSiCCDS13967.1. [O60733-1]
CCDS33645.1. [O60733-2]
RefSeqiNP_001004426.1. NM_001004426.1. [O60733-2]
NP_001186491.1. NM_001199562.1. [O60733-2]
NP_003551.2. NM_003560.2. [O60733-1]
XP_005261821.1. XM_005261764.2. [O60733-1]
XP_005261822.1. XM_005261765.1. [O60733-1]
XP_005261823.1. XM_005261766.1. [O60733-1]
XP_006724395.1. XM_006724332.3. [O60733-1]
XP_016884470.1. XM_017028981.1. [O60733-2]
XP_016884471.1. XM_017028982.1. [O60733-2]
XP_016884477.1. XM_017028988.1. [O60733-3]
UniGeneiHs.170479.

3D structure databases

ProteinModelPortaliO60733.
SMRiO60733.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113986. 2 interactors.
IntActiO60733. 6 interactors.
STRINGi9606.ENSP00000333142.

Chemistry databases

BindingDBiO60733.
ChEMBLiCHEMBL3213.
DrugBankiDB01103. Quinacrine.
SwissLipidsiSLP:000000618.

PTM databases

iPTMnetiO60733.
PhosphoSitePlusiO60733.

Polymorphism and mutation databases

BioMutaiPLA2G6.

Proteomic databases

MaxQBiO60733.
PaxDbiO60733.
PeptideAtlasiO60733.
PRIDEiO60733.

Protocols and materials databases

DNASUi8398.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000332509; ENSP00000333142; ENSG00000184381. [O60733-1]
ENST00000335539; ENSP00000335149; ENSG00000184381. [O60733-2]
ENST00000402064; ENSP00000386100; ENSG00000184381. [O60733-2]
GeneIDi8398.
KEGGihsa:8398.
UCSCiuc003auy.2. human. [O60733-1]

Organism-specific databases

CTDi8398.
DisGeNETi8398.
GeneCardsiPLA2G6.
GeneReviewsiPLA2G6.
HGNCiHGNC:9039. PLA2G6.
HPAiHPA001171.
MalaCardsiPLA2G6.
MIMi256600. phenotype.
603604. gene.
610217. phenotype.
612953. phenotype.
neXtProtiNX_O60733.
OpenTargetsiENSG00000184381.
Orphaneti199351. Adult-onset dystonia-parkinsonism.
35069. Infantile neuroaxonal dystrophy.
PharmGKBiPA33367.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0513. Eukaryota.
COG0666. LUCA.
COG3621. LUCA.
GeneTreeiENSGT00530000063645.
HOVERGENiHBG053482.
InParanoidiO60733.
KOiK16343.
OMAiKEDMVRS.
OrthoDBiEOG091G042U.
PhylomeDBiO60733.
TreeFamiTF319230.

Enzyme and pathway databases

BioCyciZFISH:HS00055-MONOMER.
BRENDAi3.1.1.4. 2681.
ReactomeiR-HSA-1482788. Acyl chain remodelling of PC.
R-HSA-1482798. Acyl chain remodeling of CL.
R-HSA-1482839. Acyl chain remodelling of PE.
R-HSA-2029485. Role of phospholipids in phagocytosis.
R-HSA-6811436. COPI-independent Golgi-to-ER retrograde traffic.

Miscellaneous databases

ChiTaRSiPLA2G6. human.
GeneWikiiPLA2G6.
GenomeRNAii8398.
PMAP-CutDBO60733.
PROiO60733.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000184381.
CleanExiHS_PLA2G6.
ExpressionAtlasiO60733. baseline and differential.
GenevisibleiO60733. HS.

Family and domain databases

Gene3Di1.25.40.20. 2 hits.
InterProiIPR016035. Acyl_Trfase/lysoPLipase.
IPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR002641. Patatin/PLipase_A2-rel.
[Graphical view]
PfamiPF12796. Ank_2. 1 hit.
PF01734. Patatin. 1 hit.
[Graphical view]
PRINTSiPR01415. ANKYRIN.
SMARTiSM00248. ANK. 6 hits.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 1 hit.
SSF52151. SSF52151. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 4 hits.
PS51635. PNPLA. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPLPL9_HUMAN
AccessioniPrimary (citable) accession number: O60733
Secondary accession number(s): A8K597
, B0QYE8, O75645, Q8N452, Q9UG29, Q9UIT0, Q9Y671
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: May 30, 2000
Last modified: November 30, 2016
This is version 169 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Pharmaceutical, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.