Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O60733

- PLPL9_HUMAN

UniProt

O60733 - PLPL9_HUMAN

Protein

85/88 kDa calcium-independent phospholipase A2

Gene

PLA2G6

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 146 (01 Oct 2014)
      Sequence version 2 (30 May 2000)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Catalyzes the release of fatty acids from phospholipids. It has been implicated in normal phospholipid remodeling, nitric oxide-induced or vasopressin-induced arachidonic acid release and in leukotriene and prostaglandin production. May participate in fas mediated apoptosis and in regulating transmembrane ion flux in glucose-stimulated B-cells. Has a role in cardiolipin (CL) deacylation. Required for both speed and directionality of monocyte MCP1/CCL2-induced chemotaxis through regulation of F-actin polymerization at the pseudopods.
    Isoform ankyrin-iPLA2-1 and isoform ankyrin-iPLA2-2, which lack the catalytic domain, are probably involved in the negative regulation of iPLA2 activity.

    Catalytic activityi

    Phosphatidylcholine + H2O = 1-acylglycerophosphocholine + a carboxylate.

    Enzyme regulationi

    Inhibited by calcium-activated calmodulin.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei519 – 5191Sequence Analysis

    GO - Molecular functioni

    1. calcium-independent phospholipase A2 activity Source: Ensembl
    2. phospholipase A2 activity Source: ProtInc

    GO - Biological processi

    1. cardiolipin acyl-chain remodeling Source: Reactome
    2. cardiolipin biosynthetic process Source: UniProtKB
    3. cell death Source: UniProtKB-KW
    4. chemotaxis Source: UniProtKB-KW
    5. Fc-gamma receptor signaling pathway involved in phagocytosis Source: Reactome
    6. glycerophospholipid biosynthetic process Source: Reactome
    7. innate immune response Source: Reactome
    8. lipid catabolic process Source: UniProtKB-KW
    9. maternal process involved in female pregnancy Source: Ensembl
    10. memory Source: Ensembl
    11. negative regulation of synaptic transmission, glutamatergic Source: Ensembl
    12. phosphatidylcholine acyl-chain remodeling Source: Reactome
    13. phosphatidylethanolamine acyl-chain remodeling Source: Reactome
    14. phospholipid metabolic process Source: Reactome
    15. positive regulation of arachidonic acid secretion Source: Ensembl
    16. positive regulation of ceramide biosynthetic process Source: Ensembl
    17. positive regulation of cytosolic calcium ion concentration Source: Ensembl
    18. positive regulation of exocytosis Source: Ensembl
    19. positive regulation of insulin secretion involved in cellular response to glucose stimulus Source: Ensembl
    20. positive regulation of protein kinase C signaling Source: Ensembl
    21. positive regulation of protein phosphorylation Source: Ensembl
    22. positive regulation of release of cytochrome c from mitochondria Source: Ensembl
    23. positive regulation of vasodilation Source: Ensembl
    24. regulation of store-operated calcium channel activity Source: Ensembl
    25. response to endoplasmic reticulum stress Source: Ensembl
    26. small molecule metabolic process Source: Reactome
    27. urinary bladder smooth muscle contraction Source: Ensembl

    Keywords - Molecular functioni

    Hydrolase

    Keywords - Biological processi

    Chemotaxis, Lipid degradation, Lipid metabolism

    Keywords - Ligandi

    Calmodulin-binding

    Enzyme and pathway databases

    ReactomeiREACT_120829. Acyl chain remodelling of PC.
    REACT_121006. Acyl chain remodeling of CL.
    REACT_121369. Acyl chain remodelling of PE.
    REACT_160158. Role of phospholipids in phagocytosis.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    85/88 kDa calcium-independent phospholipase A2 (EC:3.1.1.4)
    Short name:
    CaI-PLA2
    Alternative name(s):
    Group VI phospholipase A2
    Short name:
    GVI PLA2
    Intracellular membrane-associated calcium-independent phospholipase A2 beta
    Short name:
    iPLA2-beta
    Patatin-like phospholipase domain-containing protein 9
    Short name:
    PNPLA9
    Gene namesi
    Name:PLA2G6
    Synonyms:PLPLA9
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 22

    Organism-specific databases

    HGNCiHGNC:9039. PLA2G6.

    Subcellular locationi

    Isoform LH-iPLA2 : Membrane; Peripheral membrane protein
    Note: Recruited to the membrane-enriched pseudopod upon MCP1/CCL2 stimulation in monocytes.

    GO - Cellular componenti

    1. cytosol Source: Reactome
    2. membrane Source: UniProtKB-SubCell
    3. mitochondrion Source: Ensembl

    Keywords - Cellular componenti

    Cytoplasm, Membrane

    Pathology & Biotechi

    Involvement in diseasei

    Neurodegeneration with brain iron accumulation 2B (NBIA2B) [MIM:610217]: A neurodegenerative disorder associated with iron accumulation in the brain, primarily in the basal ganglia. It is characterized by progressive extrapyramidal dysfunction leading to rigidity, dystonia, dysarthria and sensorimotor impairment.1 Publication
    Note: The disease is caused by mutations affecting the gene represented in this entry.
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti545 – 5451K → T in NBIA2B. 1 Publication
    VAR_029372
    Natural varianti632 – 6321R → W in NBIA2B. 1 Publication
    VAR_029373
    Neurodegeneration with brain iron accumulation 2A (NBIA2A) [MIM:256600]: A neurodegenerative disease characterized by pathologic axonal swelling and spheroid bodies in the central nervous system. Onset is within the first 2 years of life with death by age 10 years.3 Publications
    Note: The disease is caused by mutations affecting the gene represented in this entry.
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti310 – 3101V → E in NBIA2A. 1 Publication
    VAR_029371
    Natural varianti484 – 4841D → G in NBIA2A. 1 Publication
    VAR_070600
    Natural varianti661 – 6611T → M in NBIA2A. 1 Publication
    VAR_070601
    Natural varianti691 – 6911Missing in NBIA2A. 2 Publications
    VAR_029374
    Parkinson disease 14 (PARK14) [MIM:612953]: An adult-onset progressive neurodegenerative disorder characterized by parkinsonism, dystonia, severe cognitive decline, cerebral and cerebellar atrophy and absent iron in the basal ganglia on magnetic resonance imaging.1 Publication
    Note: The disease is caused by mutations affecting the gene represented in this entry.
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti741 – 7411R → Q in PARK14. 1 Publication
    VAR_062530
    Natural varianti747 – 7471R → W in PARK14. 1 Publication
    VAR_062531

    Pharmaceutical usei

    Potential target for therapeutic intervention of Barth syndrome.

    Keywords - Diseasei

    Disease mutation, Dystonia, Neurodegeneration, Parkinsonism

    Organism-specific databases

    MIMi256600. phenotype.
    610217. phenotype.
    612953. phenotype.
    Orphaneti199351. Adult-onset dystonia-parkinsonism.
    35069. Infantile neuroaxonal dystrophy.
    PharmGKBiPA33367.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 80680685/88 kDa calcium-independent phospholipase A2PRO_0000067037Add
    BLAST

    Proteomic databases

    MaxQBiO60733.
    PaxDbiO60733.
    PRIDEiO60733.

    PTM databases

    PhosphoSiteiO60733.

    Miscellaneous databases

    PMAP-CutDBO60733.

    Expressioni

    Tissue specificityi

    Four different transcripts were found to be expressed in a distinct tissue distribution.

    Gene expression databases

    ArrayExpressiO60733.
    BgeeiO60733.
    CleanExiHS_PLA2G6.
    GenevestigatoriO60733.

    Organism-specific databases

    HPAiHPA001171.

    Interactioni

    Subunit structurei

    Forms large oligomeric 270-350 kDa structures.

    Protein-protein interaction databases

    BioGridi113986. 2 interactions.
    STRINGi9606.ENSP00000333142.

    Structurei

    3D structure databases

    ProteinModelPortaliO60733.
    SMRiO60733. Positions 116-427.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati151 – 18131ANK 1Add
    BLAST
    Repeati185 – 21531ANK 2Add
    BLAST
    Repeati219 – 24830ANK 3Add
    BLAST
    Repeati251 – 28131ANK 4Add
    BLAST
    Repeati286 – 31227ANK 5Add
    BLAST
    Repeati316 – 34530ANK 6Add
    BLAST
    Repeati349 – 37830ANK 7Add
    BLAST
    Domaini481 – 665185PatatinAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni677 – 69620Calmodulin-bindingBy similarityAdd
    BLAST
    Regioni748 – 75912Calmodulin-bindingBy similarityAdd
    BLAST

    Sequence similaritiesi

    Contains 7 ANK repeats.PROSITE-ProRule annotation
    Contains 1 patatin domain.Curated

    Keywords - Domaini

    ANK repeat, Repeat

    Phylogenomic databases

    eggNOGiCOG0666.
    HOVERGENiHBG053482.
    InParanoidiO60733.
    KOiK16343.
    OMAiPTYFRPN.
    OrthoDBiEOG76T9QK.
    PhylomeDBiO60733.
    TreeFamiTF319230.

    Family and domain databases

    Gene3Di1.25.40.20. 2 hits.
    InterProiIPR016035. Acyl_Trfase/lysoPLipase.
    IPR002110. Ankyrin_rpt.
    IPR020683. Ankyrin_rpt-contain_dom.
    IPR002641. Patatin/PLipase_A2-rel.
    [Graphical view]
    PfamiPF00023. Ank. 4 hits.
    PF01734. Patatin. 1 hit.
    [Graphical view]
    PRINTSiPR01415. ANKYRIN.
    SMARTiSM00248. ANK. 6 hits.
    [Graphical view]
    SUPFAMiSSF48403. SSF48403. 1 hit.
    SSF52151. SSF52151. 1 hit.
    PROSITEiPS50297. ANK_REP_REGION. 1 hit.
    PS50088. ANK_REPEAT. 4 hits.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform LH-iPLA2 (identifier: O60733-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MQFFGRLVNT FSGVTNLFSN PFRVKEVAVA DYTSSDRVRE EGQLILFQNT    50
    PNRTWDCVLV NPRNSQSGFR LFQLELEADA LVNFHQYSSQ LLPFYESSPQ 100
    VLHTEVLQHL TDLIRNHPSW SVAHLAVELG IRECFHHSRI ISCANCAENE 150
    EGCTPLHLAC RKGDGEILVE LVQYCHTQMD VTDYKGETVF HYAVQGDNSQ 200
    VLQLLGRNAV AGLNQVNNQG LTPLHLACQL GKQEMVRVLL LCNARCNIMG 250
    PNGYPIHSAM KFSQKGCAEM IISMDSSQIH SKDPRYGASP LHWAKNAEMA 300
    RMLLKRGCNV NSTSSAGNTA LHVAVMRNRF DCAIVLLTHG ANADARGEHG 350
    NTPLHLAMSK DNVEMIKALI VFGAEVDTPN DFGETPTFLA SKIGRLVTRK 400
    AILTLLRTVG AEYCFPPIHG VPAEQGSAAP HHPFSLERAQ PPPISLNNLE 450
    LQDLMHISRA RKPAFILGSM RDEKRTHDHL LCLDGGGVKG LIIIQLLIAI 500
    EKASGVATKD LFDWVAGTST GGILALAILH SKSMAYMRGM YFRMKDEVFR 550
    GSRPYESGPL EEFLKREFGE HTKMTDVRKP KVMLTGTLSD RQPAELHLFR 600
    NYDAPETVRE PRFNQNVNLR PPAQPSDQLV WRAARSSGAA PTYFRPNGRF 650
    LDGGLLANNP TLDAMTEIHE YNQDLIRKGQ ANKVKKLSIV VSLGTGRSPQ 700
    VPVTCVDVFR PSNPWELAKT VFGAKELGKM VVDCCTDPDG RAVDRARAWC 750
    EMVGIQYFRL NPQLGTDIML DEVSDTVLVN ALWETEVYIY EHREEFQKLI 800
    QLLLSP 806
    Length:806
    Mass (Da):89,903
    Last modified:May 30, 2000 - v2
    Checksum:i8E55CD4EB9ACAD8B
    GO
    Isoform SH-iPLA2 (identifier: O60733-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         396-450: LVTRKAILTLLRTVGAEYCFPPIHGVPAEQGSAAPHHPFSLERAQPPPISLNNLE → Q

    Show »
    Length:752
    Mass (Da):84,093
    Checksum:iF1C46C9380332E1D
    GO
    Isoform Ankyrin-iPLA2-1 (identifier: O60733-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         477-479: HDH → CRT
         480-806: Missing.

    Show »
    Length:479
    Mass (Da):53,216
    Checksum:i2C849808049DD065
    GO
    Isoform Ankyrin-iPLA2-2 (identifier: O60733-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         71-142: Missing.
         450-499: ELQDLMHISR...GLIIIQLLIA → GSHPSQAGWW...READMQNLSP
         500-806: Missing.

    Show »
    Length:427
    Mass (Da):46,484
    Checksum:i52DAEBA2EDDC4C31
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti11 – 111F → S in AAD30424. (PubMed:10336645)Curated
    Sequence conflicti64 – 641N → D in AAD41722. (PubMed:10092647)Curated
    Sequence conflicti64 – 641N → D in AAD41723. (PubMed:10092647)Curated
    Sequence conflicti579 – 5791K → I in AAD30424. (PubMed:10336645)Curated
    Sequence conflicti686 – 6861K → I in AAD30424. (PubMed:10336645)Curated
    Sequence conflicti801 – 8011Q → H in AAC97486. (PubMed:9417066)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti58 – 581V → I.1 Publication
    Corresponds to variant rs11570605 [ dbSNP | Ensembl ].
    VAR_018961
    Natural varianti63 – 631R → G.1 Publication
    Corresponds to variant rs11570606 [ dbSNP | Ensembl ].
    VAR_018962
    Natural varianti70 – 701R → Q.1 Publication
    Corresponds to variant rs11570607 [ dbSNP | Ensembl ].
    VAR_018963
    Natural varianti183 – 1831D → N.1 Publication
    Corresponds to variant rs11570646 [ dbSNP | Ensembl ].
    VAR_018964
    Natural varianti310 – 3101V → E in NBIA2A. 1 Publication
    VAR_029371
    Natural varianti343 – 3431A → T.1 Publication
    Corresponds to variant rs11570680 [ dbSNP | Ensembl ].
    VAR_018965
    Natural varianti484 – 4841D → G in NBIA2A. 1 Publication
    VAR_070600
    Natural varianti545 – 5451K → T in NBIA2B. 1 Publication
    VAR_029372
    Natural varianti632 – 6321R → W in NBIA2B. 1 Publication
    VAR_029373
    Natural varianti661 – 6611T → M in NBIA2A. 1 Publication
    VAR_070601
    Natural varianti691 – 6911Missing in NBIA2A. 2 Publications
    VAR_029374
    Natural varianti741 – 7411R → Q in PARK14. 1 Publication
    VAR_062530
    Natural varianti747 – 7471R → W in PARK14. 1 Publication
    VAR_062531
    Natural varianti774 – 7741S → T.
    Corresponds to variant rs34184838 [ dbSNP | Ensembl ].
    VAR_037903

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei71 – 14272Missing in isoform Ankyrin-iPLA2-2. 1 PublicationVSP_000277Add
    BLAST
    Alternative sequencei396 – 45055LVTRK…LNNLE → Q in isoform SH-iPLA2. 2 PublicationsVSP_000278Add
    BLAST
    Alternative sequencei450 – 49950ELQDL…QLLIA → GSHPSQAGWWAWGAVSDGTT GSHAHLTGPEASVHPGLHEG READMQNLSP in isoform Ankyrin-iPLA2-2. 1 PublicationVSP_000279Add
    BLAST
    Alternative sequencei477 – 4793HDH → CRT in isoform Ankyrin-iPLA2-1. 1 PublicationVSP_000281
    Alternative sequencei480 – 806327Missing in isoform Ankyrin-iPLA2-1. 1 PublicationVSP_000282Add
    BLAST
    Alternative sequencei500 – 806307Missing in isoform Ankyrin-iPLA2-2. 1 PublicationVSP_000280Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF064594 mRNA. Translation: AAC97486.1.
    AF102988 mRNA. Translation: AAD41722.1.
    AF102989 mRNA. Translation: AAD41723.1.
    AF117692
    , AF117677, AF117678, AF117679, AF117680, AF117681, AF117682, AF117683, AF117684, AF117685, AF117686, AF117687, AF117688, AF117689, AF117690, AF117691 Genomic DNA. Translation: AAD30424.1.
    AF116267
    , AF116252, AF116253, AF116254, AF116255, AF116256, AF116257, AF116258, AF116259, AF116260, AF116261, AF116262, AF116263, AF116264, AF116265, AF116266 Genomic DNA. Translation: AAF34728.1.
    AL080187 mRNA. Translation: CAB45768.2.
    CR456543 mRNA. Translation: CAG30429.1.
    AY522921 Genomic DNA. Translation: AAR92478.1.
    AK291212 mRNA. Translation: BAF83901.1.
    AL022322 Genomic DNA. Translation: CAA18446.1.
    AL022322 Genomic DNA. Translation: CAQ10446.1.
    CH471095 Genomic DNA. Translation: EAW60219.1.
    CH471095 Genomic DNA. Translation: EAW60220.1.
    BC036742 mRNA. Translation: AAH36742.2.
    BC051904 mRNA. Translation: AAH51904.1.
    CCDSiCCDS13967.1. [O60733-1]
    CCDS33645.1. [O60733-2]
    RefSeqiNP_001004426.1. NM_001004426.1. [O60733-2]
    NP_001186491.1. NM_001199562.1. [O60733-2]
    NP_003551.2. NM_003560.2. [O60733-1]
    XP_005261821.1. XM_005261764.1. [O60733-1]
    XP_005261822.1. XM_005261765.1. [O60733-1]
    XP_005261823.1. XM_005261766.1. [O60733-1]
    XP_006724395.1. XM_006724332.1. [O60733-1]
    UniGeneiHs.170479.

    Genome annotation databases

    EnsembliENST00000332509; ENSP00000333142; ENSG00000184381. [O60733-1]
    ENST00000335539; ENSP00000335149; ENSG00000184381. [O60733-2]
    ENST00000402064; ENSP00000386100; ENSG00000184381. [O60733-2]
    GeneIDi8398.
    KEGGihsa:8398.
    UCSCiuc003auy.1. human. [O60733-1]
    uc003auz.1. human. [O60733-2]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    NIEHS-SNPs

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF064594 mRNA. Translation: AAC97486.1 .
    AF102988 mRNA. Translation: AAD41722.1 .
    AF102989 mRNA. Translation: AAD41723.1 .
    AF117692
    , AF117677 , AF117678 , AF117679 , AF117680 , AF117681 , AF117682 , AF117683 , AF117684 , AF117685 , AF117686 , AF117687 , AF117688 , AF117689 , AF117690 , AF117691 Genomic DNA. Translation: AAD30424.1 .
    AF116267
    , AF116252 , AF116253 , AF116254 , AF116255 , AF116256 , AF116257 , AF116258 , AF116259 , AF116260 , AF116261 , AF116262 , AF116263 , AF116264 , AF116265 , AF116266 Genomic DNA. Translation: AAF34728.1 .
    AL080187 mRNA. Translation: CAB45768.2 .
    CR456543 mRNA. Translation: CAG30429.1 .
    AY522921 Genomic DNA. Translation: AAR92478.1 .
    AK291212 mRNA. Translation: BAF83901.1 .
    AL022322 Genomic DNA. Translation: CAA18446.1 .
    AL022322 Genomic DNA. Translation: CAQ10446.1 .
    CH471095 Genomic DNA. Translation: EAW60219.1 .
    CH471095 Genomic DNA. Translation: EAW60220.1 .
    BC036742 mRNA. Translation: AAH36742.2 .
    BC051904 mRNA. Translation: AAH51904.1 .
    CCDSi CCDS13967.1. [O60733-1 ]
    CCDS33645.1. [O60733-2 ]
    RefSeqi NP_001004426.1. NM_001004426.1. [O60733-2 ]
    NP_001186491.1. NM_001199562.1. [O60733-2 ]
    NP_003551.2. NM_003560.2. [O60733-1 ]
    XP_005261821.1. XM_005261764.1. [O60733-1 ]
    XP_005261822.1. XM_005261765.1. [O60733-1 ]
    XP_005261823.1. XM_005261766.1. [O60733-1 ]
    XP_006724395.1. XM_006724332.1. [O60733-1 ]
    UniGenei Hs.170479.

    3D structure databases

    ProteinModelPortali O60733.
    SMRi O60733. Positions 116-427.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 113986. 2 interactions.
    STRINGi 9606.ENSP00000333142.

    Chemistry

    BindingDBi O60733.
    ChEMBLi CHEMBL3213.
    DrugBanki DB01103. Quinacrine.

    PTM databases

    PhosphoSitei O60733.

    Proteomic databases

    MaxQBi O60733.
    PaxDbi O60733.
    PRIDEi O60733.

    Protocols and materials databases

    DNASUi 8398.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000332509 ; ENSP00000333142 ; ENSG00000184381 . [O60733-1 ]
    ENST00000335539 ; ENSP00000335149 ; ENSG00000184381 . [O60733-2 ]
    ENST00000402064 ; ENSP00000386100 ; ENSG00000184381 . [O60733-2 ]
    GeneIDi 8398.
    KEGGi hsa:8398.
    UCSCi uc003auy.1. human. [O60733-1 ]
    uc003auz.1. human. [O60733-2 ]

    Organism-specific databases

    CTDi 8398.
    GeneCardsi GC22M038507.
    GeneReviewsi PLA2G6.
    HGNCi HGNC:9039. PLA2G6.
    HPAi HPA001171.
    MIMi 256600. phenotype.
    603604. gene.
    610217. phenotype.
    612953. phenotype.
    neXtProti NX_O60733.
    Orphaneti 199351. Adult-onset dystonia-parkinsonism.
    35069. Infantile neuroaxonal dystrophy.
    PharmGKBi PA33367.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0666.
    HOVERGENi HBG053482.
    InParanoidi O60733.
    KOi K16343.
    OMAi PTYFRPN.
    OrthoDBi EOG76T9QK.
    PhylomeDBi O60733.
    TreeFami TF319230.

    Enzyme and pathway databases

    Reactomei REACT_120829. Acyl chain remodelling of PC.
    REACT_121006. Acyl chain remodeling of CL.
    REACT_121369. Acyl chain remodelling of PE.
    REACT_160158. Role of phospholipids in phagocytosis.

    Miscellaneous databases

    ChiTaRSi PLA2G6. human.
    GeneWikii PLA2G6.
    GenomeRNAii 8398.
    NextBioi 31428.
    PMAP-CutDB O60733.
    PROi O60733.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O60733.
    Bgeei O60733.
    CleanExi HS_PLA2G6.
    Genevestigatori O60733.

    Family and domain databases

    Gene3Di 1.25.40.20. 2 hits.
    InterProi IPR016035. Acyl_Trfase/lysoPLipase.
    IPR002110. Ankyrin_rpt.
    IPR020683. Ankyrin_rpt-contain_dom.
    IPR002641. Patatin/PLipase_A2-rel.
    [Graphical view ]
    Pfami PF00023. Ank. 4 hits.
    PF01734. Patatin. 1 hit.
    [Graphical view ]
    PRINTSi PR01415. ANKYRIN.
    SMARTi SM00248. ANK. 6 hits.
    [Graphical view ]
    SUPFAMi SSF48403. SSF48403. 1 hit.
    SSF52151. SSF52151. 1 hit.
    PROSITEi PS50297. ANK_REP_REGION. 1 hit.
    PS50088. ANK_REPEAT. 4 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Multiple splice variants of the human calcium-independent phospholipase A2 and their effect on enzyme activity."
      Larsson P.K.A., Claesson H.-E., Kennedy B.P.
      J. Biol. Chem. 273:207-214(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS LH-IPLA2; ANKYRIN-IPLA2-1 AND ANKYRIN-IPLA2-2).
      Tissue: B-cell and Testis.
    2. "Human pancreatic islets express mRNA species encoding two distinct catalytically active isoforms of group VI phospholipase A2 (iPLA2) that arise from an exon-skipping mechanism of alternative splicing of the transcript from the iPLA2 gene on chromosome 22q13.1."
      Ma Z., Wang X., Nowatzke W., Ramanadham S., Turk J.
      J. Biol. Chem. 274:9607-9616(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS LH-IPLA2 AND SH-IPLA2).
      Tissue: Pancreatic islet.
    3. "The human calcium-independent phospholipase A2 gene. Multiple enzymes with distinct properties from a single gene."
      Larsson Forsell P.K.A., Kennedy B.P., Claesson H.-E.
      Eur. J. Biochem. 262:575-585(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM LH-IPLA2).
      Tissue: Testis.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM LH-IPLA2).
    6. NIEHS SNPs program
      Submitted (JAN-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS ILE-58; GLY-63; GLN-70; ASN-183 AND THR-343.
    7. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM LH-IPLA2).
    8. "The DNA sequence of human chromosome 22."
      Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M.
      , Buck D., Burgess J., Burrill W.D., Burton J., Carder C., Carter N.P., Chen Y., Clark G., Clegg S.M., Cobley V.E., Cole C.G., Collier R.E., Connor R., Conroy D., Corby N.R., Coville G.J., Cox A.V., Davis J., Dawson E., Dhami P.D., Dockree C., Dodsworth S.J., Durbin R.M., Ellington A.G., Evans K.L., Fey J.M., Fleming K., French L., Garner A.A., Gilbert J.G.R., Goward M.E., Grafham D.V., Griffiths M.N.D., Hall C., Hall R.E., Hall-Tamlyn G., Heathcott R.W., Ho S., Holmes S., Hunt S.E., Jones M.C., Kershaw J., Kimberley A.M., King A., Laird G.K., Langford C.F., Leversha M.A., Lloyd C., Lloyd D.M., Martyn I.D., Mashreghi-Mohammadi M., Matthews L.H., Mccann O.T., Mcclay J., Mclaren S., McMurray A.A., Milne S.A., Mortimore B.J., Odell C.N., Pavitt R., Pearce A.V., Pearson D., Phillimore B.J.C.T., Phillips S.H., Plumb R.W., Ramsay H., Ramsey Y., Rogers L., Ross M.T., Scott C.E., Sehra H.K., Skuce C.D., Smalley S., Smith M.L., Soderlund C., Spragon L., Steward C.A., Sulston J.E., Swann R.M., Vaudin M., Wall M., Wallis J.M., Whiteley M.N., Willey D.L., Williams L., Williams S.A., Williamson H., Wilmer T.E., Wilming L., Wright C.L., Hubbard T., Bentley D.R., Beck S., Rogers J., Shimizu N., Minoshima S., Kawasaki K., Sasaki T., Asakawa S., Kudoh J., Shintani A., Shibuya K., Yoshizaki Y., Aoki N., Mitsuyama S., Roe B.A., Chen F., Chu L., Crabtree J., Deschamps S., Do A., Do T., Dorman A., Fang F., Fu Y., Hu P., Hua A., Kenton S., Lai H., Lao H.I., Lewis J., Lewis S., Lin S.-P., Loh P., Malaj E., Nguyen T., Pan H., Phan S., Qi S., Qian Y., Ray L., Ren Q., Shaull S., Sloan D., Song L., Wang Q., Wang Y., Wang Z., White J., Willingham D., Wu H., Yao Z., Zhan M., Zhang G., Chissoe S., Murray J., Miller N., Minx P., Fulton R., Johnson D., Bemis G., Bentley D., Bradshaw H., Bourne S., Cordes M., Du Z., Fulton L., Goela D., Graves T., Hawkins J., Hinds K., Kemp K., Latreille P., Layman D., Ozersky P., Rohlfing T., Scheet P., Walker C., Wamsley A., Wohldmann P., Pepin K., Nelson J., Korf I., Bedell J.A., Hillier L.W., Mardis E., Waterston R., Wilson R., Emanuel B.S., Shaikh T., Kurahashi H., Saitta S., Budarf M.L., McDermid H.E., Johnson A., Wong A.C.C., Morrow B.E., Edelmann L., Kim U.J., Shizuya H., Simon M.I., Dumanski J.P., Peyrard M., Kedra D., Seroussi E., Fransson I., Tapia I., Bruder C.E., O'Brien K.P., Wilkinson P., Bodenteich A., Hartman K., Hu X., Khan A.S., Lane L., Tilahun Y., Wright H.
      Nature 402:489-495(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS LH-IPLA2 AND SH-IPLA2).
      Tissue: Brain.
    11. "iPLA2beta: front and center in human monocyte chemotaxis to MCP-1."
      Mishra R.S., Carnevale K.A., Cathcart M.K.
      J. Exp. Med. 205:347-359(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION IN CHEMOTAXIS, SUBCELLULAR LOCATION.
    12. "Mammalian patatin domain containing proteins: a family with diverse lipolytic activities involved in multiple biological functions."
      Kienesberger P.C., Oberer M., Lass A., Zechner R.
      J. Lipid Res. 50:S63-S68(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: REVIEW ON FAMILY.
    13. "Role of calcium-independent phospholipase A2 in the pathogenesis of Barth syndrome."
      Malhotra A., Edelman-Novemsky I., Xu Y., Plesken H., Ma J., Schlame M., Ren M.
      Proc. Natl. Acad. Sci. U.S.A. 106:2337-2341(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, PHARMACEUTICAL USE.
    14. Cited for: VARIANT NBIA2A VAL-691 DEL.
    15. Cited for: VARIANTS NBIA2B THR-545 AND TRP-632, VARIANTS NBIA2A GLU-310 AND VAL-691 DEL.
    16. Cited for: VARIANTS PARK14 GLN-741 AND TRP-747.
    17. "Recessive truncating NALCN mutation in infantile neuroaxonal dystrophy with facial dysmorphism."
      Koeroglu C., Seven M., Tolun A.
      J. Med. Genet. 50:515-520(2013) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS NBIA2A GLY-484 AND MET-661.

    Entry informationi

    Entry nameiPLPL9_HUMAN
    AccessioniPrimary (citable) accession number: O60733
    Secondary accession number(s): A8K597
    , B0QYE8, O75645, Q8N452, Q9UG29, Q9UIT0, Q9Y671
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 30, 2000
    Last sequence update: May 30, 2000
    Last modified: October 1, 2014
    This is version 146 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Pharmaceutical, Reference proteome

    Documents

    1. Human chromosome 22
      Human chromosome 22: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3