O60733 (PA2G6_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 117.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: 85 kDa calcium-independent phospholipase A2 Short name=CaI-PLA2 Short name=iPLA2 EC=3.1.1.4 Alternative name(s): Group VI phospholipase A2 Short name=GVI PLA2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 806 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Catalyzes the release of fatty acids from phospholipids. It has been implicated in normal phospholipid remodeling, nitric oxide-induced or vasopressin-induced arachidonic acid release and in leukotriene and prostaglandin production. May participate in fas mediated apoptosis and in regulating transmembrane ion flux in glucose-stimulated B-cells. Has a role in cardiolipin (CL) deacylation. Ref.11 Isoform ankyrin-iPLA2-1 and isoform ankyrin-iPLA2-2, which lack the catalytic domain, are probably involved in the negative regulation of iPLA2 activity. Ref.11 |
| Catalytic activity | Phosphatidylcholine + H2O = 1-acylglycerophosphocholine + a carboxylate. |
| Subunit structure | Forms large oligomeric 270-350 kDa structures. |
| Subcellular location | Isoform LH-iPLA2: Membrane; Peripheral membrane protein. |
| Tissue specificity | Four different transcripts were found to be expressed in a distinct tissue distribution. |
| Involvement in disease | Defects in PLA2G6 are the cause of neurodegeneration with brain iron accumulation type 2B (NBIA2B) [MIM:610217]. A neurodegenerative disorder associated with iron accumulation in the brain, primarily in the basal ganglia. It is characterized by progressive extrapyramidal dysfunction leading to rigidity, dystonia, dysarthria and sensorimotor impairment. Ref.13 Defects in PLA2G6 are the cause of neurodegeneration with brain iron accumulation type 2A (NBIA2A) [MIM:256600]; also known as Seitelberger disease. NBIA2A is a neurodegenerative disease characterized by pathologic axonal swelling and spheroid bodies in the central nervous system. Onset is within the first 2 years of life with death by age 10 years. Defects in PLA2G6 are the cause of Parkinson disease type 14 (PARK14) [MIM:612953]. An adult-onset progressive neurodegenerative disorder characterized by parkinsonism, dystonia, severe cognitive decline, cerebral and cerebellar atrophy and absent iron in the basal ganglia on magnetic resonance imaging. Ref.15 |
| Pharmaceutical use | Potential target for therapeutic intervention of Barth syndrome. |
| Sequence similarities | Contains 7 ANK repeats. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Lipid degradation |
| Cellular component | Cytoplasm Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Disease mutation Dystonia Neurodegeneration Parkinsonism |
| Domain | ANK repeat Repeat |
| Molecular function | Hydrolase |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Pharmaceutical Reference proteome |
| Gene Ontology (GO) | |
| Biological process | cardiolipin biosynthetic process Inferred from mutant phenotype Ref.11. Source: UniProtKB cell deathInferred from electronic annotation. Source: UniProtKB-KW lipid catabolic processInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | centrosome Inferred from direct assay. Source: HPA membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform LH-iPLA2 (identifier: O60733-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform SH-iPLA2 (identifier: O60733-2) The sequence of this isoform differs from the canonical sequence as follows: 396-450: LVTRKAILTLLRTVGAEYCFPPIHGVPAEQGSAAPHHPFSLERAQPPPISLNNLE → Q | ||||||
| Isoform Ankyrin-iPLA2-1 (identifier: O60733-3) The sequence of this isoform differs from the canonical sequence as follows: 477-479: HDH → CRT 480-806: Missing. | ||||||
| Isoform Ankyrin-iPLA2-2 (identifier: O60733-4) The sequence of this isoform differs from the canonical sequence as follows: 71-142: Missing. 450-499: ELQDLMHISR...GLIIIQLLIA → GSHPSQAGWW...READMQNLSP 500-806: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 806 | 806 | 85 kDa calcium-independent phospholipase A2 | PRO_0000067037 | |||||
Regions | |||||||||
| Repeat | 151 – 181 | 31 | ANK 1 | ||||||
| Repeat | 185 – 215 | 31 | ANK 2 | ||||||
| Repeat | 219 – 248 | 30 | ANK 3 | ||||||
| Repeat | 251 – 281 | 31 | ANK 4 | ||||||
| Repeat | 286 – 312 | 27 | ANK 5 | ||||||
| Repeat | 316 – 345 | 30 | ANK 6 | ||||||
| Repeat | 349 – 378 | 30 | ANK 7 | ||||||
Sites | |||||||||
| Active site | 519 | 1 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 587 | 1 | Phosphothreonine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 71 – 142 | 72 | Missing in isoform Ankyrin-iPLA2-2. | VSP_000277 | |||||
| Alternative sequence | 396 – 450 | 55 | LVTRK…LNNLE → Q in isoform SH-iPLA2. | VSP_000278 | |||||
| Alternative sequence | 450 – 499 | 50 | ELQDL…QLLIA → GSHPSQAGWWAWGAVSDGTT GSHAHLTGPEASVHPGLHEG READMQNLSP in isoform Ankyrin-iPLA2-2. | VSP_000279 | |||||
| Alternative sequence | 477 – 479 | 3 | HDH → CRT in isoform Ankyrin-iPLA2-1. | VSP_000281 | |||||
| Alternative sequence | 480 – 806 | 327 | Missing in isoform Ankyrin-iPLA2-1. | VSP_000282 | |||||
| Alternative sequence | 500 – 806 | 307 | Missing in isoform Ankyrin-iPLA2-2. | VSP_000280 | |||||
| Natural variant | 58 | 1 | V → I. Ref.6 Corresponds to variant rs11570605 [ dbSNP | Ensembl ]. | VAR_018961 | |||||
| Natural variant | 63 | 1 | R → G. Ref.6 Corresponds to variant rs11570606 [ dbSNP | Ensembl ]. | VAR_018962 | |||||
| Natural variant | 70 | 1 | R → Q. Ref.6 Corresponds to variant rs11570607 [ dbSNP | Ensembl ]. | VAR_018963 | |||||
| Natural variant | 183 | 1 | D → N. Ref.6 Corresponds to variant rs11570646 [ dbSNP | Ensembl ]. | VAR_018964 | |||||
| Natural variant | 310 | 1 | V → E in NBIA2A. Ref.13 | VAR_029371 | |||||
| Natural variant | 343 | 1 | A → T. Ref.6 Corresponds to variant rs11570680 [ dbSNP | Ensembl ]. | VAR_018965 | |||||
| Natural variant | 545 | 1 | K → T in NBIA2B. Ref.13 | VAR_029372 | |||||
| Natural variant | 632 | 1 | R → W in NBIA2B. Ref.13 | VAR_029373 | |||||
| Natural variant | 691 | 1 | Missing in NBIA2A. | VAR_029374 | |||||
| Natural variant | 741 | 1 | R → Q in PARK14. Ref.15 | VAR_062530 | |||||
| Natural variant | 747 | 1 | R → W in PARK14. Ref.15 | VAR_062531 | |||||
| Natural variant | 774 | 1 | S → T. Corresponds to variant rs34184838 [ dbSNP | Ensembl ]. | VAR_037903 | |||||
Experimental info | |||||||||
| Sequence conflict | 11 | 1 | F → S in AAD30424. Ref.3 | ||||||
| Sequence conflict | 64 | 1 | N → D in AAD41722. Ref.2 | ||||||
| Sequence conflict | 64 | 1 | N → D in AAD41723. Ref.2 | ||||||
| Sequence conflict | 579 | 1 | K → I in AAD30424. Ref.3 | ||||||
| Sequence conflict | 686 | 1 | K → I in AAD30424. Ref.3 | ||||||
| Sequence conflict | 801 | 1 | Q → H in AAC97486. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Multiple splice variants of the human calcium-independent phospholipase A2 and their effect on enzyme activity." Larsson P.K.A., Claesson H.-E., Kennedy B.P. J. Biol. Chem. 273:207-214(1998) [PubMed: 9417066] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS LH-IPLA2; ANKYRIN-IPLA2-1 AND ANKYRIN-IPLA2-2). Tissue: B-cell and Testis. |
| [2] | "Human pancreatic islets express mRNA species encoding two distinct catalytically active isoforms of group VI phospholipase A2 (iPLA2) that arise from an exon-skipping mechanism of alternative splicing of the transcript from the iPLA2 gene on chromosome 22q13.1." Ma Z., Wang X., Nowatzke W., Ramanadham S., Turk J. J. Biol. Chem. 274:9607-9616(1999) [PubMed: 10092647] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS LH-IPLA2 AND SH-IPLA2). Tissue: Pancreatic islet. |
| [3] | "The human calcium-independent phospholipase A2 gene. Multiple enzymes with distinct properties from a single gene." Larsson Forsell P.K.A., Kennedy B.P., Claesson H.-E. Eur. J. Biochem. 262:575-585(1999) [PubMed: 10336645] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING. |
| [4] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM LH-IPLA2). Tissue: Testis. |
| [5] | "A genome annotation-driven approach to cloning the human ORFeome." Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A., Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J., Beare D.M., Dunham I. Genome Biol. 5:R84.1-R84.11(2004) [PubMed: 15461802] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM LH-IPLA2). |
| [6] | NIEHS SNPs program Submitted (JAN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS ILE-58; GLY-63; GLN-70; ASN-183 AND THR-343. |
| [7] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM LH-IPLA2). |
| [8] | "The DNA sequence of human chromosome 22." Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M. Wright H.Nature 402:489-495(1999) [PubMed: 10591208] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [10] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS LH-IPLA2 AND SH-IPLA2). Tissue: Brain. |
| [11] | "Role of calcium-independent phospholipase A2 in the pathogenesis of Barth syndrome." Malhotra A., Edelman-Novemsky I., Xu Y., Plesken H., Ma J., Schlame M., Ren M. Proc. Natl. Acad. Sci. U.S.A. 106:2337-2341(2009) [PubMed: 19164547] [Abstract] Cited for: FUNCTION, PHARMACEUTICAL USE. |
| [12] | "PLA2G6 mutation underlies infantile neuroaxonal dystrophy." Khateeb S., Flusser H., Ofir R., Shelef I., Narkis G., Vardi G., Shorer Z., Levy R., Galil A., Elbedour K., Birk O.S. Am. J. Hum. Genet. 79:942-948(2006) [PubMed: 17033970] [Abstract] Cited for: VARIANT NBIA2A VAL-691 DEL. |
| [13] | "PLA2G6, encoding a phospholipase A2, is mutated in neurodegenerative disorders with high brain iron." Morgan N.V., Westaway S.K., Morton J.E., Gregory A., Gissen P., Sonek S., Cangul H., Coryell J., Canham N., Nardocci N., Zorzi G., Pasha S., Rodriguez D., Desguerre I., Mubaidin A., Bertini E., Trembath R.C., Simonati A. Hayflick S.J.Nat. Genet. 38:752-754(2006) [PubMed: 16783378] [Abstract] Cited for: VARIANTS NBIA2B THR-545 AND TRP-632, VARIANTS NBIA2A GLU-310 AND VAL-691 DEL. |
| [14] | Erratum Morgan N.V., Westaway S.K., Morton J.E., Gregory A., Gissen P., Sonek S., Cangul H., Coryell J., Canham N., Nardocci N., Zorzi G., Pasha S., Rodriguez D., Desguerre I., Mubaidin A., Bertini E., Trembath R.C., Simonati A. Hayflick S.J.Nat. Genet. 38:957-957(2006) |
| [15] | "Characterization of PLA2G6 as a locus for dystonia-parkinsonism." Paisan-Ruiz C., Bhatia K.P., Li A., Hernandez D., Davis M., Wood N.W., Hardy J., Houlden H., Singleton A., Schneider S.A. Ann. Neurol. 65:19-23(2009) [PubMed: 18570303] [Abstract] Cited for: VARIANTS PARK14 GLN-741 AND TRP-747. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF064594 mRNA. Translation: AAC97486.1. AF102988 mRNA. Translation: AAD41722.1. AF102989 mRNA. Translation: AAD41723.1. AF117692 AF117691 Genomic DNA. Translation: AAD30424.1.AF116267 AF116266 Genomic DNA. Translation: AAF34728.1.AL080187 mRNA. Translation: CAB45768.2. CR456543 mRNA. Translation: CAG30429.1. AY522921 Genomic DNA. Translation: AAR92478.1. AK291212 mRNA. Translation: BAF83901.1. AL022322 Genomic DNA. Translation: CAA18446.1. AL022322 Genomic DNA. Translation: CAQ10446.1. CH471095 Genomic DNA. Translation: EAW60219.1. CH471095 Genomic DNA. Translation: EAW60220.1. BC036742 mRNA. Translation: AAH36742.2. BC051904 mRNA. Translation: AAH51904.1. |
| IPI | IPI00031476. IPI00220207. IPI00220209. IPI00375455. |
| RefSeq | NP_001004426.1. NM_001004426.1. NP_001186491.1. NM_001199562.1. NP_003551.2. NM_003560.2. |
| UniGene | Hs.170479. |
3D structure databases | |
| ProteinModelPortal | O60733. |
| SMR | O60733. Positions 116-418. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | O60733. |
PTM databases | |
| PhosphoSite | O60733. |
Proteomic databases | |
| PRIDE | O60733. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000332509; ENSP00000333142; ENSG00000184381. |
| GeneID | 8398. |
| KEGG | hsa:8398. |
| UCSC | uc003auy.1. human. uc003auz.1. human. |
Organism-specific databases | |
| CTD | 8398. |
| GeneCards | GC22M038507. |
| H-InvDB | HIX0016464. |
| HGNC | HGNC:9039. PLA2G6. |
| HPA | HPA001171. |
| MIM | 256600. phenotype. 603604. gene. 610217. phenotype. 612953. phenotype. |
| neXtProt | NX_O60733. |
| Orphanet | 199351. Dystonia-parkinsonism, Paisan-Ruiz type. 35069. Infantile neuroaxonal dystrophy. |
| PharmGKB | PA33367. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG11587. |
| GeneTree | ENSGT00530000063645. |
| HOGENOM | HBG314710. |
| HOVERGEN | HBG053482. |
| InParanoid | O60733. |
| OMA | QLETEAD. |
| OrthoDB | EOG46Q6RW. |
| PhylomeDB | O60733. |
Gene expression databases | |
| ArrayExpress | O60733. |
| Bgee | O60733. |
| CleanEx | HS_PLA2G6. |
| Genevestigator | O60733. |
| GermOnline | ENSG00000184381. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR016035. Acyl_Trfase/lysoPLipase. IPR002110. Ankyrin_rpt. IPR020683. Ankyrin_rpt-contain_dom. IPR002641. Patatin/PLipase_A2-rel. [Graphical view] |
| Gene3D | G3DSA:1.25.40.20. ANK. 3 hits. |
| KO | K01047. |
| Pfam | PF00023. Ank. 3 hits. PF01734. Patatin. 1 hit. [Graphical view] |
| PRINTS | PR01415. ANKYRIN. |
| SMART | SM00248. ANK. 6 hits. [Graphical view] |
| SUPFAM | SSF52151. Acyl_Trfase/lysoPlipase. 1 hit. SSF48403. ANK. 1 hit. |
| PROSITE | PS50297. ANK_REP_REGION. 1 hit. PS50088. ANK_REPEAT. 4 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| DrugBank | DB01103. Quinacrine. |
| NextBio | 31428. |
| PMAP-CutDB | O60733. |
| SOURCE | Search... |
Entry information
| Entry name | PA2G6_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O60733 Secondary accession number(s): A8K597 Q9Y671 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 22 Human chromosome 22: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with