SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O60733

- PLPL9_HUMAN

UniProt

O60733 - PLPL9_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

85/88 kDa calcium-independent phospholipase A2

Gene
PLA2G6, PLPLA9
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Catalyzes the release of fatty acids from phospholipids. It has been implicated in normal phospholipid remodeling, nitric oxide-induced or vasopressin-induced arachidonic acid release and in leukotriene and prostaglandin production. May participate in fas mediated apoptosis and in regulating transmembrane ion flux in glucose-stimulated B-cells. Has a role in cardiolipin (CL) deacylation. Required for both speed and directionality of monocyte MCP1/CCL2-induced chemotaxis through regulation of F-actin polymerization at the pseudopods.2 Publications
Isoform ankyrin-iPLA2-1 and isoform ankyrin-iPLA2-2, which lack the catalytic domain, are probably involved in the negative regulation of iPLA2 activity.2 Publications

Catalytic activityi

Phosphatidylcholine + H2O = 1-acylglycerophosphocholine + a carboxylate.

Enzyme regulationi

Inhibited by calcium-activated calmodulin By similarity.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei519 – 5191 Reviewed prediction

GO - Molecular functioni

  1. calcium-independent phospholipase A2 activity Source: Ensembl
  2. phospholipase A2 activity Source: ProtInc

GO - Biological processi

  1. cardiolipin acyl-chain remodeling Source: Reactome
  2. cardiolipin biosynthetic process Source: UniProtKB
  3. cell death Source: UniProtKB-KW
  4. chemotaxis Source: UniProtKB-KW
  5. Fc-gamma receptor signaling pathway involved in phagocytosis Source: Reactome
  6. glycerophospholipid biosynthetic process Source: Reactome
  7. innate immune response Source: Reactome
  8. lipid catabolic process Source: UniProtKB-KW
  9. maternal process involved in female pregnancy Source: Ensembl
  10. memory Source: Ensembl
  11. negative regulation of synaptic transmission, glutamatergic Source: Ensembl
  12. phosphatidylcholine acyl-chain remodeling Source: Reactome
  13. phosphatidylethanolamine acyl-chain remodeling Source: Reactome
  14. phospholipid metabolic process Source: Reactome
  15. positive regulation of arachidonic acid secretion Source: Ensembl
  16. positive regulation of ceramide biosynthetic process Source: Ensembl
  17. positive regulation of cytosolic calcium ion concentration Source: Ensembl
  18. positive regulation of exocytosis Source: Ensembl
  19. positive regulation of insulin secretion involved in cellular response to glucose stimulus Source: Ensembl
  20. positive regulation of protein kinase C signaling Source: Ensembl
  21. positive regulation of protein phosphorylation Source: Ensembl
  22. positive regulation of release of cytochrome c from mitochondria Source: Ensembl
  23. positive regulation of vasodilation Source: Ensembl
  24. regulation of store-operated calcium channel activity Source: Ensembl
  25. response to endoplasmic reticulum stress Source: Ensembl
  26. small molecule metabolic process Source: Reactome
  27. urinary bladder smooth muscle contraction Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Biological processi

Chemotaxis, Lipid degradation, Lipid metabolism

Keywords - Ligandi

Calmodulin-binding

Enzyme and pathway databases

ReactomeiREACT_120829. Acyl chain remodelling of PC.
REACT_121006. Acyl chain remodeling of CL.
REACT_121369. Acyl chain remodelling of PE.
REACT_160158. Role of phospholipids in phagocytosis.

Names & Taxonomyi

Protein namesi
Recommended name:
85/88 kDa calcium-independent phospholipase A2 (EC:3.1.1.4)
Short name:
CaI-PLA2
Alternative name(s):
Group VI phospholipase A2
Short name:
GVI PLA2
Intracellular membrane-associated calcium-independent phospholipase A2 beta
Short name:
iPLA2-beta
Patatin-like phospholipase domain-containing protein 9
Short name:
PNPLA9
Gene namesi
Name:PLA2G6
Synonyms:PLPLA9
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 22

Organism-specific databases

HGNCiHGNC:9039. PLA2G6.

Subcellular locationi

Isoform LH-iPLA2 : Membrane; Peripheral membrane protein
Note: Recruited to the membrane-enriched pseudopod upon MCP1/CCL2 stimulation in monocytes.1 Publication
Isoform SH-iPLA2 : Cytoplasm 1 Publication

GO - Cellular componenti

  1. cytosol Source: Reactome
  2. membrane Source: UniProtKB-SubCell
  3. mitochondrion Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Membrane

Pathology & Biotechi

Involvement in diseasei

Neurodegeneration with brain iron accumulation 2B (NBIA2B) [MIM:610217]: A neurodegenerative disorder associated with iron accumulation in the brain, primarily in the basal ganglia. It is characterized by progressive extrapyramidal dysfunction leading to rigidity, dystonia, dysarthria and sensorimotor impairment.
Note: The disease is caused by mutations affecting the gene represented in this entry.1 Publication
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti545 – 5451K → T in NBIA2B. 1 Publication
VAR_029372
Natural varianti632 – 6321R → W in NBIA2B. 1 Publication
VAR_029373
Neurodegeneration with brain iron accumulation 2A (NBIA2A) [MIM:256600]: A neurodegenerative disease characterized by pathologic axonal swelling and spheroid bodies in the central nervous system. Onset is within the first 2 years of life with death by age 10 years.
Note: The disease is caused by mutations affecting the gene represented in this entry.3 Publications
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti310 – 3101V → E in NBIA2A. 1 Publication
VAR_029371
Natural varianti484 – 4841D → G in NBIA2A. 1 Publication
VAR_070600
Natural varianti661 – 6611T → M in NBIA2A. 1 Publication
VAR_070601
Natural varianti691 – 6911Missing in NBIA2A. 2 Publications
VAR_029374
Parkinson disease 14 (PARK14) [MIM:612953]: An adult-onset progressive neurodegenerative disorder characterized by parkinsonism, dystonia, severe cognitive decline, cerebral and cerebellar atrophy and absent iron in the basal ganglia on magnetic resonance imaging.
Note: The disease is caused by mutations affecting the gene represented in this entry.1 Publication
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti741 – 7411R → Q in PARK14. 1 Publication
VAR_062530
Natural varianti747 – 7471R → W in PARK14. 1 Publication
VAR_062531

Pharmaceutical usei

Potential target for therapeutic intervention of Barth syndrome.

Keywords - Diseasei

Disease mutation, Dystonia, Neurodegeneration, Parkinsonism

Organism-specific databases

MIMi256600. phenotype.
610217. phenotype.
612953. phenotype.
Orphaneti199351. Adult-onset dystonia-parkinsonism.
35069. Infantile neuroaxonal dystrophy.
PharmGKBiPA33367.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 80680685/88 kDa calcium-independent phospholipase A2PRO_0000067037Add
BLAST

Proteomic databases

MaxQBiO60733.
PaxDbiO60733.
PRIDEiO60733.

PTM databases

PhosphoSiteiO60733.

Miscellaneous databases

PMAP-CutDBO60733.

Expressioni

Tissue specificityi

Four different transcripts were found to be expressed in a distinct tissue distribution.

Gene expression databases

ArrayExpressiO60733.
BgeeiO60733.
CleanExiHS_PLA2G6.
GenevestigatoriO60733.

Organism-specific databases

HPAiHPA001171.

Interactioni

Subunit structurei

Forms large oligomeric 270-350 kDa structures.

Protein-protein interaction databases

BioGridi113986. 2 interactions.
STRINGi9606.ENSP00000333142.

Structurei

3D structure databases

ProteinModelPortaliO60733.
SMRiO60733. Positions 116-427.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati151 – 18131ANK 1Add
BLAST
Repeati185 – 21531ANK 2Add
BLAST
Repeati219 – 24830ANK 3Add
BLAST
Repeati251 – 28131ANK 4Add
BLAST
Repeati286 – 31227ANK 5Add
BLAST
Repeati316 – 34530ANK 6Add
BLAST
Repeati349 – 37830ANK 7Add
BLAST
Domaini481 – 665185PatatinAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni677 – 69620Calmodulin-binding By similarityAdd
BLAST
Regioni748 – 75912Calmodulin-binding By similarityAdd
BLAST

Sequence similaritiesi

Contains 7 ANK repeats.
Contains 1 patatin domain.

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

eggNOGiCOG0666.
HOVERGENiHBG053482.
InParanoidiO60733.
KOiK16343.
OMAiPTYFRPN.
OrthoDBiEOG76T9QK.
PhylomeDBiO60733.
TreeFamiTF319230.

Family and domain databases

Gene3Di1.25.40.20. 2 hits.
InterProiIPR016035. Acyl_Trfase/lysoPLipase.
IPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR002641. Patatin/PLipase_A2-rel.
[Graphical view]
PfamiPF00023. Ank. 4 hits.
PF01734. Patatin. 1 hit.
[Graphical view]
PRINTSiPR01415. ANKYRIN.
SMARTiSM00248. ANK. 6 hits.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 1 hit.
SSF52151. SSF52151. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 4 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform LH-iPLA2 (identifier: O60733-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MQFFGRLVNT FSGVTNLFSN PFRVKEVAVA DYTSSDRVRE EGQLILFQNT    50
PNRTWDCVLV NPRNSQSGFR LFQLELEADA LVNFHQYSSQ LLPFYESSPQ 100
VLHTEVLQHL TDLIRNHPSW SVAHLAVELG IRECFHHSRI ISCANCAENE 150
EGCTPLHLAC RKGDGEILVE LVQYCHTQMD VTDYKGETVF HYAVQGDNSQ 200
VLQLLGRNAV AGLNQVNNQG LTPLHLACQL GKQEMVRVLL LCNARCNIMG 250
PNGYPIHSAM KFSQKGCAEM IISMDSSQIH SKDPRYGASP LHWAKNAEMA 300
RMLLKRGCNV NSTSSAGNTA LHVAVMRNRF DCAIVLLTHG ANADARGEHG 350
NTPLHLAMSK DNVEMIKALI VFGAEVDTPN DFGETPTFLA SKIGRLVTRK 400
AILTLLRTVG AEYCFPPIHG VPAEQGSAAP HHPFSLERAQ PPPISLNNLE 450
LQDLMHISRA RKPAFILGSM RDEKRTHDHL LCLDGGGVKG LIIIQLLIAI 500
EKASGVATKD LFDWVAGTST GGILALAILH SKSMAYMRGM YFRMKDEVFR 550
GSRPYESGPL EEFLKREFGE HTKMTDVRKP KVMLTGTLSD RQPAELHLFR 600
NYDAPETVRE PRFNQNVNLR PPAQPSDQLV WRAARSSGAA PTYFRPNGRF 650
LDGGLLANNP TLDAMTEIHE YNQDLIRKGQ ANKVKKLSIV VSLGTGRSPQ 700
VPVTCVDVFR PSNPWELAKT VFGAKELGKM VVDCCTDPDG RAVDRARAWC 750
EMVGIQYFRL NPQLGTDIML DEVSDTVLVN ALWETEVYIY EHREEFQKLI 800
QLLLSP 806
Length:806
Mass (Da):89,903
Last modified:May 30, 2000 - v2
Checksum:i8E55CD4EB9ACAD8B
GO
Isoform SH-iPLA2 (identifier: O60733-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     396-450: LVTRKAILTLLRTVGAEYCFPPIHGVPAEQGSAAPHHPFSLERAQPPPISLNNLE → Q

Show »
Length:752
Mass (Da):84,093
Checksum:iF1C46C9380332E1D
GO
Isoform Ankyrin-iPLA2-1 (identifier: O60733-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     477-479: HDH → CRT
     480-806: Missing.

Show »
Length:479
Mass (Da):53,216
Checksum:i2C849808049DD065
GO
Isoform Ankyrin-iPLA2-2 (identifier: O60733-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     71-142: Missing.
     450-499: ELQDLMHISR...GLIIIQLLIA → GSHPSQAGWW...READMQNLSP
     500-806: Missing.

Show »
Length:427
Mass (Da):46,484
Checksum:i52DAEBA2EDDC4C31
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti58 – 581V → I.1 Publication
Corresponds to variant rs11570605 [ dbSNP | Ensembl ].
VAR_018961
Natural varianti63 – 631R → G.1 Publication
Corresponds to variant rs11570606 [ dbSNP | Ensembl ].
VAR_018962
Natural varianti70 – 701R → Q.1 Publication
Corresponds to variant rs11570607 [ dbSNP | Ensembl ].
VAR_018963
Natural varianti183 – 1831D → N.1 Publication
Corresponds to variant rs11570646 [ dbSNP | Ensembl ].
VAR_018964
Natural varianti310 – 3101V → E in NBIA2A. 1 Publication
VAR_029371
Natural varianti343 – 3431A → T.1 Publication
Corresponds to variant rs11570680 [ dbSNP | Ensembl ].
VAR_018965
Natural varianti484 – 4841D → G in NBIA2A. 1 Publication
VAR_070600
Natural varianti545 – 5451K → T in NBIA2B. 1 Publication
VAR_029372
Natural varianti632 – 6321R → W in NBIA2B. 1 Publication
VAR_029373
Natural varianti661 – 6611T → M in NBIA2A. 1 Publication
VAR_070601
Natural varianti691 – 6911Missing in NBIA2A. 2 Publications
VAR_029374
Natural varianti741 – 7411R → Q in PARK14. 1 Publication
VAR_062530
Natural varianti747 – 7471R → W in PARK14. 1 Publication
VAR_062531
Natural varianti774 – 7741S → T.
Corresponds to variant rs34184838 [ dbSNP | Ensembl ].
VAR_037903

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei71 – 14272Missing in isoform Ankyrin-iPLA2-2. VSP_000277Add
BLAST
Alternative sequencei396 – 45055LVTRK…LNNLE → Q in isoform SH-iPLA2. VSP_000278Add
BLAST
Alternative sequencei450 – 49950ELQDL…QLLIA → GSHPSQAGWWAWGAVSDGTT GSHAHLTGPEASVHPGLHEG READMQNLSP in isoform Ankyrin-iPLA2-2. VSP_000279Add
BLAST
Alternative sequencei477 – 4793HDH → CRT in isoform Ankyrin-iPLA2-1. VSP_000281
Alternative sequencei480 – 806327Missing in isoform Ankyrin-iPLA2-1. VSP_000282Add
BLAST
Alternative sequencei500 – 806307Missing in isoform Ankyrin-iPLA2-2. VSP_000280Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti11 – 111F → S in AAD30424. 1 Publication
Sequence conflicti64 – 641N → D in AAD41722. 1 Publication
Sequence conflicti64 – 641N → D in AAD41723. 1 Publication
Sequence conflicti579 – 5791K → I in AAD30424. 1 Publication
Sequence conflicti686 – 6861K → I in AAD30424. 1 Publication
Sequence conflicti801 – 8011Q → H in AAC97486. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF064594 mRNA. Translation: AAC97486.1.
AF102988 mRNA. Translation: AAD41722.1.
AF102989 mRNA. Translation: AAD41723.1.
AF117692
, AF117677, AF117678, AF117679, AF117680, AF117681, AF117682, AF117683, AF117684, AF117685, AF117686, AF117687, AF117688, AF117689, AF117690, AF117691 Genomic DNA. Translation: AAD30424.1.
AF116267
, AF116252, AF116253, AF116254, AF116255, AF116256, AF116257, AF116258, AF116259, AF116260, AF116261, AF116262, AF116263, AF116264, AF116265, AF116266 Genomic DNA. Translation: AAF34728.1.
AL080187 mRNA. Translation: CAB45768.2.
CR456543 mRNA. Translation: CAG30429.1.
AY522921 Genomic DNA. Translation: AAR92478.1.
AK291212 mRNA. Translation: BAF83901.1.
AL022322 Genomic DNA. Translation: CAA18446.1.
AL022322 Genomic DNA. Translation: CAQ10446.1.
CH471095 Genomic DNA. Translation: EAW60219.1.
CH471095 Genomic DNA. Translation: EAW60220.1.
BC036742 mRNA. Translation: AAH36742.2.
BC051904 mRNA. Translation: AAH51904.1.
CCDSiCCDS13967.1. [O60733-1]
CCDS33645.1. [O60733-2]
RefSeqiNP_001004426.1. NM_001004426.1. [O60733-2]
NP_001186491.1. NM_001199562.1. [O60733-2]
NP_003551.2. NM_003560.2. [O60733-1]
XP_005261821.1. XM_005261764.1. [O60733-1]
XP_005261822.1. XM_005261765.1. [O60733-1]
XP_005261823.1. XM_005261766.1. [O60733-1]
XP_006724395.1. XM_006724332.1. [O60733-1]
UniGeneiHs.170479.

Genome annotation databases

EnsembliENST00000332509; ENSP00000333142; ENSG00000184381. [O60733-1]
ENST00000335539; ENSP00000335149; ENSG00000184381. [O60733-2]
ENST00000402064; ENSP00000386100; ENSG00000184381. [O60733-2]
GeneIDi8398.
KEGGihsa:8398.
UCSCiuc003auy.1. human. [O60733-1]
uc003auz.1. human. [O60733-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF064594 mRNA. Translation: AAC97486.1 .
AF102988 mRNA. Translation: AAD41722.1 .
AF102989 mRNA. Translation: AAD41723.1 .
AF117692
, AF117677 , AF117678 , AF117679 , AF117680 , AF117681 , AF117682 , AF117683 , AF117684 , AF117685 , AF117686 , AF117687 , AF117688 , AF117689 , AF117690 , AF117691 Genomic DNA. Translation: AAD30424.1 .
AF116267
, AF116252 , AF116253 , AF116254 , AF116255 , AF116256 , AF116257 , AF116258 , AF116259 , AF116260 , AF116261 , AF116262 , AF116263 , AF116264 , AF116265 , AF116266 Genomic DNA. Translation: AAF34728.1 .
AL080187 mRNA. Translation: CAB45768.2 .
CR456543 mRNA. Translation: CAG30429.1 .
AY522921 Genomic DNA. Translation: AAR92478.1 .
AK291212 mRNA. Translation: BAF83901.1 .
AL022322 Genomic DNA. Translation: CAA18446.1 .
AL022322 Genomic DNA. Translation: CAQ10446.1 .
CH471095 Genomic DNA. Translation: EAW60219.1 .
CH471095 Genomic DNA. Translation: EAW60220.1 .
BC036742 mRNA. Translation: AAH36742.2 .
BC051904 mRNA. Translation: AAH51904.1 .
CCDSi CCDS13967.1. [O60733-1 ]
CCDS33645.1. [O60733-2 ]
RefSeqi NP_001004426.1. NM_001004426.1. [O60733-2 ]
NP_001186491.1. NM_001199562.1. [O60733-2 ]
NP_003551.2. NM_003560.2. [O60733-1 ]
XP_005261821.1. XM_005261764.1. [O60733-1 ]
XP_005261822.1. XM_005261765.1. [O60733-1 ]
XP_005261823.1. XM_005261766.1. [O60733-1 ]
XP_006724395.1. XM_006724332.1. [O60733-1 ]
UniGenei Hs.170479.

3D structure databases

ProteinModelPortali O60733.
SMRi O60733. Positions 116-427.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 113986. 2 interactions.
STRINGi 9606.ENSP00000333142.

Chemistry

BindingDBi O60733.
ChEMBLi CHEMBL3213.
DrugBanki DB01103. Quinacrine.

PTM databases

PhosphoSitei O60733.

Proteomic databases

MaxQBi O60733.
PaxDbi O60733.
PRIDEi O60733.

Protocols and materials databases

DNASUi 8398.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000332509 ; ENSP00000333142 ; ENSG00000184381 . [O60733-1 ]
ENST00000335539 ; ENSP00000335149 ; ENSG00000184381 . [O60733-2 ]
ENST00000402064 ; ENSP00000386100 ; ENSG00000184381 . [O60733-2 ]
GeneIDi 8398.
KEGGi hsa:8398.
UCSCi uc003auy.1. human. [O60733-1 ]
uc003auz.1. human. [O60733-2 ]

Organism-specific databases

CTDi 8398.
GeneCardsi GC22M038507.
GeneReviewsi PLA2G6.
HGNCi HGNC:9039. PLA2G6.
HPAi HPA001171.
MIMi 256600. phenotype.
603604. gene.
610217. phenotype.
612953. phenotype.
neXtProti NX_O60733.
Orphaneti 199351. Adult-onset dystonia-parkinsonism.
35069. Infantile neuroaxonal dystrophy.
PharmGKBi PA33367.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0666.
HOVERGENi HBG053482.
InParanoidi O60733.
KOi K16343.
OMAi PTYFRPN.
OrthoDBi EOG76T9QK.
PhylomeDBi O60733.
TreeFami TF319230.

Enzyme and pathway databases

Reactomei REACT_120829. Acyl chain remodelling of PC.
REACT_121006. Acyl chain remodeling of CL.
REACT_121369. Acyl chain remodelling of PE.
REACT_160158. Role of phospholipids in phagocytosis.

Miscellaneous databases

ChiTaRSi PLA2G6. human.
GeneWikii PLA2G6.
GenomeRNAii 8398.
NextBioi 31428.
PMAP-CutDB O60733.
PROi O60733.
SOURCEi Search...

Gene expression databases

ArrayExpressi O60733.
Bgeei O60733.
CleanExi HS_PLA2G6.
Genevestigatori O60733.

Family and domain databases

Gene3Di 1.25.40.20. 2 hits.
InterProi IPR016035. Acyl_Trfase/lysoPLipase.
IPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR002641. Patatin/PLipase_A2-rel.
[Graphical view ]
Pfami PF00023. Ank. 4 hits.
PF01734. Patatin. 1 hit.
[Graphical view ]
PRINTSi PR01415. ANKYRIN.
SMARTi SM00248. ANK. 6 hits.
[Graphical view ]
SUPFAMi SSF48403. SSF48403. 1 hit.
SSF52151. SSF52151. 1 hit.
PROSITEi PS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 4 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Multiple splice variants of the human calcium-independent phospholipase A2 and their effect on enzyme activity."
    Larsson P.K.A., Claesson H.-E., Kennedy B.P.
    J. Biol. Chem. 273:207-214(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS LH-IPLA2; ANKYRIN-IPLA2-1 AND ANKYRIN-IPLA2-2).
    Tissue: B-cell and Testis.
  2. "Human pancreatic islets express mRNA species encoding two distinct catalytically active isoforms of group VI phospholipase A2 (iPLA2) that arise from an exon-skipping mechanism of alternative splicing of the transcript from the iPLA2 gene on chromosome 22q13.1."
    Ma Z., Wang X., Nowatzke W., Ramanadham S., Turk J.
    J. Biol. Chem. 274:9607-9616(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS LH-IPLA2 AND SH-IPLA2).
    Tissue: Pancreatic islet.
  3. "The human calcium-independent phospholipase A2 gene. Multiple enzymes with distinct properties from a single gene."
    Larsson Forsell P.K.A., Kennedy B.P., Claesson H.-E.
    Eur. J. Biochem. 262:575-585(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM LH-IPLA2).
    Tissue: Testis.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM LH-IPLA2).
  6. NIEHS SNPs program
    Submitted (JAN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS ILE-58; GLY-63; GLN-70; ASN-183 AND THR-343.
  7. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM LH-IPLA2).
  8. "The DNA sequence of human chromosome 22."
    Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M.
    , Buck D., Burgess J., Burrill W.D., Burton J., Carder C., Carter N.P., Chen Y., Clark G., Clegg S.M., Cobley V.E., Cole C.G., Collier R.E., Connor R., Conroy D., Corby N.R., Coville G.J., Cox A.V., Davis J., Dawson E., Dhami P.D., Dockree C., Dodsworth S.J., Durbin R.M., Ellington A.G., Evans K.L., Fey J.M., Fleming K., French L., Garner A.A., Gilbert J.G.R., Goward M.E., Grafham D.V., Griffiths M.N.D., Hall C., Hall R.E., Hall-Tamlyn G., Heathcott R.W., Ho S., Holmes S., Hunt S.E., Jones M.C., Kershaw J., Kimberley A.M., King A., Laird G.K., Langford C.F., Leversha M.A., Lloyd C., Lloyd D.M., Martyn I.D., Mashreghi-Mohammadi M., Matthews L.H., Mccann O.T., Mcclay J., Mclaren S., McMurray A.A., Milne S.A., Mortimore B.J., Odell C.N., Pavitt R., Pearce A.V., Pearson D., Phillimore B.J.C.T., Phillips S.H., Plumb R.W., Ramsay H., Ramsey Y., Rogers L., Ross M.T., Scott C.E., Sehra H.K., Skuce C.D., Smalley S., Smith M.L., Soderlund C., Spragon L., Steward C.A., Sulston J.E., Swann R.M., Vaudin M., Wall M., Wallis J.M., Whiteley M.N., Willey D.L., Williams L., Williams S.A., Williamson H., Wilmer T.E., Wilming L., Wright C.L., Hubbard T., Bentley D.R., Beck S., Rogers J., Shimizu N., Minoshima S., Kawasaki K., Sasaki T., Asakawa S., Kudoh J., Shintani A., Shibuya K., Yoshizaki Y., Aoki N., Mitsuyama S., Roe B.A., Chen F., Chu L., Crabtree J., Deschamps S., Do A., Do T., Dorman A., Fang F., Fu Y., Hu P., Hua A., Kenton S., Lai H., Lao H.I., Lewis J., Lewis S., Lin S.-P., Loh P., Malaj E., Nguyen T., Pan H., Phan S., Qi S., Qian Y., Ray L., Ren Q., Shaull S., Sloan D., Song L., Wang Q., Wang Y., Wang Z., White J., Willingham D., Wu H., Yao Z., Zhan M., Zhang G., Chissoe S., Murray J., Miller N., Minx P., Fulton R., Johnson D., Bemis G., Bentley D., Bradshaw H., Bourne S., Cordes M., Du Z., Fulton L., Goela D., Graves T., Hawkins J., Hinds K., Kemp K., Latreille P., Layman D., Ozersky P., Rohlfing T., Scheet P., Walker C., Wamsley A., Wohldmann P., Pepin K., Nelson J., Korf I., Bedell J.A., Hillier L.W., Mardis E., Waterston R., Wilson R., Emanuel B.S., Shaikh T., Kurahashi H., Saitta S., Budarf M.L., McDermid H.E., Johnson A., Wong A.C.C., Morrow B.E., Edelmann L., Kim U.J., Shizuya H., Simon M.I., Dumanski J.P., Peyrard M., Kedra D., Seroussi E., Fransson I., Tapia I., Bruder C.E., O'Brien K.P., Wilkinson P., Bodenteich A., Hartman K., Hu X., Khan A.S., Lane L., Tilahun Y., Wright H.
    Nature 402:489-495(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS LH-IPLA2 AND SH-IPLA2).
    Tissue: Brain.
  11. "iPLA2beta: front and center in human monocyte chemotaxis to MCP-1."
    Mishra R.S., Carnevale K.A., Cathcart M.K.
    J. Exp. Med. 205:347-359(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN CHEMOTAXIS, SUBCELLULAR LOCATION.
  12. "Mammalian patatin domain containing proteins: a family with diverse lipolytic activities involved in multiple biological functions."
    Kienesberger P.C., Oberer M., Lass A., Zechner R.
    J. Lipid Res. 50:S63-S68(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: REVIEW ON FAMILY.
  13. "Role of calcium-independent phospholipase A2 in the pathogenesis of Barth syndrome."
    Malhotra A., Edelman-Novemsky I., Xu Y., Plesken H., Ma J., Schlame M., Ren M.
    Proc. Natl. Acad. Sci. U.S.A. 106:2337-2341(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, PHARMACEUTICAL USE.
  14. Cited for: VARIANT NBIA2A VAL-691 DEL.
  15. Cited for: VARIANTS NBIA2B THR-545 AND TRP-632, VARIANTS NBIA2A GLU-310 AND VAL-691 DEL.
  16. Cited for: VARIANTS PARK14 GLN-741 AND TRP-747.
  17. "Recessive truncating NALCN mutation in infantile neuroaxonal dystrophy with facial dysmorphism."
    Koeroglu C., Seven M., Tolun A.
    J. Med. Genet. 50:515-520(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS NBIA2A GLY-484 AND MET-661.

Entry informationi

Entry nameiPLPL9_HUMAN
AccessioniPrimary (citable) accession number: O60733
Secondary accession number(s): A8K597
, B0QYE8, O75645, Q8N452, Q9UG29, Q9UIT0, Q9Y671
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: May 30, 2000
Last modified: September 3, 2014
This is version 145 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Pharmaceutical, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi