Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dual specificity protein phosphatase CDC14B

Gene

CDC14B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Dual-specificity phosphatase involved in DNA damage response. Essential regulator of the G2 DNA damage checkpoint: following DNA damage, translocates to the nucleus and dephosphorylates FZR1/CDH1, a key activator of the anaphase promoting complex/cyclosome (APC/C). Dephosphorylates SIRT2 around early anaphase. Dephosphorylation of FZR1/CDH1 activates the APC/C, leading to the ubiquitination of PLK1, preventing entry into mitosis. Preferentially dephosphorylates proteins modified by proline-directed kinases.3 Publications

Catalytic activityi

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.PROSITE-ProRule annotation1 Publication
[a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei314Phosphocysteine intermediatePROSITE-ProRule annotation1

GO - Molecular functioni

  • protein serine/threonine phosphatase activity Source: UniProtKB
  • protein tyrosine/serine/threonine phosphatase activity Source: InterPro
  • protein tyrosine phosphatase activity Source: UniProtKB

GO - Biological processi

  • DNA repair Source: UniProtKB-KW
  • G2 DNA damage checkpoint Source: UniProtKB
  • positive regulation of ubiquitin protein ligase activity Source: UniProtKB
  • protein dephosphorylation Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protein phosphatase

Keywords - Biological processi

DNA damage, DNA repair

Enzyme and pathway databases

BioCyciZFISH:HS01395-MONOMER.
ReactomeiR-HSA-5687128. MAPK6/MAPK4 signaling.
SIGNORiO60729.

Names & Taxonomyi

Protein namesi
Recommended name:
Dual specificity protein phosphatase CDC14B (EC:3.1.3.16, EC:3.1.3.48)
Alternative name(s):
CDC14 cell division cycle 14 homolog B
Gene namesi
Name:CDC14B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

HGNCiHGNC:1719. CDC14B.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: GO_Central
  • nuclear membrane Source: HPA
  • nucleolus Source: UniProtKB
  • nucleoplasm Source: UniProtKB
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi8555.
OpenTargetsiENSG00000081377.
PharmGKBiPA26255.

Polymorphism and mutation databases

BioMutaiCDC14B.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000948781 – 498Dual specificity protein phosphatase CDC14BAdd BLAST498

Proteomic databases

PaxDbiO60729.
PeptideAtlasiO60729.
PRIDEiO60729.

PTM databases

DEPODiO60729.
iPTMnetiO60729.
PhosphoSitePlusiO60729.

Expressioni

Gene expression databases

BgeeiENSG00000081377.
CleanExiHS_CDC14B.
ExpressionAtlasiO60729. baseline and differential.
GenevisibleiO60729. HS.

Organism-specific databases

HPAiHPA013312.

Interactioni

Subunit structurei

Interacts with FZR1/CDH1.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
SIRT2Q8IXJ62EBI-970231,EBI-477232

Protein-protein interaction databases

BioGridi114125. 3 interactors.
IntActiO60729. 12 interactors.
MINTiMINT-4778030.
STRINGi9606.ENSP00000364389.

Structurei

Secondary structure

1498
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi44 – 46Combined sources3
Beta strandi48 – 60Combined sources13
Beta strandi71 – 75Combined sources5
Turni77 – 79Combined sources3
Beta strandi85 – 87Combined sources3
Helixi94 – 109Combined sources16
Helixi111 – 113Combined sources3
Beta strandi116 – 122Combined sources7
Helixi126 – 143Combined sources18
Helixi148 – 155Combined sources8
Turni156 – 159Combined sources4
Beta strandi168 – 172Combined sources5
Helixi179 – 191Combined sources13
Beta strandi197 – 199Combined sources3
Helixi202 – 209Combined sources8
Helixi211 – 213Combined sources3
Beta strandi216 – 220Combined sources5
Turni221 – 223Combined sources3
Beta strandi224 – 227Combined sources4
Beta strandi237 – 239Combined sources3
Helixi246 – 254Combined sources9
Beta strandi257 – 262Combined sources6
Helixi271 – 274Combined sources4
Turni275 – 277Combined sources3
Beta strandi279 – 282Combined sources4
Helixi293 – 304Combined sources12
Beta strandi307 – 313Combined sources7
Beta strandi315 – 318Combined sources4
Helixi319 – 333Combined sources15
Helixi337 – 347Combined sources11
Helixi355 – 377Combined sources23

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1OHCX-ray2.50A39-386[»]
1OHDX-ray2.60A39-386[»]
1OHEX-ray2.20A39-386[»]
ProteinModelPortaliO60729.
SMRiO60729.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO60729.

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni44 – 198AAdd BLAST155
Regioni199 – 212LinkerAdd BLAST14
Regioni213 – 379BAdd BLAST167

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi1 – 54Nucleolar localization signalCuratedAdd BLAST54

Domaini

Composed of two structurally equivalent A and B domains that adopt a dual specificity protein phosphatase (DSP) fold.

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG1720. Eukaryota.
COG2453. LUCA.
GeneTreeiENSGT00390000010254.
HOGENOMiHOG000198341.
HOVERGENiHBG050818.
InParanoidiO60729.
KOiK06639.
OMAiSPEAYIP.
OrthoDBiEOG091G04FM.
PhylomeDBiO60729.
TreeFamiTF101053.

Family and domain databases

Gene3Di3.90.190.10. 2 hits.
InterProiIPR029260. DSPn.
IPR000340. Dual-sp_phosphatase_cat-dom.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR016130. Tyr_Pase_AS.
IPR003595. Tyr_Pase_cat.
IPR000387. TYR_PHOSPHATASE_dom.
IPR020422. TYR_PHOSPHATASE_DUAL_dom.
[Graphical view]
PfamiPF00782. DSPc. 1 hit.
PF14671. DSPn. 1 hit.
[Graphical view]
SMARTiSM00195. DSPc. 1 hit.
SM00404. PTPc_motif. 1 hit.
[Graphical view]
SUPFAMiSSF52799. SSF52799. 2 hits.
PROSITEiPS00383. TYR_PHOSPHATASE_1. 1 hit.
PS50056. TYR_PHOSPHATASE_2. 1 hit.
PS50054. TYR_PHOSPHATASE_DUAL. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 2 (identifier: O60729-1) [UniParc]FASTAAdd to basket
Also known as: CDC14B2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKRKSERRSS WAAAPPCSRR CSSTSPGVKK IRSSTQQDPR RRDPQDDVYL
60 70 80 90 100
DITDRLCFAI LYSRPKSASN VHYFSIDNEL EYENFYADFG PLNLAMVYRY
110 120 130 140 150
CCKINKKLKS ITMLRKKIVH FTGSDQRKQA NAAFLVGCYM VIYLGRTPEE
160 170 180 190 200
AYRILIFGET SYIPFRDAAY GSCNFYITLL DCFHAVKKAM QYGFLNFNSF
210 220 230 240 250
NLDEYEHYEK AENGDLNWII PDRFIAFCGP HSRARLESGY HQHSPETYIQ
260 270 280 290 300
YFKNHNVTTI IRLNKRMYDA KRFTDAGFDH HDLFFADGST PTDAIVKEFL
310 320 330 340 350
DICENAEGAI AVHCKAGLGR TGTLIACYIM KHYRMTAAET IAWVRICRPG
360 370 380 390 400
SVIGPQQQFL VMKQTNLWLE GDYFRQKLKG QENGQHRAAF SKLLSGVDDI
410 420 430 440 450
SINGVENQDQ QEPEPYSDDD EINGVTQGDR LRALKSRRQS KTNAIPLTVI
460 470 480 490
LQSSVQSCKT SEPNISGSAG ITKRTTRSAS RKSSVKSLSI SRTKTVLR
Length:498
Mass (Da):56,802
Last modified:August 1, 1998 - v1
Checksum:iCEE15EC4DC3B1DC7
GO
Isoform 1 (identifier: O60729-2) [UniParc]FASTAAdd to basket
Also known as: CDC14B1

The sequence of this isoform differs from the canonical sequence as follows:
     449-487: Missing.

Show »
Length:459
Mass (Da):52,752
Checksum:i7E5057E7677B2E61
GO
Isoform 3 (identifier: O60729-3) [UniParc]FASTAAdd to basket
Also known as: CDC14B3

The sequence of this isoform differs from the canonical sequence as follows:
     449-498: VILQSSVQSCKTSEPNISGSAGITKRTTRSASRKSSVKSLSISRTKTVLR → DGWLSQAVTFLDRLLIWLGIHKD

Show »
Length:471
Mass (Da):54,176
Checksum:i7E55AF3DF2B39475
GO
Isoform 4 (identifier: O60729-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     449-498: VILQSSVQSC...SISRTKTVLR → CPLAVLTSAL...LFCLDGFRTQ

Show »
Length:485
Mass (Da):55,665
Checksum:i72641340642F981F
GO
Isoform 5 (identifier: O60729-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: MKRKSERRSSWAAAPPCSRRCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDIT → MSREGAGAALVAEVIK

Note: No experimental confirmation available.
Show »
Length:461
Mass (Da):52,311
Checksum:i94244A208280B2CB
GO

Sequence cautioni

The sequence CAI40539 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_019959302I → T.1 PublicationCorresponds to variant rs16911114dbSNPEnsembl.1
Natural variantiVAR_019960341I → T.1 PublicationCorresponds to variant rs16911075dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0435761 – 53MKRKS…YLDIT → MSREGAGAALVAEVIK in isoform 5. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_012039449 – 498VILQS…KTVLR → DGWLSQAVTFLDRLLIWLGI HKD in isoform 3. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_030720449 – 498VILQS…KTVLR → CPLAVLTSALCSVVIWWIVC DYILPILLFCLDGFRTQ in isoform 4. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_012038449 – 487Missing in isoform 1. 1 PublicationAdd BLAST39

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF023158 mRNA. Translation: AAB88293.1.
AF064104 mRNA. Translation: AAC16661.1.
AF064105 mRNA. Translation: AAC16662.2.
AK126388 mRNA. Translation: BAG54321.1.
EF611343 mRNA. Translation: ABR12627.1.
AY675321 Genomic DNA. Translation: AAT70726.1.
AL133477, AL353578 Genomic DNA. Translation: CAI39616.1.
AL133477, AL353578 Genomic DNA. Translation: CAI39617.1.
AL133477, AL353578 Genomic DNA. Translation: CAI39619.1.
AL353578, AL133477 Genomic DNA. Translation: CAI40536.1.
AL353578, AL133477 Genomic DNA. Translation: CAI40537.1.
AL353578 Genomic DNA. Translation: CAI40539.1. Different initiation.
CH471174 Genomic DNA. Translation: EAW92658.1.
CH471174 Genomic DNA. Translation: EAW92659.1.
CCDSiCCDS43853.1. [O60729-5]
CCDS6721.1. [O60729-2]
CCDS6722.1. [O60729-1]
RefSeqiNP_001070649.1. NM_001077181.1. [O60729-5]
NP_003662.1. NM_003671.3. [O60729-2]
NP_201588.1. NM_033331.2. [O60729-1]
XP_011517460.1. XM_011519158.1. [O60729-3]
XP_016870732.1. XM_017015243.1. [O60729-4]
UniGeneiHs.40582.

Genome annotation databases

EnsembliENST00000375240; ENSP00000364388; ENSG00000081377. [O60729-2]
ENST00000375241; ENSP00000364389; ENSG00000081377. [O60729-1]
ENST00000375242; ENSP00000364390; ENSG00000081377. [O60729-5]
ENST00000463569; ENSP00000420572; ENSG00000081377. [O60729-4]
ENST00000474602; ENSP00000417897; ENSG00000081377. [O60729-3]
GeneIDi8555.
KEGGihsa:8555.
UCSCiuc004awi.4. human. [O60729-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF023158 mRNA. Translation: AAB88293.1.
AF064104 mRNA. Translation: AAC16661.1.
AF064105 mRNA. Translation: AAC16662.2.
AK126388 mRNA. Translation: BAG54321.1.
EF611343 mRNA. Translation: ABR12627.1.
AY675321 Genomic DNA. Translation: AAT70726.1.
AL133477, AL353578 Genomic DNA. Translation: CAI39616.1.
AL133477, AL353578 Genomic DNA. Translation: CAI39617.1.
AL133477, AL353578 Genomic DNA. Translation: CAI39619.1.
AL353578, AL133477 Genomic DNA. Translation: CAI40536.1.
AL353578, AL133477 Genomic DNA. Translation: CAI40537.1.
AL353578 Genomic DNA. Translation: CAI40539.1. Different initiation.
CH471174 Genomic DNA. Translation: EAW92658.1.
CH471174 Genomic DNA. Translation: EAW92659.1.
CCDSiCCDS43853.1. [O60729-5]
CCDS6721.1. [O60729-2]
CCDS6722.1. [O60729-1]
RefSeqiNP_001070649.1. NM_001077181.1. [O60729-5]
NP_003662.1. NM_003671.3. [O60729-2]
NP_201588.1. NM_033331.2. [O60729-1]
XP_011517460.1. XM_011519158.1. [O60729-3]
XP_016870732.1. XM_017015243.1. [O60729-4]
UniGeneiHs.40582.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1OHCX-ray2.50A39-386[»]
1OHDX-ray2.60A39-386[»]
1OHEX-ray2.20A39-386[»]
ProteinModelPortaliO60729.
SMRiO60729.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114125. 3 interactors.
IntActiO60729. 12 interactors.
MINTiMINT-4778030.
STRINGi9606.ENSP00000364389.

PTM databases

DEPODiO60729.
iPTMnetiO60729.
PhosphoSitePlusiO60729.

Polymorphism and mutation databases

BioMutaiCDC14B.

Proteomic databases

PaxDbiO60729.
PeptideAtlasiO60729.
PRIDEiO60729.

Protocols and materials databases

DNASUi8555.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000375240; ENSP00000364388; ENSG00000081377. [O60729-2]
ENST00000375241; ENSP00000364389; ENSG00000081377. [O60729-1]
ENST00000375242; ENSP00000364390; ENSG00000081377. [O60729-5]
ENST00000463569; ENSP00000420572; ENSG00000081377. [O60729-4]
ENST00000474602; ENSP00000417897; ENSG00000081377. [O60729-3]
GeneIDi8555.
KEGGihsa:8555.
UCSCiuc004awi.4. human. [O60729-1]

Organism-specific databases

CTDi8555.
DisGeNETi8555.
GeneCardsiCDC14B.
HGNCiHGNC:1719. CDC14B.
HPAiHPA013312.
MIMi603505. gene.
neXtProtiNX_O60729.
OpenTargetsiENSG00000081377.
PharmGKBiPA26255.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1720. Eukaryota.
COG2453. LUCA.
GeneTreeiENSGT00390000010254.
HOGENOMiHOG000198341.
HOVERGENiHBG050818.
InParanoidiO60729.
KOiK06639.
OMAiSPEAYIP.
OrthoDBiEOG091G04FM.
PhylomeDBiO60729.
TreeFamiTF101053.

Enzyme and pathway databases

BioCyciZFISH:HS01395-MONOMER.
ReactomeiR-HSA-5687128. MAPK6/MAPK4 signaling.
SIGNORiO60729.

Miscellaneous databases

EvolutionaryTraceiO60729.
GeneWikiiCDC14B.
GenomeRNAii8555.
PROiO60729.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000081377.
CleanExiHS_CDC14B.
ExpressionAtlasiO60729. baseline and differential.
GenevisibleiO60729. HS.

Family and domain databases

Gene3Di3.90.190.10. 2 hits.
InterProiIPR029260. DSPn.
IPR000340. Dual-sp_phosphatase_cat-dom.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR016130. Tyr_Pase_AS.
IPR003595. Tyr_Pase_cat.
IPR000387. TYR_PHOSPHATASE_dom.
IPR020422. TYR_PHOSPHATASE_DUAL_dom.
[Graphical view]
PfamiPF00782. DSPc. 1 hit.
PF14671. DSPn. 1 hit.
[Graphical view]
SMARTiSM00195. DSPc. 1 hit.
SM00404. PTPc_motif. 1 hit.
[Graphical view]
SUPFAMiSSF52799. SSF52799. 2 hits.
PROSITEiPS00383. TYR_PHOSPHATASE_1. 1 hit.
PS50056. TYR_PHOSPHATASE_2. 1 hit.
PS50054. TYR_PHOSPHATASE_DUAL. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCC14B_HUMAN
AccessioniPrimary (citable) accession number: O60729
Secondary accession number(s): A6N5X8
, A8MQ20, B1AL31, B1AL32, O43183, O60730, Q5JU08
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 23, 2004
Last sequence update: August 1, 1998
Last modified: November 2, 2016
This is version 137 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.