O60729 (CC14B_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 107.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Dual specificity protein phosphatase CDC14B EC=3.1.3.16 EC=3.1.3.48 Alternative name(s): CDC14 cell division cycle 14 homolog B | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 498 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Dual-specificity phosphatase involved in DNA damage response. Essential regulator of the G2 DNA damage checkpoint: following DNA damage, translocates to the nucleus and dephosphorylates FZR1/CDH1, a key activator of the anaphase promoting complex/cyclosome (APC/C). Dephosphorylation of FZR1/CDH1 activates the APC/C, leading to the ubiquitination of PLK1, preventing entry into mitosis. Preferentially dephosphorylates proteins modified by proline-directed kinases. Ref.1 Ref.11 |
| Catalytic activity | Protein tyrosine phosphate + H2O = protein tyrosine + phosphate. Ref.9 A phosphoprotein + H2O = a protein + phosphate. Ref.9 |
| Subunit structure | Interacts with FZR1/CDH1. Ref.11 |
| Subcellular location | Nucleus › nucleolus. Nucleus › nucleoplasm. Note: Following DNA damage, translocates from the nucleolus to the nucleoplasm and interacts with FZR1/CDH1. Ref.1 Ref.9 Ref.10 Ref.11 |
| Domain | Composed of two structurally equivalent A and B domains that adopt a dual specificity protein phosphatase (DSP) fold. |
| Sequence similarities | Belongs to the protein-tyrosine phosphatase family. Non-receptor class CDC14 subfamily. |
| Sequence caution | The sequence CAI40539.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 2 (identifier: O60729-1) Also known as: CDC14B2; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: O60729-2) Also known as: CDC14B1; The sequence of this isoform differs from the canonical sequence as follows: 449-487: Missing. | ||||||
| Isoform 3 (identifier: O60729-3) Also known as: CDC14B3; The sequence of this isoform differs from the canonical sequence as follows: 449-498: VILQSSVQSCKTSEPNISGSAGITKRTTRSASRKSSVKSLSISRTKTVLR → DGWLSQAVTFLDRLLIWLGIHKD | ||||||
| Isoform 4 (identifier: O60729-4) The sequence of this isoform differs from the canonical sequence as follows: 449-498: VILQSSVQSC...SISRTKTVLR → CPLAVLTSAL...LFCLDGFRTQ | ||||||
| Isoform 5 (identifier: O60729-5) The sequence of this isoform differs from the canonical sequence as follows: 1-53: MKRKSERRSSWAAAPPCSRRCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDIT → MSREGAGAALVAEVIK | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 498 | 498 | Dual specificity protein phosphatase CDC14B | PRO_0000094878 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 44 – 198 | 155 | A | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 199 – 212 | 14 | Linker | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 213 – 379 | 167 | B | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Motif | 1 – 54 | 54 | Nucleolar localization signal Probable | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 314 | 1 | Phosphocysteine intermediate By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 53 | 53 | MKRKS…YLDIT → MSREGAGAALVAEVIK in isoform 5. | VSP_043576 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 449 – 498 | 50 | VILQS…KTVLR → DGWLSQAVTFLDRLLIWLGI HKD in isoform 3. | VSP_012039 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 449 – 498 | 50 | VILQS…KTVLR → CPLAVLTSALCSVVIWWIVC DYILPILLFCLDGFRTQ in isoform 4. | VSP_030720 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 449 – 487 | 39 | Missing in isoform 1. | VSP_012038 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 302 | 1 | I → T. Ref.6 Corresponds to variant rs16911114 [ dbSNP | Ensembl ]. | VAR_019959 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 341 | 1 | I → T. Ref.6 Corresponds to variant rs16911075 [ dbSNP | Ensembl ]. | VAR_019960 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 44 – 46 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 48 – 60 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 71 – 75 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 77 – 79 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 85 – 87 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 94 – 109 | 16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 111 – 113 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 116 – 122 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 126 – 143 | 18 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 148 – 155 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 156 – 159 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 168 – 172 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 179 – 191 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 197 – 199 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 202 – 209 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 211 – 213 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 216 – 220 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 221 – 223 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 224 – 227 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 237 – 239 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 246 – 254 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 257 – 262 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 271 – 274 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 275 – 277 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 279 – 282 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 293 – 304 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 307 – 313 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 315 – 318 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 319 – 333 | 15 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 337 – 347 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 355 – 377 | 23 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A family of putative tumor suppressors is structurally and functionally conserved in humans and yeast." Li L., Ernsting B.R., Wishart M.J., Lohse D.L., Dixon J.E. J. Biol. Chem. 272:29403-29406(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION. |
| [2] | Hao L., Baskerville C., Charbonneau H. Submitted (MAY-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3). Tissue: Placenta. |
| [3] | Hao L., Baskerville C., Charbonneau H. Submitted (AUG-1999) to the EMBL/GenBank/DDBJ databases Cited for: SEQUENCE REVISION (ISOFORM 3). |
| [4] | "Subcellular adaptation of a hominoid cell cycle protein expressed in the brain." Rosso L., Marques A.C., Kaessmann H. Submitted (MAY-2007) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4). |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5). Tissue: Uterus. |
| [6] | NIEHS SNPs program Submitted (JUL-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS THR-302 AND THR-341. |
| [7] | "DNA sequence and analysis of human chromosome 9." Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. Dunham I.Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "Disruption of centrosome structure, chromosome segregation, and cytokinesis by misexpression of human Cdc14A phosphatase." Kaiser B.K., Zimmerman Z.A., Charbonneau H., Jackson P.K. Mol. Biol. Cell 13:2289-2300(2002) [PubMed] [Europe PMC] [Abstract] Cited for: CATALYTIC ACTIVITY, SUBCELLULAR LOCATION. |
| [10] | "Deregulated human Cdc14A phosphatase disrupts centrosome separation and chromosome segregation." Mailand N., Lukas C., Kaiser B.K., Jackson P.K., Bartek J., Lukas J. Nat. Cell Biol. 4:317-322(2002) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [11] | "The Cdc14B-Cdh1-Plk1 axis controls the G2 DNA-damage-response checkpoint." Bassermann F., Frescas D., Guardavaccaro D., Busino L., Peschiaroli A., Pagano M. Cell 134:256-267(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH FZR1. |
| [12] | "The structure of the cell cycle protein Cdc14 reveals a proline-directed protein phosphatase." Gray C.H., Good V.M., Tonks N.K., Barford D. EMBO J. 22:3524-3535(2003) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.5 ANGSTROMS) OF 39-386. |
Web resources
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF023158 mRNA. Translation: AAB88293.1. AF064104 mRNA. Translation: AAC16661.1. AF064105 mRNA. Translation: AAC16662.2. AK126388 mRNA. Translation: BAG54321.1. EF611343 mRNA. Translation: ABR12627.1. AY675321 Genomic DNA. Translation: AAT70726.1. AL133477, AL353578 Genomic DNA. Translation: CAI39616.1. AL133477, AL353578 Genomic DNA. Translation: CAI39617.1. AL133477, AL353578 Genomic DNA. Translation: CAI39619.1. AL353578, AL133477 Genomic DNA. Translation: CAI40536.1. AL353578, AL133477 Genomic DNA. Translation: CAI40537.1. AL353578 Genomic DNA. Translation: CAI40539.1. Different initiation. CH471174 Genomic DNA. Translation: EAW92658.1. CH471174 Genomic DNA. Translation: EAW92659.1. | ||||||||||||||||||||||||
| IPI | IPI00026976. IPI00026977. IPI00103560. IPI00552176. IPI00798000. | ||||||||||||||||||||||||
| RefSeq | NP_001070649.1. NM_001077181.1. NP_003662.1. NM_003671.3. NP_201588.1. NM_033331.2. | ||||||||||||||||||||||||
| UniGene | Hs.40582. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | O60729. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| IntAct | O60729. 1 interaction. | ||||||||||||||||||||||||
| STRING | 9606.ENSP00000364389. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | O60729. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PaxDb | O60729. | ||||||||||||||||||||||||
| PRIDE | O60729. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| DNASU | 8555. | ||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000265659; ENSP00000265659; ENSG00000081377. ENST00000375236; ENSP00000364384; ENSG00000081377. ENST00000375240; ENSP00000364388; ENSG00000081377. ENST00000375241; ENSP00000364389; ENSG00000081377. ENST00000375242; ENSP00000364390; ENSG00000081377. ENST00000463569; ENSP00000420572; ENSG00000081377. ENST00000474602; ENSP00000417897; ENSG00000081377. | ||||||||||||||||||||||||
| GeneID | 8555. | ||||||||||||||||||||||||
| KEGG | hsa:8555. | ||||||||||||||||||||||||
| UCSC | uc004awj.3. human. uc004awk.3. human. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 8555. | ||||||||||||||||||||||||
| GeneCards | GC09M099252. | ||||||||||||||||||||||||
| HGNC | HGNC:1719. CDC14B. | ||||||||||||||||||||||||
| HPA | HPA013312. | ||||||||||||||||||||||||
| MIM | 603505. gene. | ||||||||||||||||||||||||
| neXtProt | NX_O60729. | ||||||||||||||||||||||||
| PharmGKB | PA26255. | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | COG2453. | ||||||||||||||||||||||||
| HOGENOM | HOG000198341. | ||||||||||||||||||||||||
| HOVERGEN | HBG050818. | ||||||||||||||||||||||||
| InParanoid | O60729. | ||||||||||||||||||||||||
| KO | K06639. | ||||||||||||||||||||||||
| OMA | YIPYFKN. | ||||||||||||||||||||||||
| OrthoDB | EOG4QVCBW. | ||||||||||||||||||||||||
| PhylomeDB | O60729. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | O60729. | ||||||||||||||||||||||||
| Bgee | O60729. | ||||||||||||||||||||||||
| CleanEx | HS_CDC14B. | ||||||||||||||||||||||||
| Genevestigator | O60729. | ||||||||||||||||||||||||
| GermOnline | ENSG00000081377. Homo sapiens. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| InterPro | IPR000340. Dual-sp_phosphatase_cat-dom. IPR020422. Dual-sp_phosphatase_subgr_cat. IPR026068. Dual_Pase_CDC14. IPR000387. Tyr/Dual-sp_Pase. IPR016130. Tyr_Pase_AS. [Graphical view] | ||||||||||||||||||||||||
| PANTHER | PTHR23339:SF27. PTHR23339:SF27. 1 hit. | ||||||||||||||||||||||||
| Pfam | PF00782. DSPc. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| PROSITE | PS00383. TYR_PHOSPHATASE_1. 1 hit. PS50056. TYR_PHOSPHATASE_2. 1 hit. PS50054. TYR_PHOSPHATASE_DUAL. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| EvolutionaryTrace | O60729. | ||||||||||||||||||||||||
| GenomeRNAi | 8555. | ||||||||||||||||||||||||
| NextBio | 32057. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | CC14B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O60729 Secondary accession number(s): A6N5X8 Q5JU08 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
