Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A

Gene

PDE8A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. May be involved in maintaining basal levels of the cyclic nucleotide and/or in the cAMP regulation of germ cell development.1 Publication

Catalytic activityi

Adenosine 3',5'-cyclic phosphate + H2O = adenosine 5'-phosphate.

Cofactori

a divalent metal cation1 PublicationNote: Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions.1 Publication

Enzyme regulationi

Inhibited by dipyridimole. Insensitive to selective PDE inhibitors including rolipram and zaprinast as well as to the non-selective inhibitor, IBMX. Unaffected by cGMP.

Pathwayi: 3',5'-cyclic AMP degradation

This protein is involved in step 1 of the subpathway that synthesizes AMP from 3',5'-cyclic AMP.
Proteins known to be involved in this subpathway in this organism are:
  1. cAMP-specific 3',5'-cyclic phosphodiesterase 4C (PDE4C), cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A (PDE10A), cAMP-specific 3',5'-cyclic phosphodiesterase 4A (PDE4A), High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A (PDE7A), cAMP-specific 3',5'-cyclic phosphodiesterase 7B (PDE7B), cAMP-specific 3',5'-cyclic phosphodiesterase 4D (PDE4D), cAMP-specific 3',5'-cyclic phosphodiesterase 4B (PDE4B), High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8B (PDE8B), High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A (PDE8A)
This subpathway is part of the pathway 3',5'-cyclic AMP degradation, which is itself part of Purine metabolism.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes AMP from 3',5'-cyclic AMP, the pathway 3',5'-cyclic AMP degradation and in Purine metabolism.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei556Proton donorBy similarity1
Metal bindingi560Divalent metal cation 11
Metal bindingi596Divalent metal cation 11
Metal bindingi597Divalent metal cation 11
Metal bindingi597Divalent metal cation 21
Metal bindingi726Divalent metal cation 11

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Ligandi

cAMP, Metal-binding

Enzyme and pathway databases

BioCyciZFISH:HS01103-MONOMER.
BRENDAi3.1.4.53. 2681.
ReactomeiR-HSA-418555. G alpha (s) signalling events.
UniPathwayiUPA00762; UER00747.

Names & Taxonomyi

Protein namesi
Recommended name:
High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A (EC:3.1.4.53)
Gene namesi
Name:PDE8A
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

HGNCiHGNC:8793. PDE8A.

Subcellular locationi

GO - Cellular componenti

  • cytosol Source: Reactome
  • extracellular exosome Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi748Y → F: Increases sensitivity to several nonselective or family selective PDE inhibitors. 1 Publication1

Organism-specific databases

DisGeNETi5151.
OpenTargetsiENSG00000073417.
PharmGKBiPA33141.

Chemistry databases

ChEMBLiCHEMBL4640.
DrugBankiDB00201. Caffeine.
DB00920. Ketotifen.
GuidetoPHARMACOLOGYi1307.

Polymorphism and mutation databases

BioMutaiPDE8A.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001988381 – 829High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8AAdd BLAST829

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei20PhosphoserineCombined sources1
Modified residuei359Phosphoserine; by PKA1 Publication1
Modified residuei386PhosphoserineBy similarity1
Modified residuei457PhosphoserineCombined sources1
Modified residuei461PhosphotyrosineBy similarity1

Post-translational modificationi

Phosphorylated at Ser-359 by PKA under elevated cAMP conditions, this enhances catalytic activity.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiO60658.
PaxDbiO60658.
PeptideAtlasiO60658.
PRIDEiO60658.

PTM databases

iPTMnetiO60658.
PhosphoSitePlusiO60658.

Expressioni

Tissue specificityi

Expressed in most tissues except thymus and peripheral blood leukocytes. Highest levels in testis, ovary, small intestine and colon.

Gene expression databases

BgeeiENSG00000073417.
CleanExiHS_PDE8A.
ExpressionAtlasiO60658. baseline and differential.
GenevisibleiO60658. HS.

Organism-specific databases

HPAiHPA007722.

Interactioni

Protein-protein interaction databases

BioGridi111177. 2 interactors.
IntActiO60658. 2 interactors.
STRINGi9606.ENSP00000311453.

Chemistry databases

BindingDBiO60658.

Structurei

Secondary structure

1829
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi486 – 491Combined sources6
Turni492 – 496Combined sources5
Beta strandi497 – 499Combined sources3
Helixi502 – 508Combined sources7
Helixi513 – 524Combined sources12
Helixi528 – 531Combined sources4
Helixi535 – 547Combined sources13
Beta strandi553 – 557Combined sources5
Helixi558 – 572Combined sources15
Helixi575 – 578Combined sources4
Helixi583 – 595Combined sources13
Turni596 – 599Combined sources4
Helixi605 – 610Combined sources6
Helixi614 – 618Combined sources5
Turni619 – 621Combined sources3
Helixi624 – 638Combined sources15
Turni641 – 643Combined sources3
Turni645 – 648Combined sources4
Helixi651 – 666Combined sources16
Helixi670 – 672Combined sources3
Helixi673 – 683Combined sources11
Helixi685 – 691Combined sources7
Helixi692 – 694Combined sources3
Helixi698 – 708Combined sources11
Helixi711 – 726Combined sources16
Helixi729 – 731Combined sources3
Helixi734 – 758Combined sources25
Turni769 – 771Combined sources3
Helixi774 – 784Combined sources11
Helixi786 – 797Combined sources12
Helixi800 – 814Combined sources15

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1LHQmodel-A482-821[»]
1LXXmodel-A488-821[»]
3ECMX-ray1.90A482-819[»]
3ECNX-ray2.10A/B482-819[»]
ProteinModelPortaliO60658.
SMRiO60658.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO60658.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini213 – 283PASPROSITE-ProRule annotationAdd BLAST71
Domaini287 – 329PACAdd BLAST43

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni531 – 813CatalyticBy similarityAdd BLAST283

Domaini

Composed of a C-terminal catalytic domain containing two putative divalent metal sites and an N-terminal regulatory domain.

Sequence similaritiesi

Contains 1 PAS (PER-ARNT-SIM) domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG1229. Eukaryota.
ENOG410XP9B. LUCA.
GeneTreeiENSGT00760000118889.
HOVERGENiHBG053544.
KOiK18437.
OMAiKIGKEWQ.
OrthoDBiEOG091G0337.
PhylomeDBiO60658.
TreeFamiTF314638.

Family and domain databases

Gene3Di1.10.1300.10. 1 hit.
InterProiIPR003607. HD/PDEase_dom.
IPR000014. PAS.
IPR013767. PAS_fold.
IPR023088. PDEase.
IPR002073. PDEase_catalytic_dom.
IPR023174. PDEase_CS.
[Graphical view]
PfamiPF00989. PAS. 1 hit.
PF00233. PDEase_I. 1 hit.
[Graphical view]
PRINTSiPR00387. PDIESTERASE1.
SMARTiSM00471. HDc. 1 hit.
[Graphical view]
SUPFAMiSSF55785. SSF55785. 1 hit.
TIGRFAMsiTIGR00229. sensory_box. 1 hit.
PROSITEiPS50112. PAS. 1 hit.
PS00126. PDEASE_I. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O60658-1) [UniParc]FASTAAdd to basket
Also known as: PDE8A1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGCAPSIHIS ERLVAEDAPS PAAPPLSSGG PRLPQGQKTA ALPRTRGAGL
60 70 80 90 100
LESELRDGSG KKVAVADVQF GPMRFHQDQL QVLLVFTKED NQCNGFCRAC
110 120 130 140 150
EKAGFKCTVT KEAQAVLACF LDKHHDIIII DHRNPRQLDA EALCRSIRSS
160 170 180 190 200
KLSENTVIVG VVRRVDREEL SVMPFISAGF TRRYVENPNI MACYNELLQL
210 220 230 240 250
EFGEVRSQLK LRACNSVFTA LENSEDAIEI TSEDRFIQYA NPAFETTMGY
260 270 280 290 300
QSGELIGKEL GEVPINEKKA DLLDTINSCI RIGKEWQGIY YAKKKNGDNI
310 320 330 340 350
QQNVKIIPVI GQGGKIRHYV SIIRVCNGNN KAEKISECVQ SDTHTDNQTG
360 370 380 390 400
KHKDRRKGSL DVKAVASRAT EVSSQRRHSS MARIHSMTIE APITKVINII
410 420 430 440 450
NAAQESSPMP VTEALDRVLE ILRTTELYSP QFGAKDDDPH ANDLVGGLMS
460 470 480 490 500
DGLRRLSGNE YVLSTKNTQM VSSNIITPIS LDDVPPRIAR AMENEEYWDF
510 520 530 540 550
DIFELEAATH NRPLIYLGLK MFARFGICEF LHCSESTLRS WLQIIEANYH
560 570 580 590 600
SSNPYHNSTH SADVLHATAY FLSKERIKET LDPIDEVAAL IAATIHDVDH
610 620 630 640 650
PGRTNSFLCN AGSELAILYN DTAVLESHHA ALAFQLTTGD DKCNIFKNME
660 670 680 690 700
RNDYRTLRQG IIDMVLATEM TKHFEHVNKF VNSINKPLAT LEENGETDKN
710 720 730 740 750
QEVINTMLRT PENRTLIKRM LIKCADVSNP CRPLQYCIEW AARISEEYFS
760 770 780 790 800
QTDEEKQQGL PVVMPVFDRN TCSIPKSQIS FIDYFITDMF DAWDAFVDLP
810 820
DLMQHLDNNF KYWKGLDEMK LRNLRPPPE
Length:829
Mass (Da):93,304
Last modified:September 19, 2002 - v2
Checksum:i99BD05EA185A42CD
GO
Isoform 2 (identifier: O60658-2) [UniParc]FASTAAdd to basket
Also known as: PDE8A2

The sequence of this isoform differs from the canonical sequence as follows:
     239-284: Missing.

Show »
Length:783
Mass (Da):88,293
Checksum:i67BB1FBE670D7EFE
GO
Isoform 3 (identifier: O60658-3) [UniParc]FASTAAdd to basket
Also known as: PDE8A3

The sequence of this isoform differs from the canonical sequence as follows:
     213-231: ACNSVFTALENSEDAIEIT → SGKEFTMQKRKTEIIYNKM
     232-829: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.
Show »
Length:231
Mass (Da):25,744
Checksum:iD7E21A8D19D661A6
GO
Isoform 4 (identifier: O60658-4) [UniParc]FASTAAdd to basket
Also known as: PDE8A4

The sequence of this isoform differs from the canonical sequence as follows:
     212-228: RACNSVFTALENSEDAI → SMQILHLKQQWAISQVN
     229-829: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.
Show »
Length:228
Mass (Da):25,279
Checksum:i4667A08AAA57F17F
GO
Isoform 5 (identifier: O60658-5) [UniParc]FASTAAdd to basket
Also known as: PDE8A5

The sequence of this isoform differs from the canonical sequence as follows:
     239-272: YANPAFETTMGYQSGELIGKELGEVPINEKKADL → PCCSSSWFGAAHIPSSAPVEVGVGLLPSWSLRRT
     273-829: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.
Show »
Length:272
Mass (Da):29,852
Checksum:iFEECE2A0C9115E13
GO
Isoform 6 (identifier: O60658-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-72: Missing.

Note: No experimental confirmation available.
Show »
Length:757
Mass (Da):86,049
Checksum:i66EB20F0822E42AC
GO

Sequence cautioni

The sequence AAL18612 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.Curated
The sequence AAL18613 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.Curated
The sequence AAL18614 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.Curated
The sequence BAG54458 differs from that shown. Intron retention.Curated
The sequence EAX01967 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti55L → V in AAK57641 (PubMed:11371644).Curated1
Sequence conflicti344H → R in AAK57641 (PubMed:11371644).Curated1
Sequence conflicti344H → R in AAC39763 (PubMed:9618252).Curated1
Sequence conflicti399I → V in AAK57641 (PubMed:11371644).Curated1
Sequence conflicti399I → V in AAC39763 (PubMed:9618252).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_069109112E → G.2 PublicationsCorresponds to variant rs17855018dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0460171 – 72Missing in isoform 6. 1 PublicationAdd BLAST72
Alternative sequenceiVSP_041674212 – 228RACNS…SEDAI → SMQILHLKQQWAISQVN in isoform 4. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_041675213 – 231ACNSV…AIEIT → SGKEFTMQKRKTEIIYNKM in isoform 3. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_041676229 – 829Missing in isoform 4. 1 PublicationAdd BLAST601
Alternative sequenceiVSP_041677232 – 829Missing in isoform 3. 1 PublicationAdd BLAST598
Alternative sequenceiVSP_004597239 – 284Missing in isoform 2. 2 PublicationsAdd BLAST46
Alternative sequenceiVSP_041678239 – 272YANPA…KKADL → PCCSSSWFGAAHIPSSAPVE VGVGLLPSWSLRRT in isoform 5. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_041679273 – 829Missing in isoform 5. 1 PublicationAdd BLAST557

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF388183 mRNA. Translation: AAL18610.1.
AF388184 mRNA. Translation: AAL18611.1.
AF388185 mRNA. Translation: AAL18612.1. Sequence problems.
AF388186 mRNA. Translation: AAL18613.1. Sequence problems.
AF388187 mRNA. Translation: AAL18614.1. Sequence problems.
AF332653 mRNA. Translation: AAK57641.1.
AK074280 mRNA. No translation available.
AK127232 mRNA. Translation: BAG54458.1. Sequence problems.
AC027078 Genomic DNA. No translation available.
AC087468 Genomic DNA. No translation available.
CH471101 Genomic DNA. Translation: EAX01967.1. Sequence problems.
BC060762 mRNA. Translation: AAH60762.1.
BC075822 mRNA. Translation: AAH75822.1.
AF056490 mRNA. Translation: AAC39763.1.
AL109687 mRNA. Translation: CAB52020.1.
AL109778 mRNA. Translation: CAB52432.1.
CCDSiCCDS10336.1. [O60658-1]
CCDS10337.1. [O60658-2]
CCDS58397.1. [O60658-6]
PIRiJW0088.
RefSeqiNP_001230066.1. NM_001243137.1. [O60658-6]
NP_002596.1. NM_002605.2. [O60658-1]
NP_775656.1. NM_173454.1. [O60658-2]
XP_016877800.1. XM_017022311.1.
UniGeneiHs.9333.

Genome annotation databases

EnsembliENST00000310298; ENSP00000311453; ENSG00000073417. [O60658-1]
ENST00000339708; ENSP00000340679; ENSG00000073417. [O60658-2]
ENST00000394553; ENSP00000378056; ENSG00000073417. [O60658-1]
ENST00000478717; ENSP00000432309; ENSG00000073417. [O60658-4]
ENST00000557957; ENSP00000453808; ENSG00000073417. [O60658-6]
GeneIDi5151.
KEGGihsa:5151.
UCSCiuc002blh.4. human. [O60658-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF388183 mRNA. Translation: AAL18610.1.
AF388184 mRNA. Translation: AAL18611.1.
AF388185 mRNA. Translation: AAL18612.1. Sequence problems.
AF388186 mRNA. Translation: AAL18613.1. Sequence problems.
AF388187 mRNA. Translation: AAL18614.1. Sequence problems.
AF332653 mRNA. Translation: AAK57641.1.
AK074280 mRNA. No translation available.
AK127232 mRNA. Translation: BAG54458.1. Sequence problems.
AC027078 Genomic DNA. No translation available.
AC087468 Genomic DNA. No translation available.
CH471101 Genomic DNA. Translation: EAX01967.1. Sequence problems.
BC060762 mRNA. Translation: AAH60762.1.
BC075822 mRNA. Translation: AAH75822.1.
AF056490 mRNA. Translation: AAC39763.1.
AL109687 mRNA. Translation: CAB52020.1.
AL109778 mRNA. Translation: CAB52432.1.
CCDSiCCDS10336.1. [O60658-1]
CCDS10337.1. [O60658-2]
CCDS58397.1. [O60658-6]
PIRiJW0088.
RefSeqiNP_001230066.1. NM_001243137.1. [O60658-6]
NP_002596.1. NM_002605.2. [O60658-1]
NP_775656.1. NM_173454.1. [O60658-2]
XP_016877800.1. XM_017022311.1.
UniGeneiHs.9333.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1LHQmodel-A482-821[»]
1LXXmodel-A488-821[»]
3ECMX-ray1.90A482-819[»]
3ECNX-ray2.10A/B482-819[»]
ProteinModelPortaliO60658.
SMRiO60658.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111177. 2 interactors.
IntActiO60658. 2 interactors.
STRINGi9606.ENSP00000311453.

Chemistry databases

BindingDBiO60658.
ChEMBLiCHEMBL4640.
DrugBankiDB00201. Caffeine.
DB00920. Ketotifen.
GuidetoPHARMACOLOGYi1307.

PTM databases

iPTMnetiO60658.
PhosphoSitePlusiO60658.

Polymorphism and mutation databases

BioMutaiPDE8A.

Proteomic databases

MaxQBiO60658.
PaxDbiO60658.
PeptideAtlasiO60658.
PRIDEiO60658.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000310298; ENSP00000311453; ENSG00000073417. [O60658-1]
ENST00000339708; ENSP00000340679; ENSG00000073417. [O60658-2]
ENST00000394553; ENSP00000378056; ENSG00000073417. [O60658-1]
ENST00000478717; ENSP00000432309; ENSG00000073417. [O60658-4]
ENST00000557957; ENSP00000453808; ENSG00000073417. [O60658-6]
GeneIDi5151.
KEGGihsa:5151.
UCSCiuc002blh.4. human. [O60658-1]

Organism-specific databases

CTDi5151.
DisGeNETi5151.
GeneCardsiPDE8A.
H-InvDBHIX0012539.
HGNCiHGNC:8793. PDE8A.
HPAiHPA007722.
MIMi602972. gene.
neXtProtiNX_O60658.
OpenTargetsiENSG00000073417.
PharmGKBiPA33141.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1229. Eukaryota.
ENOG410XP9B. LUCA.
GeneTreeiENSGT00760000118889.
HOVERGENiHBG053544.
KOiK18437.
OMAiKIGKEWQ.
OrthoDBiEOG091G0337.
PhylomeDBiO60658.
TreeFamiTF314638.

Enzyme and pathway databases

UniPathwayiUPA00762; UER00747.
BioCyciZFISH:HS01103-MONOMER.
BRENDAi3.1.4.53. 2681.
ReactomeiR-HSA-418555. G alpha (s) signalling events.

Miscellaneous databases

ChiTaRSiPDE8A. human.
EvolutionaryTraceiO60658.
GeneWikiiPDE8A.
GenomeRNAii5151.
PROiO60658.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000073417.
CleanExiHS_PDE8A.
ExpressionAtlasiO60658. baseline and differential.
GenevisibleiO60658. HS.

Family and domain databases

Gene3Di1.10.1300.10. 1 hit.
InterProiIPR003607. HD/PDEase_dom.
IPR000014. PAS.
IPR013767. PAS_fold.
IPR023088. PDEase.
IPR002073. PDEase_catalytic_dom.
IPR023174. PDEase_CS.
[Graphical view]
PfamiPF00989. PAS. 1 hit.
PF00233. PDEase_I. 1 hit.
[Graphical view]
PRINTSiPR00387. PDIESTERASE1.
SMARTiSM00471. HDc. 1 hit.
[Graphical view]
SUPFAMiSSF55785. SSF55785. 1 hit.
TIGRFAMsiTIGR00229. sensory_box. 1 hit.
PROSITEiPS50112. PAS. 1 hit.
PS00126. PDEASE_I. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPDE8A_HUMAN
AccessioniPrimary (citable) accession number: O60658
Secondary accession number(s): B3KXE6
, H0YMZ7, Q6P9H3, Q969I1, Q96PC9, Q96PD0, Q96PD1, Q96T71, Q9UMB7, Q9UMC3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: September 19, 2002
Last modified: November 2, 2016
This is version 174 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.