Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O60658

- PDE8A_HUMAN

UniProt

O60658 - PDE8A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A

Gene

PDE8A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. May be involved in maintaining basal levels of the cyclic nucleotide and/or in the cAMP regulation of germ cell development.1 Publication

Catalytic activityi

Adenosine 3',5'-cyclic phosphate + H2O = adenosine 5'-phosphate.

Cofactori

Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions.1 Publication

Enzyme regulationi

Inhibited by dipyridimole. Insensitive to selective PDE inhibitors including rolipram and zaprinast as well as to the non-selective inhibitor, IBMX. Unaffected by cGMP.

Pathwayi

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei556 – 5561Proton donorBy similarity
Metal bindingi560 – 5601Divalent metal cation 1
Metal bindingi596 – 5961Divalent metal cation 1
Metal bindingi597 – 5971Divalent metal cation 1
Metal bindingi597 – 5971Divalent metal cation 2
Metal bindingi726 – 7261Divalent metal cation 1

GO - Molecular functioni

  1. 3',5'-cyclic-AMP phosphodiesterase activity Source: Ensembl
  2. 3',5'-cyclic-nucleotide phosphodiesterase activity Source: UniProtKB
  3. metal ion binding Source: UniProtKB-KW
  4. signal transducer activity Source: InterPro

GO - Biological processi

  1. cAMP catabolic process Source: UniProtKB-UniPathway
  2. cyclic nucleotide metabolic process Source: UniProtKB
  3. phosphorelay signal transduction system Source: InterPro
  4. regulation of transcription, DNA-templated Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Ligandi

cAMP, Metal-binding

Enzyme and pathway databases

ReactomeiREACT_19327. G alpha (s) signalling events.
UniPathwayiUPA00762; UER00747.

Names & Taxonomyi

Protein namesi
Recommended name:
High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A (EC:3.1.4.53)
Gene namesi
Name:PDE8A
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 15

Organism-specific databases

HGNCiHGNC:8793. PDE8A.

Subcellular locationi

GO - Cellular componenti

  1. cytosol Source: Reactome
  2. extracellular vesicular exosome Source: UniProt
Complete GO annotation...

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi748 – 7481Y → F: Increases sensitivity to several nonselective or family selective PDE inhibitors. 1 Publication

Organism-specific databases

PharmGKBiPA33141.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 829829High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8APRO_0000198838Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei20 – 201Phosphoserine1 Publication
Modified residuei359 – 3591Phosphoserine; by PKA1 Publication
Modified residuei457 – 4571Phosphoserine3 Publications
Modified residuei461 – 4611PhosphotyrosineBy similarity

Post-translational modificationi

Phosphorylated at Ser-359 by PKA under elevated cAMP conditions, this enhances catalytic activity.4 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiO60658.
PaxDbiO60658.
PRIDEiO60658.

PTM databases

PhosphoSiteiO60658.

Expressioni

Tissue specificityi

Expressed in most tissues except thymus and peripheral blood leukocytes. Highest levels in testis, ovary, small intestine and colon.

Gene expression databases

BgeeiO60658.
CleanExiHS_PDE8A.
ExpressionAtlasiO60658. baseline and differential.
GenevestigatoriO60658.

Organism-specific databases

HPAiHPA007722.

Interactioni

Protein-protein interaction databases

BioGridi111177. 4 interactions.
IntActiO60658. 2 interactions.
STRINGi9606.ENSP00000311453.

Structurei

Secondary structure

1
829
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi486 – 4916
Turni492 – 4965
Beta strandi497 – 4993
Helixi502 – 5087
Helixi513 – 52412
Helixi528 – 5314
Helixi535 – 54713
Beta strandi553 – 5575
Helixi558 – 57215
Helixi575 – 5784
Helixi583 – 59513
Turni596 – 5994
Helixi605 – 6106
Helixi614 – 6185
Turni619 – 6213
Helixi624 – 63815
Turni641 – 6433
Turni645 – 6484
Helixi651 – 66616
Helixi670 – 6723
Helixi673 – 68311
Helixi685 – 6917
Helixi692 – 6943
Helixi698 – 70811
Helixi711 – 72616
Helixi729 – 7313
Helixi734 – 75825
Turni769 – 7713
Helixi774 – 78411
Helixi786 – 79712
Helixi800 – 81415

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1LHQmodel-A482-821[»]
1LXXmodel-A488-821[»]
3ECMX-ray1.90A482-819[»]
3ECNX-ray2.10A/B482-819[»]
ProteinModelPortaliO60658.
SMRiO60658. Positions 216-328, 482-819.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO60658.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini213 – 28371PASPROSITE-ProRule annotationAdd
BLAST
Domaini287 – 32943PACAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni531 – 813283CatalyticBy similarityAdd
BLAST

Domaini

Composed of a C-terminal catalytic domain containing two putative divalent metal sites and an N-terminal regulatory domain.

Sequence similaritiesi

Contains 1 PAS (PER-ARNT-SIM) domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG282089.
GeneTreeiENSGT00760000118889.
HOVERGENiHBG053544.
KOiK18437.
OMAiQTGKHKD.
OrthoDBiEOG7X3QQM.
PhylomeDBiO60658.
TreeFamiTF314638.

Family and domain databases

Gene3Di1.10.1300.10. 1 hit.
InterProiIPR003607. HD/PDEase_dom.
IPR000014. PAS.
IPR013767. PAS_fold.
IPR023088. PDEase.
IPR002073. PDEase_catalytic_dom.
IPR023174. PDEase_CS.
IPR001789. Sig_transdc_resp-reg_receiver.
[Graphical view]
PfamiPF00989. PAS. 1 hit.
PF00233. PDEase_I. 1 hit.
PF00072. Response_reg. 1 hit.
[Graphical view]
PRINTSiPR00387. PDIESTERASE1.
SMARTiSM00471. HDc. 1 hit.
SM00091. PAS. 1 hit.
[Graphical view]
SUPFAMiSSF55785. SSF55785. 1 hit.
TIGRFAMsiTIGR00229. sensory_box. 1 hit.
PROSITEiPS50112. PAS. 1 hit.
PS00126. PDEASE_I. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O60658-1) [UniParc]FASTAAdd to Basket

Also known as: PDE8A1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGCAPSIHIS ERLVAEDAPS PAAPPLSSGG PRLPQGQKTA ALPRTRGAGL
60 70 80 90 100
LESELRDGSG KKVAVADVQF GPMRFHQDQL QVLLVFTKED NQCNGFCRAC
110 120 130 140 150
EKAGFKCTVT KEAQAVLACF LDKHHDIIII DHRNPRQLDA EALCRSIRSS
160 170 180 190 200
KLSENTVIVG VVRRVDREEL SVMPFISAGF TRRYVENPNI MACYNELLQL
210 220 230 240 250
EFGEVRSQLK LRACNSVFTA LENSEDAIEI TSEDRFIQYA NPAFETTMGY
260 270 280 290 300
QSGELIGKEL GEVPINEKKA DLLDTINSCI RIGKEWQGIY YAKKKNGDNI
310 320 330 340 350
QQNVKIIPVI GQGGKIRHYV SIIRVCNGNN KAEKISECVQ SDTHTDNQTG
360 370 380 390 400
KHKDRRKGSL DVKAVASRAT EVSSQRRHSS MARIHSMTIE APITKVINII
410 420 430 440 450
NAAQESSPMP VTEALDRVLE ILRTTELYSP QFGAKDDDPH ANDLVGGLMS
460 470 480 490 500
DGLRRLSGNE YVLSTKNTQM VSSNIITPIS LDDVPPRIAR AMENEEYWDF
510 520 530 540 550
DIFELEAATH NRPLIYLGLK MFARFGICEF LHCSESTLRS WLQIIEANYH
560 570 580 590 600
SSNPYHNSTH SADVLHATAY FLSKERIKET LDPIDEVAAL IAATIHDVDH
610 620 630 640 650
PGRTNSFLCN AGSELAILYN DTAVLESHHA ALAFQLTTGD DKCNIFKNME
660 670 680 690 700
RNDYRTLRQG IIDMVLATEM TKHFEHVNKF VNSINKPLAT LEENGETDKN
710 720 730 740 750
QEVINTMLRT PENRTLIKRM LIKCADVSNP CRPLQYCIEW AARISEEYFS
760 770 780 790 800
QTDEEKQQGL PVVMPVFDRN TCSIPKSQIS FIDYFITDMF DAWDAFVDLP
810 820
DLMQHLDNNF KYWKGLDEMK LRNLRPPPE
Length:829
Mass (Da):93,304
Last modified:September 19, 2002 - v2
Checksum:i99BD05EA185A42CD
GO
Isoform 2 (identifier: O60658-2) [UniParc]FASTAAdd to Basket

Also known as: PDE8A2

The sequence of this isoform differs from the canonical sequence as follows:
     239-284: Missing.

Show »
Length:783
Mass (Da):88,293
Checksum:i67BB1FBE670D7EFE
GO
Isoform 3 (identifier: O60658-3) [UniParc]FASTAAdd to Basket

Also known as: PDE8A3

The sequence of this isoform differs from the canonical sequence as follows:
     213-231: ACNSVFTALENSEDAIEIT → SGKEFTMQKRKTEIIYNKM
     232-829: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.

Show »
Length:231
Mass (Da):25,744
Checksum:iD7E21A8D19D661A6
GO
Isoform 4 (identifier: O60658-4) [UniParc]FASTAAdd to Basket

Also known as: PDE8A4

The sequence of this isoform differs from the canonical sequence as follows:
     212-228: RACNSVFTALENSEDAI → SMQILHLKQQWAISQVN
     229-829: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.

Show »
Length:228
Mass (Da):25,279
Checksum:i4667A08AAA57F17F
GO
Isoform 5 (identifier: O60658-5) [UniParc]FASTAAdd to Basket

Also known as: PDE8A5

The sequence of this isoform differs from the canonical sequence as follows:
     239-272: YANPAFETTMGYQSGELIGKELGEVPINEKKADL → PCCSSSWFGAAHIPSSAPVEVGVGLLPSWSLRRT
     273-829: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.

Show »
Length:272
Mass (Da):29,852
Checksum:iFEECE2A0C9115E13
GO
Isoform 6 (identifier: O60658-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-72: Missing.

Note: No experimental confirmation available.

Show »
Length:757
Mass (Da):86,049
Checksum:i66EB20F0822E42AC
GO

Sequence cautioni

The sequence BAG54458.1 differs from that shown. Reason: Intron retention.
The sequence EAX01967.1 differs from that shown. Reason: Erroneous gene model prediction.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti55 – 551L → V in AAK57641. (PubMed:11371644)Curated
Sequence conflicti344 – 3441H → R in AAK57641. (PubMed:11371644)Curated
Sequence conflicti344 – 3441H → R in AAC39763. (PubMed:9618252)Curated
Sequence conflicti399 – 3991I → V in AAK57641. (PubMed:11371644)Curated
Sequence conflicti399 – 3991I → V in AAC39763. (PubMed:9618252)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti112 – 1121E → G.2 Publications
Corresponds to variant rs17855018 [ dbSNP | Ensembl ].
VAR_069109

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 7272Missing in isoform 6. 1 PublicationVSP_046017Add
BLAST
Alternative sequencei212 – 22817RACNS…SEDAI → SMQILHLKQQWAISQVN in isoform 4. 1 PublicationVSP_041674Add
BLAST
Alternative sequencei213 – 23119ACNSV…AIEIT → SGKEFTMQKRKTEIIYNKM in isoform 3. 1 PublicationVSP_041675Add
BLAST
Alternative sequencei229 – 829601Missing in isoform 4. 1 PublicationVSP_041676Add
BLAST
Alternative sequencei232 – 829598Missing in isoform 3. 1 PublicationVSP_041677Add
BLAST
Alternative sequencei239 – 28446Missing in isoform 2. 2 PublicationsVSP_004597Add
BLAST
Alternative sequencei239 – 27234YANPA…KKADL → PCCSSSWFGAAHIPSSAPVE VGVGLLPSWSLRRT in isoform 5. 1 PublicationVSP_041678Add
BLAST
Alternative sequencei273 – 829557Missing in isoform 5. 1 PublicationVSP_041679Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF388183 mRNA. Translation: AAL18610.1.
AF388184 mRNA. Translation: AAL18611.1.
AF388185 mRNA. Translation: AAL18612.1. Sequence problems.
AF388186 mRNA. Translation: AAL18613.1. Sequence problems.
AF388187 mRNA. Translation: AAL18614.1. Sequence problems.
AF332653 mRNA. Translation: AAK57641.1.
AK074280 mRNA. No translation available.
AK127232 mRNA. Translation: BAG54458.1. Sequence problems.
AC027078 Genomic DNA. No translation available.
AC087468 Genomic DNA. No translation available.
CH471101 Genomic DNA. Translation: EAX01967.1. Sequence problems.
BC060762 mRNA. Translation: AAH60762.1.
BC075822 mRNA. Translation: AAH75822.1.
AF056490 mRNA. Translation: AAC39763.1.
AL109687 mRNA. Translation: CAB52020.1.
AL109778 mRNA. Translation: CAB52432.1.
CCDSiCCDS10336.1. [O60658-1]
CCDS10337.1. [O60658-2]
CCDS58397.1. [O60658-6]
PIRiJW0088.
RefSeqiNP_001230066.1. NM_001243137.1. [O60658-6]
NP_002596.1. NM_002605.2. [O60658-1]
NP_775656.1. NM_173454.1. [O60658-2]
XP_006720630.1. XM_006720567.1.
UniGeneiHs.9333.

Genome annotation databases

EnsembliENST00000310298; ENSP00000311453; ENSG00000073417. [O60658-1]
ENST00000339708; ENSP00000340679; ENSG00000073417. [O60658-2]
ENST00000394553; ENSP00000378056; ENSG00000073417. [O60658-1]
ENST00000478717; ENSP00000432309; ENSG00000073417. [O60658-4]
ENST00000557957; ENSP00000453808; ENSG00000073417. [O60658-6]
GeneIDi5151.
KEGGihsa:5151.
UCSCiuc002blh.3. human. [O60658-1]
uc002bli.3. human. [O60658-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF388183 mRNA. Translation: AAL18610.1 .
AF388184 mRNA. Translation: AAL18611.1 .
AF388185 mRNA. Translation: AAL18612.1 . Sequence problems.
AF388186 mRNA. Translation: AAL18613.1 . Sequence problems.
AF388187 mRNA. Translation: AAL18614.1 . Sequence problems.
AF332653 mRNA. Translation: AAK57641.1 .
AK074280 mRNA. No translation available.
AK127232 mRNA. Translation: BAG54458.1 . Sequence problems.
AC027078 Genomic DNA. No translation available.
AC087468 Genomic DNA. No translation available.
CH471101 Genomic DNA. Translation: EAX01967.1 . Sequence problems.
BC060762 mRNA. Translation: AAH60762.1 .
BC075822 mRNA. Translation: AAH75822.1 .
AF056490 mRNA. Translation: AAC39763.1 .
AL109687 mRNA. Translation: CAB52020.1 .
AL109778 mRNA. Translation: CAB52432.1 .
CCDSi CCDS10336.1. [O60658-1 ]
CCDS10337.1. [O60658-2 ]
CCDS58397.1. [O60658-6 ]
PIRi JW0088.
RefSeqi NP_001230066.1. NM_001243137.1. [O60658-6 ]
NP_002596.1. NM_002605.2. [O60658-1 ]
NP_775656.1. NM_173454.1. [O60658-2 ]
XP_006720630.1. XM_006720567.1.
UniGenei Hs.9333.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1LHQ model - A 482-821 [» ]
1LXX model - A 488-821 [» ]
3ECM X-ray 1.90 A 482-819 [» ]
3ECN X-ray 2.10 A/B 482-819 [» ]
ProteinModelPortali O60658.
SMRi O60658. Positions 216-328, 482-819.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 111177. 4 interactions.
IntActi O60658. 2 interactions.
STRINGi 9606.ENSP00000311453.

Chemistry

BindingDBi O60658.
ChEMBLi CHEMBL2363066.
DrugBanki DB00201. Caffeine.
DB00920. Ketotifen.
GuidetoPHARMACOLOGYi 1307.

PTM databases

PhosphoSitei O60658.

Proteomic databases

MaxQBi O60658.
PaxDbi O60658.
PRIDEi O60658.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000310298 ; ENSP00000311453 ; ENSG00000073417 . [O60658-1 ]
ENST00000339708 ; ENSP00000340679 ; ENSG00000073417 . [O60658-2 ]
ENST00000394553 ; ENSP00000378056 ; ENSG00000073417 . [O60658-1 ]
ENST00000478717 ; ENSP00000432309 ; ENSG00000073417 . [O60658-4 ]
ENST00000557957 ; ENSP00000453808 ; ENSG00000073417 . [O60658-6 ]
GeneIDi 5151.
KEGGi hsa:5151.
UCSCi uc002blh.3. human. [O60658-1 ]
uc002bli.3. human. [O60658-2 ]

Organism-specific databases

CTDi 5151.
GeneCardsi GC15P085523.
H-InvDB HIX0012539.
HGNCi HGNC:8793. PDE8A.
HPAi HPA007722.
MIMi 602972. gene.
neXtProti NX_O60658.
PharmGKBi PA33141.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG282089.
GeneTreei ENSGT00760000118889.
HOVERGENi HBG053544.
KOi K18437.
OMAi QTGKHKD.
OrthoDBi EOG7X3QQM.
PhylomeDBi O60658.
TreeFami TF314638.

Enzyme and pathway databases

UniPathwayi UPA00762 ; UER00747 .
Reactomei REACT_19327. G alpha (s) signalling events.

Miscellaneous databases

ChiTaRSi PDE8A. human.
EvolutionaryTracei O60658.
GeneWikii PDE8A.
GenomeRNAii 5151.
NextBioi 19878.
PROi O60658.
SOURCEi Search...

Gene expression databases

Bgeei O60658.
CleanExi HS_PDE8A.
ExpressionAtlasi O60658. baseline and differential.
Genevestigatori O60658.

Family and domain databases

Gene3Di 1.10.1300.10. 1 hit.
InterProi IPR003607. HD/PDEase_dom.
IPR000014. PAS.
IPR013767. PAS_fold.
IPR023088. PDEase.
IPR002073. PDEase_catalytic_dom.
IPR023174. PDEase_CS.
IPR001789. Sig_transdc_resp-reg_receiver.
[Graphical view ]
Pfami PF00989. PAS. 1 hit.
PF00233. PDEase_I. 1 hit.
PF00072. Response_reg. 1 hit.
[Graphical view ]
PRINTSi PR00387. PDIESTERASE1.
SMARTi SM00471. HDc. 1 hit.
SM00091. PAS. 1 hit.
[Graphical view ]
SUPFAMi SSF55785. SSF55785. 1 hit.
TIGRFAMsi TIGR00229. sensory_box. 1 hit.
PROSITEi PS50112. PAS. 1 hit.
PS00126. PDEASE_I. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Human phosphodiesterase 8A splice variants: cloning, gene organization, and tissue distribution."
    Wang P., Wu P., Egan R.W., Billah M.M.
    Gene 280:183-194(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4 AND 5).
    Tissue: Testis.
  2. "T cell activation up-regulates cyclic nucleotide phosphodiesterases 8A1 and 7A3."
    Glavas N.A., Ostenson C., Schaefer J.B., Vasta V., Beavo J.A.
    Proc. Natl. Acad. Sci. U.S.A. 98:6319-6324(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 381-829 (ISOFORM 1), VARIANT GLY-112.
    Tissue: Hippocampus.
  4. "Analysis of the DNA sequence and duplication history of human chromosome 15."
    Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A.
    , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
    Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT GLY-112.
    Tissue: Liver and Placenta.
  7. "Isolation and characterization of PDE8A, a novel human cAMP-specific phosphodiesterase."
    Fisher D.A., Smith J.F., Pillar J.S., St Denis S.H., Cheng J.B.
    Biochem. Biophys. Res. Commun. 246:570-577(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 117-829 (ISOFORMS 1 AND 2).
  8. The European IMAGE consortium
    Submitted (JUL-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 554-829.
  9. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-20 AND SER-457, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  10. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-457, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  11. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-457, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  12. "Cyclic AMP-specific phosphodiesterase, PDE8A1, is activated by protein kinase A-mediated phosphorylation."
    Brown K.M., Lee L.C., Findlay J.E., Day J.P., Baillie G.S.
    FEBS Lett. 586:1631-1637(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION AT SER-359.
  13. "Kinetic and structural studies of phosphodiesterase-8A and implication on the inhibitor selectivity."
    Wang H., Yan Z., Yang S., Cai J., Robinson H., Ke H.
    Biochemistry 47:12760-12768(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (1.90 ANGSTROMS) OF 482-819 IN COMPLEX WITH METAL IONS AND THE INHIBITOR IBMX, FUNCTION, COFACTOR, MUTAGENESIS OF TYR-748.

Entry informationi

Entry nameiPDE8A_HUMAN
AccessioniPrimary (citable) accession number: O60658
Secondary accession number(s): B3KXE6
, H0YMZ7, Q6P9H3, Q969I1, Q96PC9, Q96PD0, Q96PD1, Q96T71, Q9UMB7, Q9UMC3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: September 19, 2002
Last modified: October 29, 2014
This is version 155 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3