O60658 (PDE8A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 138.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A EC=3.1.4.17 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 829 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. May be involved in maintaining basal levels of the cyclic nucleotide and/or in the cAMP regulation of germ cell development. Ref.12 |
| Catalytic activity | Adenosine 3',5'-cyclic phosphate + H2O = adenosine 5'-phosphate. |
| Cofactor | Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions. Ref.12 |
| Enzyme regulation | Inhibited by dipyridimole. Insensitive to selective PDE inhibitors including rolipram and zaprinast as well as to the non-selective inhibitor, IBMX. Unaffected by cGMP. |
| Pathway | Purine metabolism; 3',5'-cyclic AMP degradation; AMP from 3',5'-cyclic AMP: step 1/1. |
| Tissue specificity | Expressed in most tissues except thymus and peripheral blood leukocytes. Highest levels in testis, ovary, small intestine and colon. |
| Domain | Composed of a C-terminal catalytic domain containing two putative divalent metal sites and an N-terminal regulatory domain. |
| Sequence similarities | Belongs to the cyclic nucleotide phosphodiesterase family. PDE8 subfamily. Contains 1 PAC (PAS-associated C-terminal) domain. Contains 1 PAS (PER-ARNT-SIM) domain. |
| Sequence caution | The sequence AAL18612.1 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS. The sequence AAL18613.1 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS. The sequence AAL18614.1 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS. The sequence BAG54458.1 differs from that shown. Reason: Intron retention. The sequence EAX01967.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O60658-1) Also known as: PDE8A1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O60658-2) Also known as: PDE8A2; The sequence of this isoform differs from the canonical sequence as follows: 239-284: Missing. | ||||||
| Isoform 3 (identifier: O60658-3) Also known as: PDE8A3; The sequence of this isoform differs from the canonical sequence as follows: 213-231: ACNSVFTALENSEDAIEIT → SGKEFTMQKRKTEIIYNKM 232-829: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available. | ||||||
| Isoform 4 (identifier: O60658-4) Also known as: PDE8A4; The sequence of this isoform differs from the canonical sequence as follows: 212-228: RACNSVFTALENSEDAI → SMQILHLKQQWAISQVN 229-829: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available. | ||||||
| Isoform 5 (identifier: O60658-5) Also known as: PDE8A5; The sequence of this isoform differs from the canonical sequence as follows: 239-272: YANPAFETTMGYQSGELIGKELGEVPINEKKADL → PCCSSSWFGAAHIPSSAPVEVGVGLLPSWSLRRT 273-829: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available. | ||||||
| Isoform 6 (identifier: O60658-6) The sequence of this isoform differs from the canonical sequence as follows: 1-72: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 829 | 829 | High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A | PRO_0000198838 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 213 – 283 | 71 | PAS | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 287 – 329 | 43 | PAC | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 531 – 813 | 283 | Catalytic By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 556 | 1 | Proton donor By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 560 | 1 | Divalent metal cation 1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 596 | 1 | Divalent metal cation 1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 597 | 1 | Divalent metal cation 1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 597 | 1 | Divalent metal cation 2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 726 | 1 | Divalent metal cation 1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 20 | 1 | Phosphoserine Ref.9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 457 | 1 | Phosphoserine Ref.9 Ref.10 Ref.11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 72 | 72 | Missing in isoform 6. | VSP_046017 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 212 – 228 | 17 | RACNS…SEDAI → SMQILHLKQQWAISQVN in isoform 4. | VSP_041674 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 213 – 231 | 19 | ACNSV…AIEIT → SGKEFTMQKRKTEIIYNKM in isoform 3. | VSP_041675 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 229 – 829 | 601 | Missing in isoform 4. | VSP_041676 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 232 – 829 | 598 | Missing in isoform 3. | VSP_041677 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 239 – 284 | 46 | Missing in isoform 2. | VSP_004597 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 239 – 272 | 34 | YANPA…KKADL → PCCSSSWFGAAHIPSSAPVE VGVGLLPSWSLRRT in isoform 5. | VSP_041678 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 273 – 829 | 557 | Missing in isoform 5. | VSP_041679 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 112 | 1 | E → G. Ref.3 Ref.6 Corresponds to variant rs17855018 [ dbSNP | Ensembl ]. | VAR_069109 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 748 | 1 | Y → F: Increases sensitivity to several nonselective or family selective PDE inhibitors. Ref.12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 55 | 1 | L → V in AAK57641. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 344 | 1 | H → R in AAK57641. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 344 | 1 | H → R in AAC39763. Ref.7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 399 | 1 | I → V in AAK57641. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 399 | 1 | I → V in AAC39763. Ref.7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 486 – 491 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 492 – 496 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 497 – 499 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 502 – 508 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 513 – 524 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 528 – 531 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 535 – 547 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 553 – 557 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 558 – 572 | 15 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 575 – 578 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 583 – 595 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 596 – 599 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 605 – 610 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 614 – 618 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 619 – 621 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 624 – 638 | 15 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 641 – 643 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 645 – 648 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 651 – 666 | 16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 670 – 672 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 673 – 683 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 685 – 691 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 692 – 694 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 698 – 708 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 711 – 726 | 16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 729 – 731 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 734 – 758 | 25 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 769 – 771 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 774 – 784 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 786 – 797 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 800 – 814 | 15 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human phosphodiesterase 8A splice variants: cloning, gene organization, and tissue distribution." Wang P., Wu P., Egan R.W., Billah M.M. Gene 280:183-194(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4 AND 5). Tissue: Testis. |
| [2] | "T cell activation up-regulates cyclic nucleotide phosphodiesterases 8A1 and 7A3." Glavas N.A., Ostenson C., Schaefer J.B., Vasta V., Beavo J.A. Proc. Natl. Acad. Sci. U.S.A. 98:6319-6324(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 381-829 (ISOFORM 1), VARIANT GLY-112. Tissue: Hippocampus. |
| [4] | "Analysis of the DNA sequence and duplication history of human chromosome 15." Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A. Nusbaum C.Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT GLY-112. Tissue: Liver and Placenta. |
| [7] | "Isolation and characterization of PDE8A, a novel human cAMP-specific phosphodiesterase." Fisher D.A., Smith J.F., Pillar J.S., St Denis S.H., Cheng J.B. Biochem. Biophys. Res. Commun. 246:570-577(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 117-829 (ISOFORMS 1 AND 2). |
| [8] | The European IMAGE consortium Submitted (JUL-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 554-829. |
| [9] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-20 AND SER-457, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-457, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [11] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-457, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "Kinetic and structural studies of phosphodiesterase-8A and implication on the inhibitor selectivity." Wang H., Yan Z., Yang S., Cai J., Robinson H., Ke H. Biochemistry 47:12760-12768(2008) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.90 ANGSTROMS) OF 482-819 IN COMPLEX WITH METAL IONS AND THE INHIBITOR IBMX, FUNCTION, COFACTOR, MUTAGENESIS OF TYR-748. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF388183 mRNA. Translation: AAL18610.1. AF388184 mRNA. Translation: AAL18611.1. AF388185 mRNA. Translation: AAL18612.1. Sequence problems. AF388186 mRNA. Translation: AAL18613.1. Sequence problems. AF388187 mRNA. Translation: AAL18614.1. Sequence problems. AF332653 mRNA. Translation: AAK57641.1. AK074280 mRNA. No translation available. AK127232 mRNA. Translation: BAG54458.1. Sequence problems. AC027078 Genomic DNA. No translation available. AC087468 Genomic DNA. No translation available. CH471101 Genomic DNA. Translation: EAX01967.1. Sequence problems. BC060762 mRNA. Translation: AAH60762.1. BC075822 mRNA. Translation: AAH75822.1. AF056490 mRNA. Translation: AAC39763.1. AL109687 mRNA. Translation: CAB52020.1. AL109778 mRNA. Translation: CAB52432.1. | ||||||||||||||||||||||||||||||
| IPI | IPI00030976. IPI00182447. IPI00218161. IPI00218162. IPI01025651. | ||||||||||||||||||||||||||||||
| PIR | JW0088. | ||||||||||||||||||||||||||||||
| RefSeq | NP_001230066.1. NM_001243137.1. NP_002596.1. NM_002605.2. NP_775656.1. NM_173454.1. | ||||||||||||||||||||||||||||||
| UniGene | Hs.9333. | ||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||
| ProteinModelPortal | O60658. | ||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||
| IntAct | O60658. 2 interactions. | ||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000311453. | ||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||
| PhosphoSite | O60658. | ||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||
| PaxDb | O60658. | ||||||||||||||||||||||||||||||
| PRIDE | O60658. | ||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||
| Ensembl | ENST00000310298; ENSP00000311453; ENSG00000073417. ENST00000339708; ENSP00000340679; ENSG00000073417. ENST00000394553; ENSP00000378056; ENSG00000073417. ENST00000478717; ENSP00000432309; ENSG00000073417. ENST00000557957; ENSP00000453808; ENSG00000073417. | ||||||||||||||||||||||||||||||
| GeneID | 5151. | ||||||||||||||||||||||||||||||
| KEGG | hsa:5151. | ||||||||||||||||||||||||||||||
| UCSC | uc002blh.3. human. uc002bli.3. human. | ||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||
| CTD | 5151. | ||||||||||||||||||||||||||||||
| GeneCards | GC15P085523. | ||||||||||||||||||||||||||||||
| H-InvDB | HIX0012539. | ||||||||||||||||||||||||||||||
| HGNC | HGNC:8793. PDE8A. | ||||||||||||||||||||||||||||||
| HPA | HPA007722. | ||||||||||||||||||||||||||||||
| MIM | 602972. gene. | ||||||||||||||||||||||||||||||
| neXtProt | NX_O60658. | ||||||||||||||||||||||||||||||
| PharmGKB | PA33141. | ||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||
| eggNOG | NOG282089. | ||||||||||||||||||||||||||||||
| HOVERGEN | HBG053544. | ||||||||||||||||||||||||||||||
| InParanoid | O60658. | ||||||||||||||||||||||||||||||
| KO | K01120. | ||||||||||||||||||||||||||||||
| OMA | QTGKHKD. | ||||||||||||||||||||||||||||||
| OrthoDB | EOG4SBDX7. | ||||||||||||||||||||||||||||||
| PhylomeDB | O60658. | ||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||
| Reactome | REACT_111102. Signal Transduction. | ||||||||||||||||||||||||||||||
| UniPathway | UPA00762; UER00747. | ||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||
| ArrayExpress | O60658. | ||||||||||||||||||||||||||||||
| Bgee | O60658. | ||||||||||||||||||||||||||||||
| CleanEx | HS_PDE8A. | ||||||||||||||||||||||||||||||
| Genevestigator | O60658. | ||||||||||||||||||||||||||||||
| GermOnline | ENSG00000073417. Homo sapiens. | ||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||
| Gene3D | 1.10.1300.10. 1 hit. | ||||||||||||||||||||||||||||||
| InterPro | IPR003607. HD/PDEase_dom. IPR000014. PAS. IPR013767. PAS_fold. IPR023088. PDEase. IPR002073. PDEase_catalytic_dom. IPR023174. PDEase_CS. IPR001789. Sig_transdc_resp-reg_receiver. [Graphical view] | ||||||||||||||||||||||||||||||
| Pfam | PF00989. PAS. 1 hit. PF00233. PDEase_I. 1 hit. PF00072. Response_reg. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| PRINTS | PR00387. PDIESTERASE1. | ||||||||||||||||||||||||||||||
| SMART | SM00471. HDc. 1 hit. SM00091. PAS. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| TIGRFAMs | TIGR00229. sensory_box. 1 hit. | ||||||||||||||||||||||||||||||
| PROSITE | PS50113. PAC. False negative. PS50112. PAS. 1 hit. PS00126. PDEASE_I. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||
| BindingDB | O60658. | ||||||||||||||||||||||||||||||
| ChEMBL | CHEMBL4640. | ||||||||||||||||||||||||||||||
| ChiTaRS | PDE8A. human. | ||||||||||||||||||||||||||||||
| EvolutionaryTrace | O60658. | ||||||||||||||||||||||||||||||
| GenomeRNAi | 5151. | ||||||||||||||||||||||||||||||
| NextBio | 19878. | ||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||
Entry information
| Entry name | PDE8A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O60658 Secondary accession number(s): B3KXE6 Q9UMC3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 15 Human chromosome 15: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
