Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

O60658 (PDE8A_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 152. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (7) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A

EC=3.1.4.53
Gene names
Name:PDE8A
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length829 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. May be involved in maintaining basal levels of the cyclic nucleotide and/or in the cAMP regulation of germ cell development. Ref.13

Catalytic activity

Adenosine 3',5'-cyclic phosphate + H2O = adenosine 5'-phosphate.

Cofactor

Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions. Ref.13

Enzyme regulation

Inhibited by dipyridimole. Insensitive to selective PDE inhibitors including rolipram and zaprinast as well as to the non-selective inhibitor, IBMX. Unaffected by cGMP.

Pathway

Purine metabolism; 3',5'-cyclic AMP degradation; AMP from 3',5'-cyclic AMP: step 1/1.

Tissue specificity

Expressed in most tissues except thymus and peripheral blood leukocytes. Highest levels in testis, ovary, small intestine and colon.

Domain

Composed of a C-terminal catalytic domain containing two putative divalent metal sites and an N-terminal regulatory domain.

Post-translational modification

Phosphorylated at Ser-359 by PKA under elevated cAMP conditions, this enhances catalytic activity. Ref.12

Sequence similarities

Belongs to the cyclic nucleotide phosphodiesterase family. PDE8 subfamily.

Contains 1 PAC (PAS-associated C-terminal) domain.

Contains 1 PAS (PER-ARNT-SIM) domain.

Sequence caution

The sequence AAL18612.1 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.

The sequence AAL18613.1 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.

The sequence AAL18614.1 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.

The sequence BAG54458.1 differs from that shown. Reason: Intron retention.

The sequence EAX01967.1 differs from that shown. Reason: Erroneous gene model prediction.

Alternative products

This entry describes 6 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: O60658-1)

Also known as: PDE8A1;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: O60658-2)

Also known as: PDE8A2;

The sequence of this isoform differs from the canonical sequence as follows:
     239-284: Missing.
Isoform 3 (identifier: O60658-3)

Also known as: PDE8A3;

The sequence of this isoform differs from the canonical sequence as follows:
     213-231: ACNSVFTALENSEDAIEIT → SGKEFTMQKRKTEIIYNKM
     232-829: Missing.
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.
Isoform 4 (identifier: O60658-4)

Also known as: PDE8A4;

The sequence of this isoform differs from the canonical sequence as follows:
     212-228: RACNSVFTALENSEDAI → SMQILHLKQQWAISQVN
     229-829: Missing.
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.
Isoform 5 (identifier: O60658-5)

Also known as: PDE8A5;

The sequence of this isoform differs from the canonical sequence as follows:
     239-272: YANPAFETTMGYQSGELIGKELGEVPINEKKADL → PCCSSSWFGAAHIPSSAPVEVGVGLLPSWSLRRT
     273-829: Missing.
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.
Isoform 6 (identifier: O60658-6)

The sequence of this isoform differs from the canonical sequence as follows:
     1-72: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 829829High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A
PRO_0000198838

Regions

Domain213 – 28371PAS
Domain287 – 32943PAC
Region531 – 813283Catalytic By similarity

Sites

Active site5561Proton donor By similarity
Metal binding5601Divalent metal cation 1
Metal binding5961Divalent metal cation 1
Metal binding5971Divalent metal cation 1
Metal binding5971Divalent metal cation 2
Metal binding7261Divalent metal cation 1

Amino acid modifications

Modified residue201Phosphoserine Ref.9
Modified residue3591Phosphoserine; by PKA Ref.12
Modified residue4571Phosphoserine Ref.9 Ref.10 Ref.11
Modified residue4611Phosphotyrosine By similarity

Natural variations

Alternative sequence1 – 7272Missing in isoform 6.
VSP_046017
Alternative sequence212 – 22817RACNS…SEDAI → SMQILHLKQQWAISQVN in isoform 4.
VSP_041674
Alternative sequence213 – 23119ACNSV…AIEIT → SGKEFTMQKRKTEIIYNKM in isoform 3.
VSP_041675
Alternative sequence229 – 829601Missing in isoform 4.
VSP_041676
Alternative sequence232 – 829598Missing in isoform 3.
VSP_041677
Alternative sequence239 – 28446Missing in isoform 2.
VSP_004597
Alternative sequence239 – 27234YANPA…KKADL → PCCSSSWFGAAHIPSSAPVE VGVGLLPSWSLRRT in isoform 5.
VSP_041678
Alternative sequence273 – 829557Missing in isoform 5.
VSP_041679
Natural variant1121E → G. Ref.3 Ref.6
Corresponds to variant rs17855018 [ dbSNP | Ensembl ].
VAR_069109

Experimental info

Mutagenesis7481Y → F: Increases sensitivity to several nonselective or family selective PDE inhibitors. Ref.13
Sequence conflict551L → V in AAK57641. Ref.2
Sequence conflict3441H → R in AAK57641. Ref.2
Sequence conflict3441H → R in AAC39763. Ref.7
Sequence conflict3991I → V in AAK57641. Ref.2
Sequence conflict3991I → V in AAC39763. Ref.7

Secondary structure

........................................................ 829
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (PDE8A1) [UniParc].

Last modified September 19, 2002. Version 2.
Checksum: 99BD05EA185A42CD

FASTA82993,304
        10         20         30         40         50         60 
MGCAPSIHIS ERLVAEDAPS PAAPPLSSGG PRLPQGQKTA ALPRTRGAGL LESELRDGSG 

        70         80         90        100        110        120 
KKVAVADVQF GPMRFHQDQL QVLLVFTKED NQCNGFCRAC EKAGFKCTVT KEAQAVLACF 

       130        140        150        160        170        180 
LDKHHDIIII DHRNPRQLDA EALCRSIRSS KLSENTVIVG VVRRVDREEL SVMPFISAGF 

       190        200        210        220        230        240 
TRRYVENPNI MACYNELLQL EFGEVRSQLK LRACNSVFTA LENSEDAIEI TSEDRFIQYA 

       250        260        270        280        290        300 
NPAFETTMGY QSGELIGKEL GEVPINEKKA DLLDTINSCI RIGKEWQGIY YAKKKNGDNI 

       310        320        330        340        350        360 
QQNVKIIPVI GQGGKIRHYV SIIRVCNGNN KAEKISECVQ SDTHTDNQTG KHKDRRKGSL 

       370        380        390        400        410        420 
DVKAVASRAT EVSSQRRHSS MARIHSMTIE APITKVINII NAAQESSPMP VTEALDRVLE 

       430        440        450        460        470        480 
ILRTTELYSP QFGAKDDDPH ANDLVGGLMS DGLRRLSGNE YVLSTKNTQM VSSNIITPIS 

       490        500        510        520        530        540 
LDDVPPRIAR AMENEEYWDF DIFELEAATH NRPLIYLGLK MFARFGICEF LHCSESTLRS 

       550        560        570        580        590        600 
WLQIIEANYH SSNPYHNSTH SADVLHATAY FLSKERIKET LDPIDEVAAL IAATIHDVDH 

       610        620        630        640        650        660 
PGRTNSFLCN AGSELAILYN DTAVLESHHA ALAFQLTTGD DKCNIFKNME RNDYRTLRQG 

       670        680        690        700        710        720 
IIDMVLATEM TKHFEHVNKF VNSINKPLAT LEENGETDKN QEVINTMLRT PENRTLIKRM 

       730        740        750        760        770        780 
LIKCADVSNP CRPLQYCIEW AARISEEYFS QTDEEKQQGL PVVMPVFDRN TCSIPKSQIS 

       790        800        810        820 
FIDYFITDMF DAWDAFVDLP DLMQHLDNNF KYWKGLDEMK LRNLRPPPE 

« Hide

Isoform 2 (PDE8A2) [UniParc].

Checksum: 67BB1FBE670D7EFE
Show »

FASTA78388,293
Isoform 3 (PDE8A3) [UniParc].

Checksum: D7E21A8D19D661A6
Show »

FASTA23125,744
Isoform 4 (PDE8A4) [UniParc].

Checksum: 4667A08AAA57F17F
Show »

FASTA22825,279
Isoform 5 (PDE8A5) [UniParc].

Checksum: FEECE2A0C9115E13
Show »

FASTA27229,852
Isoform 6 [UniParc].

Checksum: 66EB20F0822E42AC
Show »

FASTA75786,049

References

« Hide 'large scale' references
[1]"Human phosphodiesterase 8A splice variants: cloning, gene organization, and tissue distribution."
Wang P., Wu P., Egan R.W., Billah M.M.
Gene 280:183-194(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4 AND 5).
Tissue: Testis.
[2]"T cell activation up-regulates cyclic nucleotide phosphodiesterases 8A1 and 7A3."
Glavas N.A., Ostenson C., Schaefer J.B., Vasta V., Beavo J.A.
Proc. Natl. Acad. Sci. U.S.A. 98:6319-6324(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 381-829 (ISOFORM 1), VARIANT GLY-112.
Tissue: Hippocampus.
[4]"Analysis of the DNA sequence and duplication history of human chromosome 15."
Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A. expand/collapse author list , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT GLY-112.
Tissue: Liver and Placenta.
[7]"Isolation and characterization of PDE8A, a novel human cAMP-specific phosphodiesterase."
Fisher D.A., Smith J.F., Pillar J.S., St Denis S.H., Cheng J.B.
Biochem. Biophys. Res. Commun. 246:570-577(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 117-829 (ISOFORMS 1 AND 2).
[8]The European IMAGE consortium
Submitted (JUL-1999) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 554-829.
[9]"Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-20 AND SER-457, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[10]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-457, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[11]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-457, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[12]"Cyclic AMP-specific phosphodiesterase, PDE8A1, is activated by protein kinase A-mediated phosphorylation."
Brown K.M., Lee L.C., Findlay J.E., Day J.P., Baillie G.S.
FEBS Lett. 586:1631-1637(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION AT SER-359.
[13]"Kinetic and structural studies of phosphodiesterase-8A and implication on the inhibitor selectivity."
Wang H., Yan Z., Yang S., Cai J., Robinson H., Ke H.
Biochemistry 47:12760-12768(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (1.90 ANGSTROMS) OF 482-819 IN COMPLEX WITH METAL IONS AND THE INHIBITOR IBMX, FUNCTION, COFACTOR, MUTAGENESIS OF TYR-748.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF388183 mRNA. Translation: AAL18610.1.
AF388184 mRNA. Translation: AAL18611.1.
AF388185 mRNA. Translation: AAL18612.1. Sequence problems.
AF388186 mRNA. Translation: AAL18613.1. Sequence problems.
AF388187 mRNA. Translation: AAL18614.1. Sequence problems.
AF332653 mRNA. Translation: AAK57641.1.
AK074280 mRNA. No translation available.
AK127232 mRNA. Translation: BAG54458.1. Sequence problems.
AC027078 Genomic DNA. No translation available.
AC087468 Genomic DNA. No translation available.
CH471101 Genomic DNA. Translation: EAX01967.1. Sequence problems.
BC060762 mRNA. Translation: AAH60762.1.
BC075822 mRNA. Translation: AAH75822.1.
AF056490 mRNA. Translation: AAC39763.1.
AL109687 mRNA. Translation: CAB52020.1.
AL109778 mRNA. Translation: CAB52432.1.
CCDSCCDS10336.1. [O60658-1]
CCDS10337.1. [O60658-2]
CCDS58397.1. [O60658-6]
PIRJW0088.
RefSeqNP_001230066.1. NM_001243137.1. [O60658-6]
NP_002596.1. NM_002605.2. [O60658-1]
NP_775656.1. NM_173454.1. [O60658-2]
XP_006720630.1. XM_006720567.1.
UniGeneHs.9333.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
1LHQmodel-A482-821[»]
1LXXmodel-A488-821[»]
3ECMX-ray1.90A482-819[»]
3ECNX-ray2.10A/B482-819[»]
ProteinModelPortalO60658.
SMRO60658. Positions 482-819.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid111177. 3 interactions.
IntActO60658. 2 interactions.
STRING9606.ENSP00000311453.

Chemistry

BindingDBO60658.
ChEMBLCHEMBL4640.
GuidetoPHARMACOLOGY1307.

PTM databases

PhosphoSiteO60658.

Proteomic databases

MaxQBO60658.
PaxDbO60658.
PRIDEO60658.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000310298; ENSP00000311453; ENSG00000073417. [O60658-1]
ENST00000339708; ENSP00000340679; ENSG00000073417. [O60658-2]
ENST00000394553; ENSP00000378056; ENSG00000073417. [O60658-1]
ENST00000478717; ENSP00000432309; ENSG00000073417. [O60658-4]
ENST00000557957; ENSP00000453808; ENSG00000073417. [O60658-6]
GeneID5151.
KEGGhsa:5151.
UCSCuc002blh.3. human. [O60658-1]
uc002bli.3. human. [O60658-2]

Organism-specific databases

CTD5151.
GeneCardsGC15P085523.
H-InvDBHIX0012539.
HGNCHGNC:8793. PDE8A.
HPAHPA007722.
MIM602972. gene.
neXtProtNX_O60658.
PharmGKBPA33141.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG282089.
HOVERGENHBG053544.
InParanoidO60658.
KOK01120.
OMAQTGKHKD.
OrthoDBEOG7X3QQM.
PhylomeDBO60658.
TreeFamTF314638.

Enzyme and pathway databases

ReactomeREACT_111102. Signal Transduction.
UniPathwayUPA00762; UER00747.

Gene expression databases

ArrayExpressO60658.
BgeeO60658.
CleanExHS_PDE8A.
GenevestigatorO60658.

Family and domain databases

Gene3D1.10.1300.10. 1 hit.
InterProIPR003607. HD/PDEase_dom.
IPR000014. PAS.
IPR013767. PAS_fold.
IPR023088. PDEase.
IPR002073. PDEase_catalytic_dom.
IPR023174. PDEase_CS.
IPR001789. Sig_transdc_resp-reg_receiver.
[Graphical view]
PfamPF00989. PAS. 1 hit.
PF00233. PDEase_I. 1 hit.
PF00072. Response_reg. 1 hit.
[Graphical view]
PRINTSPR00387. PDIESTERASE1.
SMARTSM00471. HDc. 1 hit.
SM00091. PAS. 1 hit.
[Graphical view]
SUPFAMSSF55785. SSF55785. 1 hit.
TIGRFAMsTIGR00229. sensory_box. 1 hit.
PROSITEPS50112. PAS. 1 hit.
PS00126. PDEASE_I. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSPDE8A. human.
EvolutionaryTraceO60658.
GeneWikiPDE8A.
GenomeRNAi5151.
NextBio19878.
PROO60658.
SOURCESearch...

Entry information

Entry namePDE8A_HUMAN
AccessionPrimary (citable) accession number: O60658
Secondary accession number(s): B3KXE6 expand/collapse secondary AC list , H0YMZ7, Q6P9H3, Q969I1, Q96PC9, Q96PD0, Q96PD1, Q96T71, Q9UMB7, Q9UMC3
Entry history
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: September 19, 2002
Last modified: July 9, 2014
This is version 152 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

PATHWAY comments

Index of metabolic and biosynthesis pathways

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 15

Human chromosome 15: entries, gene names and cross-references to MIM