SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

O60333

- KIF1B_HUMAN

UniProt

O60333 - KIF1B_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Kinesin-like protein KIF1B
Gene
KIF1B, KIAA0591, KIAA1448
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Motor for anterograde transport of mitochondria. Has a microtubule plus end-directed motility. Isoform 2 is required for induction of neuronal apoptosis.1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi97 – 1048ATP By similarity

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. ATPase activity Source: UniProtKB
  3. kinesin binding Source: UniProtKB
  4. microtubule motor activity Source: UniProtKB
  5. protein binding Source: IntAct

GO - Biological processi

  1. anterograde axon cargo transport Source: UniProtKB
  2. apoptotic process Source: UniProtKB-KW
  3. cytoskeleton-dependent intracellular transport Source: UniProtKB
  4. microtubule-based movement Source: UniProtKB
  5. mitochondrion transport along microtubule Source: Ensembl
  6. neuromuscular synaptic transmission Source: UniProtKB
  7. neuron-neuron synaptic transmission Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Motor protein

Keywords - Biological processi

Apoptosis

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Kinesin-like protein KIF1B
Short name:
Klp
Gene namesi
Name:KIF1B
Synonyms:KIAA0591, KIAA1448
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:16636. KIF1B.

Subcellular locationi

Cytoplasmic vesicle By similarity. Cytoplasmcytoskeleton By similarity. Mitochondrion
Note: Colocalizes with synaptophysin at synaptic cytoplasmic transport vesicles in the neurites of hippocampal neurons By similarity.1 Publication

GO - Cellular componenti

  1. cytoplasmic vesicle Source: UniProtKB
  2. cytoplasmic vesicle membrane Source: UniProtKB
  3. kinesin complex Source: InterPro
  4. microtubule Source: UniProtKB-KW
  5. microtubule associated complex Source: UniProtKB
  6. mitochondrion Source: UniProtKB-SubCell
  7. neuron projection Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Microtubule, Mitochondrion

Pathology & Biotechi

Involvement in diseasei

Charcot-Marie-Tooth disease 2A1 (CMT2A1) [MIM:118210]: A dominant axonal form of Charcot-Marie-Tooth disease, a disorder of the peripheral nervous system, characterized by progressive weakness and atrophy, initially of the peroneal muscles and later of the distal muscles of the arms. Charcot-Marie-Tooth disease is classified in two main groups on the basis of electrophysiologic properties and histopathology: primary peripheral demyelinating neuropathies (designated CMT1 when they are dominantly inherited) and primary peripheral axonal neuropathies (CMT2). Neuropathies of the CMT2 group are characterized by signs of axonal degeneration in the absence of obvious myelin alterations, normal or slightly reduced nerve conduction velocities, and progressive distal muscle weakness and atrophy. Nerve conduction velocities are normal or slightly reduced.
Note: The disease is caused by mutations affecting the gene represented in this entry.1 Publication
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti98 – 981Q → L in CMT2A1. 1 Publication
VAR_011515
Neuroblastoma 1 (NBLST1) [MIM:256700]: A common neoplasm of early childhood arising from embryonic cells that form the primitive neural crest and give rise to the adrenal medulla and the sympathetic nervous system.
Note: Disease susceptibility is associated with variations affecting the gene represented in this entry.
Pheochromocytoma (PCC) [MIM:171300]: A catecholamine-producing tumor of chromaffin tissue of the adrenal medulla or sympathetic paraganglia. The cardinal symptom, reflecting the increased secretion of epinephrine and norepinephrine, is hypertension, which may be persistent or intermittent.
Note: Disease susceptibility is associated with variations affecting the gene represented in this entry.

Keywords - Diseasei

Charcot-Marie-Tooth disease, Disease mutation, Neurodegeneration, Neuropathy

Organism-specific databases

MIMi118210. phenotype.
171300. phenotype.
256700. phenotype.
Orphaneti99946. Autosomal dominant Charcot-Marie-Tooth disease type 2A1.
PharmGKBiPA38176.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed1 Publication
Chaini2 – 18161815Kinesin-like protein KIF1B
PRO_0000125407Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylserine1 Publication
Modified residuei1057 – 10571Phosphoserine2 Publications
Modified residuei1075 – 10751Phosphothreonine1 Publication
Modified residuei1454 – 14541Phosphoserine1 Publication
Modified residuei1487 – 14871Phosphoserine2 Publications
Modified residuei1610 – 16101Phosphoserine1 Publication
Modified residuei1613 – 16131Phosphoserine1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiO60333.
PaxDbiO60333.
PRIDEiO60333.

PTM databases

PhosphoSiteiO60333.

Expressioni

Tissue specificityi

Isoform 3 is abundant in the skeletal muscle. It is also expressed in fetal brain, lung and kidney, and adult heart, placenta, testis, ovary and small intestine. Isoform 2 is abundant in the brain and also expressed in fetal heart, lung, liver and kidney, and adult skeletal muscle, placenta, liver, kidney, heart, spleen, thymus, prostate, testis, ovary, small intestine, colon and pancreas.3 Publications

Gene expression databases

ArrayExpressiO60333.
BgeeiO60333.
CleanExiHS_KIF1B.
GenevestigatoriO60333.

Organism-specific databases

HPAiCAB015177.
HPA026434.

Interactioni

Subunit structurei

Interacts (via C-terminus end of the kinesin-motor domain) with CHP1; the interaction occurs in a calcium-dependent manner By similarity. Interacts with KBP.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
CLASP1Q7Z4603EBI-465633,EBI-913476
DLG1Q129594EBI-465669,EBI-357481
Dlg2Q636223EBI-465669,EBI-396947From a different organism.
DLG4P783524EBI-465669,EBI-80389
MAGI1Q96QZ73EBI-465669,EBI-924464

Protein-protein interaction databases

BioGridi116723. 15 interactions.
DIPiDIP-33015N.
IntActiO60333. 23 interactions.
MINTiMINT-1682229.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi533 – 5353
Beta strandi547 – 5504
Beta strandi553 – 5597
Beta strandi563 – 5653
Beta strandi568 – 5703
Beta strandi573 – 5753
Beta strandi580 – 5878
Beta strandi593 – 5975
Beta strandi601 – 6033
Beta strandi605 – 6073
Beta strandi625 – 6295
Beta strandi633 – 6353
Helixi637 – 6404
Turni641 – 6455

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2EH0NMR-A531-647[»]
ProteinModelPortaliO60333.
SMRiO60333. Positions 4-380, 471-647.

Miscellaneous databases

EvolutionaryTraceiO60333.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini5 – 354350Kinesin motor
Add
BLAST
Domaini556 – 61257FHA
Add
BLAST
Domaini1702 – 179998PH
Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni270 – 35081Interaction with KBP
Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili365 – 38622 Reviewed prediction
Add
BLAST
Coiled coili470 – 50233 Reviewed prediction
Add
BLAST
Coiled coili668 – 73770 Reviewed prediction
Add
BLAST
Coiled coili841 – 86929 Reviewed prediction
Add
BLAST

Sequence similaritiesi

Contains 1 FHA domain.
Contains 1 PH domain.

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiCOG5059.
HOVERGENiHBG052251.
KOiK10392.
OMAiNRDAITE.
OrthoDBiEOG77Q4VS.
PhylomeDBiO60333.
TreeFamiTF105221.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
2.60.200.20. 1 hit.
3.40.850.10. 1 hit.
InterProiIPR000253. FHA_dom.
IPR022140. KIF1B.
IPR022164. Kinesin-like.
IPR027640. Kinesin-like_fam.
IPR019821. Kinesin_motor_CS.
IPR001752. Kinesin_motor_dom.
IPR027417. P-loop_NTPase.
IPR001849. PH_domain.
IPR011993. PH_like_dom.
IPR008984. SMAD_FHA_domain.
[Graphical view]
PANTHERiPTHR24115. PTHR24115. 1 hit.
PfamiPF12473. DUF3694. 1 hit.
PF00498. FHA. 1 hit.
PF12423. KIF1B. 1 hit.
PF00225. Kinesin. 1 hit.
PF00169. PH. 1 hit.
[Graphical view]
PRINTSiPR00380. KINESINHEAVY.
SMARTiSM00240. FHA. 1 hit.
SM00129. KISc. 1 hit.
SM00233. PH. 1 hit.
[Graphical view]
SUPFAMiSSF49879. SSF49879. 1 hit.
SSF52540. SSF52540. 1 hit.
PROSITEiPS50006. FHA_DOMAIN. 1 hit.
PS00411. KINESIN_MOTOR_1. 1 hit.
PS50067. KINESIN_MOTOR_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: O60333-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSGASVKVAV RVRPFNSRET SKESKCIIQM QGNSTSIINP KNPKEAPKSF     50
SFDYSYWSHT SPEDPCFASQ NRVYNDIGKE MLLHAFEGYN VCIFAYGQTG 100
AGKSYTMMGK QEESQAGIIP QLCEELFEKI NDNCNEEMSY SVEVSYMEIY 150
CERVRDLLNP KNKGNLRVRE HPLLGPYVED LSKLAVTSYT DIADLMDAGN 200
KARTVAATNM NETSSRSHAV FTIVFTQKKH DNETNLSTEK VSKISLVDLA 250
GSERADSTGA KGTRLKEGAN INKSLTTLGK VISALAEVDN CTSKSKKKKK 300
TDFIPYRDSV LTWLLRENLG GNSRTAMVAA LSPADINYDE TLSTLRYADR 350
AKQIKCNAVI NEDPNAKLVR ELKEEVTRLK DLLRAQGLGD IIDIDPLIDD 400
YSGSGSKYLK DFQNNKHRYL LASENQRPGH FSTASMGSLT SSPSSCSLSS 450
QVGLTSVTSI QERIMSTPGG EEAIERLKES EKIIAELNET WEEKLRKTEA 500
IRMEREALLA EMGVAIREDG GTLGVFSPKK TPHLVNLNED PLMSECLLYY 550
IKDGITRVGQ ADAERRQDIV LSGAHIKEEH CIFRSERSNS GEVIVTLEPC 600
ERSETYVNGK RVSQPVQLRS GNRIIMGKNH VFRFNHPEQA RAEREKTPSA 650
ETPSEPVDWT FAQRELLEKQ GIDMKQEMEK RLQEMEILYK KEKEEADLLL 700
EQQRLDYESK LQALQKQVET RSLAAETTEE EEEEEEVPWT QHEFELAQWA 750
FRKWKSHQFT SLRDLLWGNA VYLKEANAIS VELKKKVQFQ FVLLTDTLYS 800
PLPPELLPTE MEKTHEDRPF PRTVVAVEVQ DLKNGATHYW SLEKLKQRLD 850
LMREMYDRAG EMASSAQDES ETTVTGSDPF YDRFHWFKLV GSSPIFHGCV 900
NERLADRTPS PTFSTADSDI TELADEQQDE MEDFDDEAFV DDAGSDAGTE 950
EGSDLFSDGH DPFYDRSPWF ILVGRAFVYL SNLLYPVPLI HRVAIVSEKG 1000
EVRGFLRVAV QAIAADEEAP DYGSGIRQSG TAKISFDNEY FNQSDFSSVA 1050
MTRSGLSLEE LRIVEGQGQS SEVITPPEEI SRINDLDLKS STLLDGKMVM 1100
EGFSEEIGNH LKLGSAFTFR VTVLQASGIL PEYADIFCQF NFLHRHDEAF 1150
STEPLKNNGR GSPLAFYHVQ NIAVEITESF VDYIKTKPIV FEVFGHYQQH 1200
PLHLQGQELN SPPQPCRRFF PPPMPLSKPV PATKLNTMSK TSLGQSMSKY 1250
DLLVWFEISE LEPTGEYIPA VVDHTAGLPC QGTFLLHQGI QRRITVTIIH 1300
EKGSELHWKD VRELVVGRIR NKPEVDEAAV DAILSLNIIS AKYLKSSHNS 1350
SRTFYRFEAV WDSSLHNSLL LNRVTPYGEK IYMTLSAYLE LDHCIQPAVI 1400
TKDVCMVFYS RDAKISPPRS LRSLFGSGYS KSPDSNRVTG IYELSLCKMS 1450
DTGSPGMQRR RRKILDTSVA YVRGEENLAG WRPRGDSLIL EHQWELEKLE 1500
LLHEVEKTRH FLLLRERLGD SIPKSLSDSL SPSLSSGTLS TSTSISSQIS 1550
TTTFESAITP SESSGYDSGD IESLVDREKE LATKCLQLLT HTFNREFSQV 1600
HGSVSDCKLS DISPIGRDPS ESSFSSATLT PSSTCPSLVD SRSNSLDQKT 1650
PEANSRASSP CPEFEQFQIV PAVETPYLAR AGKNEFLNLV PDIEEIRPSS 1700
VVSKKGYLHF KEPLYSNWAK HFVVVRRPYV FIYNSDKDPV ERGIINLSTA 1750
QVEYSEDQQA MVKTPNTFAV CTKHRGVLLQ ALNDKDMNDW LYAFNPLLAG 1800
TIRSKLSRRC PSQSKY 1816
Length:1,816
Mass (Da):204,476
Last modified:October 17, 2006 - v5
Checksum:iAD62F0515978C783
GO
Isoform 2 (identifier: O60333-2) [UniParc]FASTAAdd to Basket

Also known as: Beta

The sequence of this isoform differs from the canonical sequence as follows:
     289-294: Missing.
     394-434: IDPLIDDYSGSGSKYLKDFQNNKHRYLLASENQRPGHFSTA → T

Show »
Length:1,770
Mass (Da):199,263
Checksum:i8AE6BB2665AF702C
GO
Isoform 3 (identifier: O60333-3) [UniParc]FASTAAdd to Basket

Also known as: Alpha

The sequence of this isoform differs from the canonical sequence as follows:
     289-294: Missing.
     394-434: IDPLIDDYSGSGSKYLKDFQNNKHRYLLASENQRPGHFSTA → T
     707-1196: YESKLQALQK...KPIVFEVFGH → ADSDSGDDSD...NLKAGRETTV
     1197-1816: Missing.

Note: Contains a phosphoserine at position 1141. Contains a phosphoserine at position 663. Contains a phosphoserine at position 665.

Show »
Length:1,153
Mass (Da):130,363
Checksum:i6F0D8846CD283811
GO
Isoform 4 (identifier: O60333-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1804-1816: SKLSRRCPSQSKY → PGHLASEIIREDKSVSFSCQ

Show »
Length:1,823
Mass (Da):205,140
Checksum:iA53CAAD5693880E7
GO

Sequence cautioni

The sequence AAH01415.1 differs from that shown. Reason: Erroneous initiation.
The sequence AAP35838.1 differs from that shown. Reason: Erroneous initiation.
The sequence BAA25517.2 differs from that shown. Reason: Erroneous initiation.
The sequence BAA95972.2 differs from that shown. Reason: Erroneous initiation.
The sequence BAB69038.1 differs from that shown. Reason: Erroneous initiation.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti34 – 341S → L in a medulloblastoma sample; somatic mutation; loss of ability to induce apoptosis. 1 Publication
VAR_063531
Natural varianti98 – 981Q → L in CMT2A1. 1 Publication
VAR_011515
Natural varianti692 – 6921E → V Confers susceptibility to neuroblastoma; found as germline mutation in a neuroblastoma patient; loss of ability to induce apoptosis. 1 Publication
VAR_063532
Natural varianti873 – 8731T → I Confers susceptibility to neuroblastoma; found as germline mutation in a neuroblastoma patient; loss of ability to induce apoptosis. 1 Publication
Corresponds to variant rs121908162 [ dbSNP | Ensembl ].
VAR_063533
Natural varianti1133 – 11331Y → C.1 Publication
Corresponds to variant rs2297881 [ dbSNP | Ensembl ].
VAR_063534
Natural varianti1263 – 12631P → S Confers susceptibility to neuroblastoma; found as germline mutation in a neuroblastoma patient; loss of ability to induce apoptosis. 1 Publication
Corresponds to variant rs121908163 [ dbSNP | Ensembl ].
VAR_063535
Natural varianti1527 – 15271S → N Confers susceptibility to pheochromocytoma; found as germline mutation in a pheochromocytoma family; loss of ability to induce apoptosis. 1 Publication
VAR_063536
Natural varianti1600 – 16001V → M.1 Publication
Corresponds to variant rs77172218 [ dbSNP | Ensembl ].
VAR_063537
Natural varianti1674 – 16741E → K in a pheochromocytoma sample; loss of ability to induce apoptosis. 1 Publication
Corresponds to variant rs143669846 [ dbSNP | Ensembl ].
VAR_063538

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei289 – 2946Missing in isoform 2 and isoform 3.
VSP_002858
Alternative sequencei394 – 43441IDPLI…HFSTA → T in isoform 2 and isoform 3.
VSP_002859Add
BLAST
Alternative sequencei707 – 1196490YESKL…EVFGH → ADSDSGDDSDKRSCEESWKL ITSLREKLPPSKLQTIVKKC GLPSSGKKREPIKMYQIPQR RRLSKDSKWVTISDLKIQAV KEICYEVALNDFRHSRQEIE ALAIVKMKELCAMYGKKDPN ERDSWRAVARDVWDTVGVGD EKIEDVMATGKGSTDVDDLK VHIDKLEDILQEVKKQNNMK DEEIKVLRNKMLKMEKVLPL IGSQEQKSPGSHKAKEPVGA GVSSTSENNVSKGDNGELAK EERVSQLMNGDPAFRRGRLR WMRQEQIRFKNLQQQEITKQ LRRQNVPHRFIPPENRKPRF PFKSNPKHRNSWSPGTHIII TEDEVIELRIPKDDEARKGN KEESQEKGGKGAFKDPQFPW GSQGMRSQDHIQVSKQHINN QQQPPQLRWRSNSLNNGQPK STRCQASASAESLNSHSGHP TADVQTFQAKRHIHQHRQSY CNYNTGGQLEGNAATSYQKQ TDKPSHCSQFVTPPRMRRQF SAPNLKAGRETTV in isoform 3.
VSP_002860Add
BLAST
Alternative sequencei1197 – 1816620Missing in isoform 3.
VSP_002861Add
BLAST
Alternative sequencei1804 – 181613SKLSR…SQSKY → PGHLASEIIREDKSVSFSCQ in isoform 4.
VSP_009381Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti87 – 871E → G in BAA25517. 1 Publication
Sequence conflicti129 – 1313KIN → TNH in AAK49332. 1 Publication
Sequence conflicti129 – 1313KIN → TNH in AAK85155. 1 Publication
Sequence conflicti129 – 1313KIN → TNH in AAN17742. 1 Publication
Sequence conflicti170 – 1701E → D in AAK49332. 1 Publication
Sequence conflicti170 – 1701E → D in AAK85155. 1 Publication
Sequence conflicti170 – 1701E → D in AAN17742. 1 Publication
Sequence conflicti174 – 1741L → R in AAK49332. 1 Publication
Sequence conflicti174 – 1741L → R in AAK85155. 1 Publication
Sequence conflicti174 – 1741L → R in AAN17742. 1 Publication
Sequence conflicti219 – 2213AVF → VVY in AAK49332. 1 Publication
Sequence conflicti219 – 2213AVF → VVY in AAK85155. 1 Publication
Sequence conflicti219 – 2213AVF → VVY in AAN17742. 1 Publication
Sequence conflicti235 – 2395NLSTE → ILATV in AAK49332. 1 Publication
Sequence conflicti235 – 2395NLSTE → ILATV in AAK85155. 1 Publication
Sequence conflicti235 – 2395NLSTE → ILATV in AAN17742. 1 Publication
Sequence conflicti244 – 2441I → T in AAK49332. 1 Publication
Sequence conflicti244 – 2441I → T in AAK85155. 1 Publication
Sequence conflicti244 – 2441I → T in AAN17742. 1 Publication
Sequence conflicti253 – 2531E → D in AAK49332. 1 Publication
Sequence conflicti253 – 2531E → D in AAK85155. 1 Publication
Sequence conflicti253 – 2531E → D in AAN17742. 1 Publication
Sequence conflicti256 – 2561D → A in AAK49332. 1 Publication
Sequence conflicti256 – 2561D → A in AAK85155. 1 Publication
Sequence conflicti256 – 2561D → A in AAN17742. 1 Publication
Sequence conflicti270 – 2701N → I in AAK49332. 1 Publication
Sequence conflicti270 – 2701N → I in AAK85155. 1 Publication
Sequence conflicti270 – 2701N → I in AAN17742. 1 Publication
Sequence conflicti363 – 3631D → G in BAB69038. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AX039604 Genomic DNA. Translation: CAC16629.1.
AB017133 mRNA. Translation: BAB69038.1. Different initiation.
AF257176 mRNA. Translation: AAK49332.1.
AY043362 mRNA. Translation: AAK85155.1.
AB088210 mRNA. Translation: BAE02543.1.
AY139835 mRNA. Translation: AAN17742.1.
AB011163 mRNA. Translation: BAA25517.2. Different initiation.
AB040881 mRNA. Translation: BAA95972.2. Different initiation.
AL139424, AL358013 Genomic DNA. Translation: CAI95752.1.
AL139424, AL358013 Genomic DNA. Translation: CAI95753.1.
AL358013, AL139424 Genomic DNA. Translation: CAI95219.1.
AL358013, AL139424 Genomic DNA. Translation: CAI95220.1.
AL358013, AL139424 Genomic DNA. Translation: CAI95221.1.
AL358013 Genomic DNA. Translation: CAI95222.1.
AL139424, AL358013 Genomic DNA. Translation: CAI95754.1.
BC001415 mRNA. Translation: AAH01415.1. Different initiation.
BC115395 mRNA. Translation: AAI15396.1.
BT007174 mRNA. Translation: AAP35838.1. Different initiation.
AK022977 mRNA. Translation: BAB14341.1.
CCDSiCCDS111.1. [O60333-2]
CCDS112.1. [O60333-3]
RefSeqiNP_055889.2. NM_015074.3. [O60333-2]
NP_904325.2. NM_183416.3. [O60333-3]
UniGeneiHs.97858.

Genome annotation databases

EnsembliENST00000263934; ENSP00000263934; ENSG00000054523. [O60333-2]
ENST00000377081; ENSP00000366284; ENSG00000054523. [O60333-4]
ENST00000377083; ENSP00000366287; ENSG00000054523. [O60333-3]
ENST00000377086; ENSP00000366290; ENSG00000054523. [O60333-1]
ENST00000377093; ENSP00000366297; ENSG00000054523. [O60333-3]
GeneIDi23095.
KEGGihsa:23095.
UCSCiuc001aqv.4. human. [O60333-3]
uc001aqw.4. human. [O60333-2]
uc001aqx.4. human. [O60333-1]
uc001aqz.3. human. [O60333-4]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Inherited peripheral neuropathies mutation db

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AX039604 Genomic DNA. Translation: CAC16629.1 .
AB017133 mRNA. Translation: BAB69038.1 . Different initiation.
AF257176 mRNA. Translation: AAK49332.1 .
AY043362 mRNA. Translation: AAK85155.1 .
AB088210 mRNA. Translation: BAE02543.1 .
AY139835 mRNA. Translation: AAN17742.1 .
AB011163 mRNA. Translation: BAA25517.2 . Different initiation.
AB040881 mRNA. Translation: BAA95972.2 . Different initiation.
AL139424 , AL358013 Genomic DNA. Translation: CAI95752.1 .
AL139424 , AL358013 Genomic DNA. Translation: CAI95753.1 .
AL358013 , AL139424 Genomic DNA. Translation: CAI95219.1 .
AL358013 , AL139424 Genomic DNA. Translation: CAI95220.1 .
AL358013 , AL139424 Genomic DNA. Translation: CAI95221.1 .
AL358013 Genomic DNA. Translation: CAI95222.1 .
AL139424 , AL358013 Genomic DNA. Translation: CAI95754.1 .
BC001415 mRNA. Translation: AAH01415.1 . Different initiation.
BC115395 mRNA. Translation: AAI15396.1 .
BT007174 mRNA. Translation: AAP35838.1 . Different initiation.
AK022977 mRNA. Translation: BAB14341.1 .
CCDSi CCDS111.1. [O60333-2 ]
CCDS112.1. [O60333-3 ]
RefSeqi NP_055889.2. NM_015074.3. [O60333-2 ]
NP_904325.2. NM_183416.3. [O60333-3 ]
UniGenei Hs.97858.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2EH0 NMR - A 531-647 [» ]
ProteinModelPortali O60333.
SMRi O60333. Positions 4-380, 471-647.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 116723. 15 interactions.
DIPi DIP-33015N.
IntActi O60333. 23 interactions.
MINTi MINT-1682229.

Chemistry

BindingDBi O60333.
ChEMBLi CHEMBL5889.

PTM databases

PhosphoSitei O60333.

Proteomic databases

MaxQBi O60333.
PaxDbi O60333.
PRIDEi O60333.

Protocols and materials databases

DNASUi 23095.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000263934 ; ENSP00000263934 ; ENSG00000054523 . [O60333-2 ]
ENST00000377081 ; ENSP00000366284 ; ENSG00000054523 . [O60333-4 ]
ENST00000377083 ; ENSP00000366287 ; ENSG00000054523 . [O60333-3 ]
ENST00000377086 ; ENSP00000366290 ; ENSG00000054523 . [O60333-1 ]
ENST00000377093 ; ENSP00000366297 ; ENSG00000054523 . [O60333-3 ]
GeneIDi 23095.
KEGGi hsa:23095.
UCSCi uc001aqv.4. human. [O60333-3 ]
uc001aqw.4. human. [O60333-2 ]
uc001aqx.4. human. [O60333-1 ]
uc001aqz.3. human. [O60333-4 ]

Organism-specific databases

CTDi 23095.
GeneCardsi GC01P010270.
HGNCi HGNC:16636. KIF1B.
HPAi CAB015177.
HPA026434.
MIMi 118210. phenotype.
171300. phenotype.
256700. phenotype.
605995. gene.
neXtProti NX_O60333.
Orphaneti 99946. Autosomal dominant Charcot-Marie-Tooth disease type 2A1.
PharmGKBi PA38176.
HUGEi Search...
Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5059.
HOVERGENi HBG052251.
KOi K10392.
OMAi NRDAITE.
OrthoDBi EOG77Q4VS.
PhylomeDBi O60333.
TreeFami TF105221.

Miscellaneous databases

ChiTaRSi KIF1B. human.
EvolutionaryTracei O60333.
GeneWikii KIF1B.
GenomeRNAii 23095.
NextBioi 44259.
PROi O60333.
SOURCEi Search...

Gene expression databases

ArrayExpressi O60333.
Bgeei O60333.
CleanExi HS_KIF1B.
Genevestigatori O60333.

Family and domain databases

Gene3Di 2.30.29.30. 1 hit.
2.60.200.20. 1 hit.
3.40.850.10. 1 hit.
InterProi IPR000253. FHA_dom.
IPR022140. KIF1B.
IPR022164. Kinesin-like.
IPR027640. Kinesin-like_fam.
IPR019821. Kinesin_motor_CS.
IPR001752. Kinesin_motor_dom.
IPR027417. P-loop_NTPase.
IPR001849. PH_domain.
IPR011993. PH_like_dom.
IPR008984. SMAD_FHA_domain.
[Graphical view ]
PANTHERi PTHR24115. PTHR24115. 1 hit.
Pfami PF12473. DUF3694. 1 hit.
PF00498. FHA. 1 hit.
PF12423. KIF1B. 1 hit.
PF00225. Kinesin. 1 hit.
PF00169. PH. 1 hit.
[Graphical view ]
PRINTSi PR00380. KINESINHEAVY.
SMARTi SM00240. FHA. 1 hit.
SM00129. KISc. 1 hit.
SM00233. PH. 1 hit.
[Graphical view ]
SUPFAMi SSF49879. SSF49879. 1 hit.
SSF52540. SSF52540. 1 hit.
PROSITEi PS50006. FHA_DOMAIN. 1 hit.
PS00411. KINESIN_MOTOR_1. 1 hit.
PS50067. KINESIN_MOTOR_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "DNA encoding a kinesin-like protein (hklp) comprising biallelic markers."
    Bougueleret L., Dufaure-Gare I., Grel P.
    Patent number WO0063375, 26-OCT-2000
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1).
  2. "Identification of the full-length KIAA0591 gene encoding a novel kinesin-related protein which is mapped to the neuroblastoma suppressor gene locus at 1p36.2."
    Nagai M., Ichimiya S., Ozaki T., Seki N., Mihara M., Furuta S., Ohira M., Tomioka N., Nomura N., Sakiyama S., Kubo O., Takakura K., Hori T., Nakagawara A.
    Int. J. Oncol. 16:907-916(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), TISSUE SPECIFICITY.
    Tissue: Substantia nigra.
  3. "Genomic structure and mutational analysis of the human KIF1B gene which is homozygously deleted in neuroblastoma at chromosome 1p36.2."
    Yang H.W., Chen Y.Z., Takita J., Soeda E., Piao H.Y., Hayashi Y.
    Oncogene 20:5075-5083(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 2), TISSUE SPECIFICITY.
  4. "Identification of the human ortholog of mouse Kif1B, a kinesin superfamily motor protein."
    Park M., Shin H., Lee Y.M., Moon E., Choi W., Kim W.
    Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
  5. "Identification of splicing variants of KIF1Bbeta."
    Munirajan A.K., Ohira M., Nakagawara A.
    Submitted (JUL-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
  6. "Genomic structure and mutational analysis of the human KIF1Balpha gene located at 1p36.2 in neuroblastoma."
    Chen Y.Y., Takita J., Chen Y.Z., Yang H.W., Hanada R., Yamamoto K., Hayashi Y.
    Int. J. Oncol. 23:737-744(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY.
    Tissue: Neuroblastoma.
  7. "Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
    Nagase T., Ishikawa K., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 5:31-39(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  8. "Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
    DNA Res. 7:143-150(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Brain.
  9. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1238-1816 (ISOFORMS 1/2).
    Tissue: Placenta.
  11. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
    Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
    Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1238-1816 (ISOFORMS 1/2).
  12. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1449-1816 (ISOFORMS 1/2).
  13. "The novel protein KBP regulates mitochondria localization by interaction with a kinesin-like protein."
    Wozniak M.J., Melzer M., Dorner C., Haring H.U., Lammers R.
    BMC Cell Biol. 6:35-35(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH KBP, SUBCELLULAR LOCATION.
  14. Cited for: FUNCTION, INVOLVEMENT IN NEUROBLASTOMA AND PHEOCHROMOCYTOMA, VARIANTS LEU-34; VAL-692; ILE-873; CYS-1133; SER-1263; ASN-1527; MET-1600 AND LYS-1674.
  15. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1057, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  16. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  17. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-1075 AND SER-1487, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  18. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1057; SER-1454; SER-1487; SER-1610 AND SER-1613, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1141 (ISOFORM 3), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  19. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  20. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-663 AND SER-665 (ISOFORM 3), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  21. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT SER-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
  22. "Charcot-Marie-Tooth disease type 2A caused by mutation in a microtubule motor KIF1B-beta."
    Zhao C., Takita J., Tanaka Y., Setou M., Nakagawa T., Takeda S., Yang H.W., Terada S., Nakata T., Takei Y., Saito M., Tsuji S., Hayashi Y., Hirokawa N.
    Cell 105:587-597(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT CMT2A1 LEU-98.

Entry informationi

Entry nameiKIF1B_HUMAN
AccessioniPrimary (citable) accession number: O60333
Secondary accession number(s): A6NFS8
, A6NKQ4, Q4VXC3, Q4VXC4, Q4VXC5, Q4VXC6, Q96Q94, Q9BV80, Q9P280
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: October 17, 2006
Last modified: September 3, 2014
This is version 158 of the entry and version 5 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi