Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

O60333

- KIF1B_HUMAN

UniProt

O60333 - KIF1B_HUMAN

Protein

Kinesin-like protein KIF1B

Gene

KIF1B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 159 (01 Oct 2014)
      Sequence version 5 (17 Oct 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Motor for anterograde transport of mitochondria. Has a microtubule plus end-directed motility. Isoform 2 is required for induction of neuronal apoptosis.1 Publication

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi97 – 1048ATPPROSITE-ProRule annotation

    GO - Molecular functioni

    1. ATPase activity Source: UniProtKB
    2. ATP binding Source: UniProtKB-KW
    3. kinesin binding Source: UniProtKB
    4. microtubule motor activity Source: UniProtKB
    5. protein binding Source: IntAct

    GO - Biological processi

    1. anterograde axon cargo transport Source: UniProtKB
    2. apoptotic process Source: UniProtKB-KW
    3. cytoskeleton-dependent intracellular transport Source: UniProtKB
    4. microtubule-based movement Source: UniProtKB
    5. mitochondrion transport along microtubule Source: Ensembl
    6. neuromuscular synaptic transmission Source: UniProtKB
    7. neuron-neuron synaptic transmission Source: UniProtKB

    Keywords - Molecular functioni

    Motor protein

    Keywords - Biological processi

    Apoptosis

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Kinesin-like protein KIF1B
    Short name:
    Klp
    Gene namesi
    Name:KIF1B
    Synonyms:KIAA0591, KIAA1448
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:16636. KIF1B.

    Subcellular locationi

    Cytoplasmic vesicle By similarity. Cytoplasmcytoskeleton By similarity. Mitochondrion 1 Publication
    Note: Colocalizes with synaptophysin at synaptic cytoplasmic transport vesicles in the neurites of hippocampal neurons.By similarity

    GO - Cellular componenti

    1. cytoplasmic vesicle Source: UniProtKB
    2. cytoplasmic vesicle membrane Source: UniProtKB
    3. kinesin complex Source: InterPro
    4. microtubule Source: UniProtKB-KW
    5. microtubule associated complex Source: UniProtKB
    6. mitochondrion Source: UniProtKB-SubCell
    7. neuron projection Source: UniProtKB

    Keywords - Cellular componenti

    Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Microtubule, Mitochondrion

    Pathology & Biotechi

    Involvement in diseasei

    Charcot-Marie-Tooth disease 2A1 (CMT2A1) [MIM:118210]: A dominant axonal form of Charcot-Marie-Tooth disease, a disorder of the peripheral nervous system, characterized by progressive weakness and atrophy, initially of the peroneal muscles and later of the distal muscles of the arms. Charcot-Marie-Tooth disease is classified in two main groups on the basis of electrophysiologic properties and histopathology: primary peripheral demyelinating neuropathies (designated CMT1 when they are dominantly inherited) and primary peripheral axonal neuropathies (CMT2). Neuropathies of the CMT2 group are characterized by signs of axonal degeneration in the absence of obvious myelin alterations, normal or slightly reduced nerve conduction velocities, and progressive distal muscle weakness and atrophy. Nerve conduction velocities are normal or slightly reduced.1 Publication
    Note: The disease is caused by mutations affecting the gene represented in this entry.
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti98 – 981Q → L in CMT2A1. 1 Publication
    VAR_011515
    Neuroblastoma 1 (NBLST1) [MIM:256700]: A common neoplasm of early childhood arising from embryonic cells that form the primitive neural crest and give rise to the adrenal medulla and the sympathetic nervous system.
    Note: Disease susceptibility is associated with variations affecting the gene represented in this entry.
    Pheochromocytoma (PCC) [MIM:171300]: A catecholamine-producing tumor of chromaffin tissue of the adrenal medulla or sympathetic paraganglia. The cardinal symptom, reflecting the increased secretion of epinephrine and norepinephrine, is hypertension, which may be persistent or intermittent.1 Publication
    Note: Disease susceptibility is associated with variations affecting the gene represented in this entry.

    Keywords - Diseasei

    Charcot-Marie-Tooth disease, Disease mutation, Neurodegeneration, Neuropathy

    Organism-specific databases

    MIMi118210. phenotype.
    171300. phenotype.
    256700. phenotype.
    Orphaneti99946. Autosomal dominant Charcot-Marie-Tooth disease type 2A1.
    PharmGKBiPA38176.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11Removed1 Publication
    Chaini2 – 18161815Kinesin-like protein KIF1BPRO_0000125407Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylserine1 Publication
    Modified residuei1057 – 10571Phosphoserine2 Publications
    Modified residuei1075 – 10751Phosphothreonine1 Publication
    Modified residuei1454 – 14541Phosphoserine1 Publication
    Modified residuei1487 – 14871Phosphoserine2 Publications
    Modified residuei1610 – 16101Phosphoserine1 Publication
    Modified residuei1613 – 16131Phosphoserine1 Publication

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiO60333.
    PaxDbiO60333.
    PRIDEiO60333.

    PTM databases

    PhosphoSiteiO60333.

    Expressioni

    Tissue specificityi

    Isoform 3 is abundant in the skeletal muscle. It is also expressed in fetal brain, lung and kidney, and adult heart, placenta, testis, ovary and small intestine. Isoform 2 is abundant in the brain and also expressed in fetal heart, lung, liver and kidney, and adult skeletal muscle, placenta, liver, kidney, heart, spleen, thymus, prostate, testis, ovary, small intestine, colon and pancreas.3 Publications

    Gene expression databases

    ArrayExpressiO60333.
    BgeeiO60333.
    CleanExiHS_KIF1B.
    GenevestigatoriO60333.

    Organism-specific databases

    HPAiCAB015177.
    HPA026434.

    Interactioni

    Subunit structurei

    Interacts (via C-terminus end of the kinesin-motor domain) with CHP1; the interaction occurs in a calcium-dependent manner By similarity. Interacts with KBP.By similarity1 Publication

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    CLASP1Q7Z4603EBI-465633,EBI-913476
    DLG1Q129594EBI-465669,EBI-357481
    Dlg2Q636223EBI-465669,EBI-396947From a different organism.
    DLG4P783524EBI-465669,EBI-80389
    MAGI1Q96QZ73EBI-465669,EBI-924464

    Protein-protein interaction databases

    BioGridi116723. 15 interactions.
    DIPiDIP-33015N.
    IntActiO60333. 23 interactions.
    MINTiMINT-1682229.

    Structurei

    Secondary structure

    1
    1816
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi533 – 5353
    Beta strandi547 – 5504
    Beta strandi553 – 5597
    Beta strandi563 – 5653
    Beta strandi568 – 5703
    Beta strandi573 – 5753
    Beta strandi580 – 5878
    Beta strandi593 – 5975
    Beta strandi601 – 6033
    Beta strandi605 – 6073
    Beta strandi625 – 6295
    Beta strandi633 – 6353
    Helixi637 – 6404
    Turni641 – 6455

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2EH0NMR-A531-647[»]
    ProteinModelPortaliO60333.
    SMRiO60333. Positions 4-380, 471-647.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiO60333.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini5 – 354350Kinesin motorPROSITE-ProRule annotationAdd
    BLAST
    Domaini556 – 61257FHAPROSITE-ProRule annotationAdd
    BLAST
    Domaini1702 – 179998PHPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni270 – 35081Interaction with KBPAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili365 – 38622Sequence AnalysisAdd
    BLAST
    Coiled coili470 – 50233Sequence AnalysisAdd
    BLAST
    Coiled coili668 – 73770Sequence AnalysisAdd
    BLAST
    Coiled coili841 – 86929Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family. Unc-104 subfamily.PROSITE-ProRule annotation
    Contains 1 FHA domain.PROSITE-ProRule annotation
    Contains 1 kinesin motor domain.PROSITE-ProRule annotation
    Contains 1 PH domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiCOG5059.
    HOVERGENiHBG052251.
    KOiK10392.
    OMAiNRDAITE.
    OrthoDBiEOG77Q4VS.
    PhylomeDBiO60333.
    TreeFamiTF105221.

    Family and domain databases

    Gene3Di2.30.29.30. 1 hit.
    2.60.200.20. 1 hit.
    3.40.850.10. 1 hit.
    InterProiIPR000253. FHA_dom.
    IPR022140. KIF1B.
    IPR022164. Kinesin-like.
    IPR027640. Kinesin-like_fam.
    IPR019821. Kinesin_motor_CS.
    IPR001752. Kinesin_motor_dom.
    IPR027417. P-loop_NTPase.
    IPR001849. PH_domain.
    IPR011993. PH_like_dom.
    IPR008984. SMAD_FHA_domain.
    [Graphical view]
    PANTHERiPTHR24115. PTHR24115. 1 hit.
    PfamiPF12473. DUF3694. 1 hit.
    PF00498. FHA. 1 hit.
    PF12423. KIF1B. 1 hit.
    PF00225. Kinesin. 1 hit.
    PF00169. PH. 1 hit.
    [Graphical view]
    PRINTSiPR00380. KINESINHEAVY.
    SMARTiSM00240. FHA. 1 hit.
    SM00129. KISc. 1 hit.
    SM00233. PH. 1 hit.
    [Graphical view]
    SUPFAMiSSF49879. SSF49879. 1 hit.
    SSF52540. SSF52540. 1 hit.
    PROSITEiPS50006. FHA_DOMAIN. 1 hit.
    PS00411. KINESIN_MOTOR_1. 1 hit.
    PS50067. KINESIN_MOTOR_2. 1 hit.
    PS50003. PH_DOMAIN. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: O60333-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSGASVKVAV RVRPFNSRET SKESKCIIQM QGNSTSIINP KNPKEAPKSF     50
    SFDYSYWSHT SPEDPCFASQ NRVYNDIGKE MLLHAFEGYN VCIFAYGQTG 100
    AGKSYTMMGK QEESQAGIIP QLCEELFEKI NDNCNEEMSY SVEVSYMEIY 150
    CERVRDLLNP KNKGNLRVRE HPLLGPYVED LSKLAVTSYT DIADLMDAGN 200
    KARTVAATNM NETSSRSHAV FTIVFTQKKH DNETNLSTEK VSKISLVDLA 250
    GSERADSTGA KGTRLKEGAN INKSLTTLGK VISALAEVDN CTSKSKKKKK 300
    TDFIPYRDSV LTWLLRENLG GNSRTAMVAA LSPADINYDE TLSTLRYADR 350
    AKQIKCNAVI NEDPNAKLVR ELKEEVTRLK DLLRAQGLGD IIDIDPLIDD 400
    YSGSGSKYLK DFQNNKHRYL LASENQRPGH FSTASMGSLT SSPSSCSLSS 450
    QVGLTSVTSI QERIMSTPGG EEAIERLKES EKIIAELNET WEEKLRKTEA 500
    IRMEREALLA EMGVAIREDG GTLGVFSPKK TPHLVNLNED PLMSECLLYY 550
    IKDGITRVGQ ADAERRQDIV LSGAHIKEEH CIFRSERSNS GEVIVTLEPC 600
    ERSETYVNGK RVSQPVQLRS GNRIIMGKNH VFRFNHPEQA RAEREKTPSA 650
    ETPSEPVDWT FAQRELLEKQ GIDMKQEMEK RLQEMEILYK KEKEEADLLL 700
    EQQRLDYESK LQALQKQVET RSLAAETTEE EEEEEEVPWT QHEFELAQWA 750
    FRKWKSHQFT SLRDLLWGNA VYLKEANAIS VELKKKVQFQ FVLLTDTLYS 800
    PLPPELLPTE MEKTHEDRPF PRTVVAVEVQ DLKNGATHYW SLEKLKQRLD 850
    LMREMYDRAG EMASSAQDES ETTVTGSDPF YDRFHWFKLV GSSPIFHGCV 900
    NERLADRTPS PTFSTADSDI TELADEQQDE MEDFDDEAFV DDAGSDAGTE 950
    EGSDLFSDGH DPFYDRSPWF ILVGRAFVYL SNLLYPVPLI HRVAIVSEKG 1000
    EVRGFLRVAV QAIAADEEAP DYGSGIRQSG TAKISFDNEY FNQSDFSSVA 1050
    MTRSGLSLEE LRIVEGQGQS SEVITPPEEI SRINDLDLKS STLLDGKMVM 1100
    EGFSEEIGNH LKLGSAFTFR VTVLQASGIL PEYADIFCQF NFLHRHDEAF 1150
    STEPLKNNGR GSPLAFYHVQ NIAVEITESF VDYIKTKPIV FEVFGHYQQH 1200
    PLHLQGQELN SPPQPCRRFF PPPMPLSKPV PATKLNTMSK TSLGQSMSKY 1250
    DLLVWFEISE LEPTGEYIPA VVDHTAGLPC QGTFLLHQGI QRRITVTIIH 1300
    EKGSELHWKD VRELVVGRIR NKPEVDEAAV DAILSLNIIS AKYLKSSHNS 1350
    SRTFYRFEAV WDSSLHNSLL LNRVTPYGEK IYMTLSAYLE LDHCIQPAVI 1400
    TKDVCMVFYS RDAKISPPRS LRSLFGSGYS KSPDSNRVTG IYELSLCKMS 1450
    DTGSPGMQRR RRKILDTSVA YVRGEENLAG WRPRGDSLIL EHQWELEKLE 1500
    LLHEVEKTRH FLLLRERLGD SIPKSLSDSL SPSLSSGTLS TSTSISSQIS 1550
    TTTFESAITP SESSGYDSGD IESLVDREKE LATKCLQLLT HTFNREFSQV 1600
    HGSVSDCKLS DISPIGRDPS ESSFSSATLT PSSTCPSLVD SRSNSLDQKT 1650
    PEANSRASSP CPEFEQFQIV PAVETPYLAR AGKNEFLNLV PDIEEIRPSS 1700
    VVSKKGYLHF KEPLYSNWAK HFVVVRRPYV FIYNSDKDPV ERGIINLSTA 1750
    QVEYSEDQQA MVKTPNTFAV CTKHRGVLLQ ALNDKDMNDW LYAFNPLLAG 1800
    TIRSKLSRRC PSQSKY 1816
    Length:1,816
    Mass (Da):204,476
    Last modified:October 17, 2006 - v5
    Checksum:iAD62F0515978C783
    GO
    Isoform 2 (identifier: O60333-2) [UniParc]FASTAAdd to Basket

    Also known as: Beta

    The sequence of this isoform differs from the canonical sequence as follows:
         289-294: Missing.
         394-434: IDPLIDDYSGSGSKYLKDFQNNKHRYLLASENQRPGHFSTA → T

    Show »
    Length:1,770
    Mass (Da):199,263
    Checksum:i8AE6BB2665AF702C
    GO
    Isoform 3 (identifier: O60333-3) [UniParc]FASTAAdd to Basket

    Also known as: Alpha

    The sequence of this isoform differs from the canonical sequence as follows:
         289-294: Missing.
         394-434: IDPLIDDYSGSGSKYLKDFQNNKHRYLLASENQRPGHFSTA → T
         707-1196: YESKLQALQK...KPIVFEVFGH → ADSDSGDDSD...NLKAGRETTV
         1197-1816: Missing.

    Note: Contains a phosphoserine at position 1141. Contains a phosphoserine at position 663. Contains a phosphoserine at position 665.

    Show »
    Length:1,153
    Mass (Da):130,363
    Checksum:i6F0D8846CD283811
    GO
    Isoform 4 (identifier: O60333-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1804-1816: SKLSRRCPSQSKY → PGHLASEIIREDKSVSFSCQ

    Show »
    Length:1,823
    Mass (Da):205,140
    Checksum:iA53CAAD5693880E7
    GO

    Sequence cautioni

    The sequence AAH01415.1 differs from that shown. Reason: Erroneous initiation.
    The sequence AAP35838.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAA25517.2 differs from that shown. Reason: Erroneous initiation.
    The sequence BAA95972.2 differs from that shown. Reason: Erroneous initiation.
    The sequence BAB69038.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti87 – 871E → G in BAA25517. (PubMed:10819331)Curated
    Sequence conflicti129 – 1313KIN → TNH in AAK49332. (PubMed:11526494)Curated
    Sequence conflicti129 – 1313KIN → TNH in AAK85155. 1 PublicationCurated
    Sequence conflicti129 – 1313KIN → TNH in AAN17742. 1 PublicationCurated
    Sequence conflicti170 – 1701E → D in AAK49332. (PubMed:11526494)Curated
    Sequence conflicti170 – 1701E → D in AAK85155. 1 PublicationCurated
    Sequence conflicti170 – 1701E → D in AAN17742. 1 PublicationCurated
    Sequence conflicti174 – 1741L → R in AAK49332. (PubMed:11526494)Curated
    Sequence conflicti174 – 1741L → R in AAK85155. 1 PublicationCurated
    Sequence conflicti174 – 1741L → R in AAN17742. 1 PublicationCurated
    Sequence conflicti219 – 2213AVF → VVY in AAK49332. (PubMed:11526494)Curated
    Sequence conflicti219 – 2213AVF → VVY in AAK85155. 1 PublicationCurated
    Sequence conflicti219 – 2213AVF → VVY in AAN17742. 1 PublicationCurated
    Sequence conflicti235 – 2395NLSTE → ILATV in AAK49332. (PubMed:11526494)Curated
    Sequence conflicti235 – 2395NLSTE → ILATV in AAK85155. 1 PublicationCurated
    Sequence conflicti235 – 2395NLSTE → ILATV in AAN17742. 1 PublicationCurated
    Sequence conflicti244 – 2441I → T in AAK49332. (PubMed:11526494)Curated
    Sequence conflicti244 – 2441I → T in AAK85155. 1 PublicationCurated
    Sequence conflicti244 – 2441I → T in AAN17742. 1 PublicationCurated
    Sequence conflicti253 – 2531E → D in AAK49332. (PubMed:11526494)Curated
    Sequence conflicti253 – 2531E → D in AAK85155. 1 PublicationCurated
    Sequence conflicti253 – 2531E → D in AAN17742. 1 PublicationCurated
    Sequence conflicti256 – 2561D → A in AAK49332. (PubMed:11526494)Curated
    Sequence conflicti256 – 2561D → A in AAK85155. 1 PublicationCurated
    Sequence conflicti256 – 2561D → A in AAN17742. 1 PublicationCurated
    Sequence conflicti270 – 2701N → I in AAK49332. (PubMed:11526494)Curated
    Sequence conflicti270 – 2701N → I in AAK85155. 1 PublicationCurated
    Sequence conflicti270 – 2701N → I in AAN17742. 1 PublicationCurated
    Sequence conflicti363 – 3631D → G in BAB69038. (PubMed:10762626)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti34 – 341S → L in a medulloblastoma sample; somatic mutation; loss of ability to induce apoptosis. 1 Publication
    VAR_063531
    Natural varianti98 – 981Q → L in CMT2A1. 1 Publication
    VAR_011515
    Natural varianti692 – 6921E → V Confers susceptibility to neuroblastoma; found as germline mutation in a neuroblastoma patient; loss of ability to induce apoptosis. 1 Publication
    VAR_063532
    Natural varianti873 – 8731T → I Confers susceptibility to neuroblastoma; found as germline mutation in a neuroblastoma patient; loss of ability to induce apoptosis. 1 Publication
    Corresponds to variant rs121908162 [ dbSNP | Ensembl ].
    VAR_063533
    Natural varianti1133 – 11331Y → C.1 Publication
    Corresponds to variant rs2297881 [ dbSNP | Ensembl ].
    VAR_063534
    Natural varianti1263 – 12631P → S Confers susceptibility to neuroblastoma; found as germline mutation in a neuroblastoma patient; loss of ability to induce apoptosis. 1 Publication
    Corresponds to variant rs121908163 [ dbSNP | Ensembl ].
    VAR_063535
    Natural varianti1527 – 15271S → N Confers susceptibility to pheochromocytoma; found as germline mutation in a pheochromocytoma family; loss of ability to induce apoptosis. 1 Publication
    VAR_063536
    Natural varianti1600 – 16001V → M.1 Publication
    Corresponds to variant rs77172218 [ dbSNP | Ensembl ].
    VAR_063537
    Natural varianti1674 – 16741E → K in a pheochromocytoma sample; loss of ability to induce apoptosis. 1 Publication
    Corresponds to variant rs143669846 [ dbSNP | Ensembl ].
    VAR_063538

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei289 – 2946Missing in isoform 2 and isoform 3. 4 PublicationsVSP_002858
    Alternative sequencei394 – 43441IDPLI…HFSTA → T in isoform 2 and isoform 3. 4 PublicationsVSP_002859Add
    BLAST
    Alternative sequencei707 – 1196490YESKL…EVFGH → ADSDSGDDSDKRSCEESWKL ITSLREKLPPSKLQTIVKKC GLPSSGKKREPIKMYQIPQR RRLSKDSKWVTISDLKIQAV KEICYEVALNDFRHSRQEIE ALAIVKMKELCAMYGKKDPN ERDSWRAVARDVWDTVGVGD EKIEDVMATGKGSTDVDDLK VHIDKLEDILQEVKKQNNMK DEEIKVLRNKMLKMEKVLPL IGSQEQKSPGSHKAKEPVGA GVSSTSENNVSKGDNGELAK EERVSQLMNGDPAFRRGRLR WMRQEQIRFKNLQQQEITKQ LRRQNVPHRFIPPENRKPRF PFKSNPKHRNSWSPGTHIII TEDEVIELRIPKDDEARKGN KEESQEKGGKGAFKDPQFPW GSQGMRSQDHIQVSKQHINN QQQPPQLRWRSNSLNNGQPK STRCQASASAESLNSHSGHP TADVQTFQAKRHIHQHRQSY CNYNTGGQLEGNAATSYQKQ TDKPSHCSQFVTPPRMRRQF SAPNLKAGRETTV in isoform 3. 4 PublicationsVSP_002860Add
    BLAST
    Alternative sequencei1197 – 1816620Missing in isoform 3. 4 PublicationsVSP_002861Add
    BLAST
    Alternative sequencei1804 – 181613SKLSR…SQSKY → PGHLASEIIREDKSVSFSCQ in isoform 4. 2 PublicationsVSP_009381Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AX039604 Genomic DNA. Translation: CAC16629.1.
    AB017133 mRNA. Translation: BAB69038.1. Different initiation.
    AF257176 mRNA. Translation: AAK49332.1.
    AY043362 mRNA. Translation: AAK85155.1.
    AB088210 mRNA. Translation: BAE02543.1.
    AY139835 mRNA. Translation: AAN17742.1.
    AB011163 mRNA. Translation: BAA25517.2. Different initiation.
    AB040881 mRNA. Translation: BAA95972.2. Different initiation.
    AL139424, AL358013 Genomic DNA. Translation: CAI95752.1.
    AL139424, AL358013 Genomic DNA. Translation: CAI95753.1.
    AL358013, AL139424 Genomic DNA. Translation: CAI95219.1.
    AL358013, AL139424 Genomic DNA. Translation: CAI95220.1.
    AL358013, AL139424 Genomic DNA. Translation: CAI95221.1.
    AL358013 Genomic DNA. Translation: CAI95222.1.
    AL139424, AL358013 Genomic DNA. Translation: CAI95754.1.
    BC001415 mRNA. Translation: AAH01415.1. Different initiation.
    BC115395 mRNA. Translation: AAI15396.1.
    BT007174 mRNA. Translation: AAP35838.1. Different initiation.
    AK022977 mRNA. Translation: BAB14341.1.
    CCDSiCCDS111.1. [O60333-2]
    CCDS112.1. [O60333-3]
    RefSeqiNP_055889.2. NM_015074.3. [O60333-2]
    NP_904325.2. NM_183416.3. [O60333-3]
    UniGeneiHs.97858.

    Genome annotation databases

    EnsembliENST00000263934; ENSP00000263934; ENSG00000054523. [O60333-2]
    ENST00000377081; ENSP00000366284; ENSG00000054523. [O60333-4]
    ENST00000377083; ENSP00000366287; ENSG00000054523. [O60333-3]
    ENST00000377086; ENSP00000366290; ENSG00000054523. [O60333-1]
    ENST00000377093; ENSP00000366297; ENSG00000054523. [O60333-3]
    GeneIDi23095.
    KEGGihsa:23095.
    UCSCiuc001aqv.4. human. [O60333-3]
    uc001aqw.4. human. [O60333-2]
    uc001aqx.4. human. [O60333-1]
    uc001aqz.3. human. [O60333-4]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    Inherited peripheral neuropathies mutation db

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AX039604 Genomic DNA. Translation: CAC16629.1 .
    AB017133 mRNA. Translation: BAB69038.1 . Different initiation.
    AF257176 mRNA. Translation: AAK49332.1 .
    AY043362 mRNA. Translation: AAK85155.1 .
    AB088210 mRNA. Translation: BAE02543.1 .
    AY139835 mRNA. Translation: AAN17742.1 .
    AB011163 mRNA. Translation: BAA25517.2 . Different initiation.
    AB040881 mRNA. Translation: BAA95972.2 . Different initiation.
    AL139424 , AL358013 Genomic DNA. Translation: CAI95752.1 .
    AL139424 , AL358013 Genomic DNA. Translation: CAI95753.1 .
    AL358013 , AL139424 Genomic DNA. Translation: CAI95219.1 .
    AL358013 , AL139424 Genomic DNA. Translation: CAI95220.1 .
    AL358013 , AL139424 Genomic DNA. Translation: CAI95221.1 .
    AL358013 Genomic DNA. Translation: CAI95222.1 .
    AL139424 , AL358013 Genomic DNA. Translation: CAI95754.1 .
    BC001415 mRNA. Translation: AAH01415.1 . Different initiation.
    BC115395 mRNA. Translation: AAI15396.1 .
    BT007174 mRNA. Translation: AAP35838.1 . Different initiation.
    AK022977 mRNA. Translation: BAB14341.1 .
    CCDSi CCDS111.1. [O60333-2 ]
    CCDS112.1. [O60333-3 ]
    RefSeqi NP_055889.2. NM_015074.3. [O60333-2 ]
    NP_904325.2. NM_183416.3. [O60333-3 ]
    UniGenei Hs.97858.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2EH0 NMR - A 531-647 [» ]
    ProteinModelPortali O60333.
    SMRi O60333. Positions 4-380, 471-647.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 116723. 15 interactions.
    DIPi DIP-33015N.
    IntActi O60333. 23 interactions.
    MINTi MINT-1682229.

    Chemistry

    BindingDBi O60333.
    ChEMBLi CHEMBL5889.

    PTM databases

    PhosphoSitei O60333.

    Proteomic databases

    MaxQBi O60333.
    PaxDbi O60333.
    PRIDEi O60333.

    Protocols and materials databases

    DNASUi 23095.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000263934 ; ENSP00000263934 ; ENSG00000054523 . [O60333-2 ]
    ENST00000377081 ; ENSP00000366284 ; ENSG00000054523 . [O60333-4 ]
    ENST00000377083 ; ENSP00000366287 ; ENSG00000054523 . [O60333-3 ]
    ENST00000377086 ; ENSP00000366290 ; ENSG00000054523 . [O60333-1 ]
    ENST00000377093 ; ENSP00000366297 ; ENSG00000054523 . [O60333-3 ]
    GeneIDi 23095.
    KEGGi hsa:23095.
    UCSCi uc001aqv.4. human. [O60333-3 ]
    uc001aqw.4. human. [O60333-2 ]
    uc001aqx.4. human. [O60333-1 ]
    uc001aqz.3. human. [O60333-4 ]

    Organism-specific databases

    CTDi 23095.
    GeneCardsi GC01P010270.
    HGNCi HGNC:16636. KIF1B.
    HPAi CAB015177.
    HPA026434.
    MIMi 118210. phenotype.
    171300. phenotype.
    256700. phenotype.
    605995. gene.
    neXtProti NX_O60333.
    Orphaneti 99946. Autosomal dominant Charcot-Marie-Tooth disease type 2A1.
    PharmGKBi PA38176.
    HUGEi Search...
    Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5059.
    HOVERGENi HBG052251.
    KOi K10392.
    OMAi NRDAITE.
    OrthoDBi EOG77Q4VS.
    PhylomeDBi O60333.
    TreeFami TF105221.

    Miscellaneous databases

    ChiTaRSi KIF1B. human.
    EvolutionaryTracei O60333.
    GeneWikii KIF1B.
    GenomeRNAii 23095.
    NextBioi 44259.
    PROi O60333.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi O60333.
    Bgeei O60333.
    CleanExi HS_KIF1B.
    Genevestigatori O60333.

    Family and domain databases

    Gene3Di 2.30.29.30. 1 hit.
    2.60.200.20. 1 hit.
    3.40.850.10. 1 hit.
    InterProi IPR000253. FHA_dom.
    IPR022140. KIF1B.
    IPR022164. Kinesin-like.
    IPR027640. Kinesin-like_fam.
    IPR019821. Kinesin_motor_CS.
    IPR001752. Kinesin_motor_dom.
    IPR027417. P-loop_NTPase.
    IPR001849. PH_domain.
    IPR011993. PH_like_dom.
    IPR008984. SMAD_FHA_domain.
    [Graphical view ]
    PANTHERi PTHR24115. PTHR24115. 1 hit.
    Pfami PF12473. DUF3694. 1 hit.
    PF00498. FHA. 1 hit.
    PF12423. KIF1B. 1 hit.
    PF00225. Kinesin. 1 hit.
    PF00169. PH. 1 hit.
    [Graphical view ]
    PRINTSi PR00380. KINESINHEAVY.
    SMARTi SM00240. FHA. 1 hit.
    SM00129. KISc. 1 hit.
    SM00233. PH. 1 hit.
    [Graphical view ]
    SUPFAMi SSF49879. SSF49879. 1 hit.
    SSF52540. SSF52540. 1 hit.
    PROSITEi PS50006. FHA_DOMAIN. 1 hit.
    PS00411. KINESIN_MOTOR_1. 1 hit.
    PS50067. KINESIN_MOTOR_2. 1 hit.
    PS50003. PH_DOMAIN. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "DNA encoding a kinesin-like protein (hklp) comprising biallelic markers."
      Bougueleret L., Dufaure-Gare I., Grel P.
      Patent number WO0063375, 26-OCT-2000
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1).
    2. "Identification of the full-length KIAA0591 gene encoding a novel kinesin-related protein which is mapped to the neuroblastoma suppressor gene locus at 1p36.2."
      Nagai M., Ichimiya S., Ozaki T., Seki N., Mihara M., Furuta S., Ohira M., Tomioka N., Nomura N., Sakiyama S., Kubo O., Takakura K., Hori T., Nakagawara A.
      Int. J. Oncol. 16:907-916(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), TISSUE SPECIFICITY.
      Tissue: Substantia nigra.
    3. "Genomic structure and mutational analysis of the human KIF1B gene which is homozygously deleted in neuroblastoma at chromosome 1p36.2."
      Yang H.W., Chen Y.Z., Takita J., Soeda E., Piao H.Y., Hayashi Y.
      Oncogene 20:5075-5083(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 2), TISSUE SPECIFICITY.
    4. "Identification of the human ortholog of mouse Kif1B, a kinesin superfamily motor protein."
      Park M., Shin H., Lee Y.M., Moon E., Choi W., Kim W.
      Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
    5. "Identification of splicing variants of KIF1Bbeta."
      Munirajan A.K., Ohira M., Nakagawara A.
      Submitted (JUL-2002) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
    6. "Genomic structure and mutational analysis of the human KIF1Balpha gene located at 1p36.2 in neuroblastoma."
      Chen Y.Y., Takita J., Chen Y.Z., Yang H.W., Hanada R., Yamamoto K., Hayashi Y.
      Int. J. Oncol. 23:737-744(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY.
      Tissue: Neuroblastoma.
    7. "Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
      Nagase T., Ishikawa K., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
      DNA Res. 5:31-39(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    8. "Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
      DNA Res. 7:143-150(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Brain.
    9. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1238-1816 (ISOFORMS 1/2).
      Tissue: Placenta.
    11. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
      Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
      Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1238-1816 (ISOFORMS 1/2).
    12. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1449-1816 (ISOFORMS 1/2).
    13. "The novel protein KBP regulates mitochondria localization by interaction with a kinesin-like protein."
      Wozniak M.J., Melzer M., Dorner C., Haring H.U., Lammers R.
      BMC Cell Biol. 6:35-35(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH KBP, SUBCELLULAR LOCATION.
    14. Cited for: FUNCTION, INVOLVEMENT IN NEUROBLASTOMA AND PHEOCHROMOCYTOMA, VARIANTS LEU-34; VAL-692; ILE-873; CYS-1133; SER-1263; ASN-1527; MET-1600 AND LYS-1674.
    15. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1057, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    16. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    17. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-1075 AND SER-1487, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    18. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1057; SER-1454; SER-1487; SER-1610 AND SER-1613, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1141 (ISOFORM 3), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    19. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    20. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-663 AND SER-665 (ISOFORM 3), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    21. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT SER-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
    22. "Charcot-Marie-Tooth disease type 2A caused by mutation in a microtubule motor KIF1B-beta."
      Zhao C., Takita J., Tanaka Y., Setou M., Nakagawa T., Takeda S., Yang H.W., Terada S., Nakata T., Takei Y., Saito M., Tsuji S., Hayashi Y., Hirokawa N.
      Cell 105:587-597(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT CMT2A1 LEU-98.

    Entry informationi

    Entry nameiKIF1B_HUMAN
    AccessioniPrimary (citable) accession number: O60333
    Secondary accession number(s): A6NFS8
    , A6NKQ4, Q4VXC3, Q4VXC4, Q4VXC5, Q4VXC6, Q96Q94, Q9BV80, Q9P280
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 11, 2001
    Last sequence update: October 17, 2006
    Last modified: October 1, 2014
    This is version 159 of the entry and version 5 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3