Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kinesin-like protein KIF1B

Gene

KIF1B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Motor for anterograde transport of mitochondria. Has a microtubule plus end-directed motility. Isoform 2 is required for induction of neuronal apoptosis.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi97 – 104ATPPROSITE-ProRule annotation8

GO - Molecular functioni

  • ATPase activity Source: UniProtKB
  • ATP binding Source: UniProtKB-KW
  • kinesin binding Source: UniProtKB
  • microtubule motor activity Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Motor protein

Keywords - Biological processi

Apoptosis

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000054523-MONOMER.
ReactomeiR-HSA-6811434. COPI-dependent Golgi-to-ER retrograde traffic.
R-HSA-983189. Kinesins.

Names & Taxonomyi

Protein namesi
Recommended name:
Kinesin-like protein KIF1B
Short name:
Klp
Gene namesi
Name:KIF1B
Synonyms:KIAA0591, KIAA1448
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:16636. KIF1B.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Microtubule, Mitochondrion

Pathology & Biotechi

Involvement in diseasei

Charcot-Marie-Tooth disease 2A1 (CMT2A1)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA dominant axonal form of Charcot-Marie-Tooth disease, a disorder of the peripheral nervous system, characterized by progressive weakness and atrophy, initially of the peroneal muscles and later of the distal muscles of the arms. Charcot-Marie-Tooth disease is classified in two main groups on the basis of electrophysiologic properties and histopathology: primary peripheral demyelinating neuropathies (designated CMT1 when they are dominantly inherited) and primary peripheral axonal neuropathies (CMT2). Neuropathies of the CMT2 group are characterized by signs of axonal degeneration in the absence of obvious myelin alterations, normal or slightly reduced nerve conduction velocities, and progressive distal muscle weakness and atrophy. Nerve conduction velocities are normal or slightly reduced.
See also OMIM:118210
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01151598Q → L in CMT2A1. 1 PublicationCorresponds to variant rs121908160dbSNPEnsembl.1
Neuroblastoma 1 (NBLST1)
Disease susceptibility is associated with variations affecting the gene represented in this entry.
Disease descriptionA common neoplasm of early childhood arising from embryonic cells that form the primitive neural crest and give rise to the adrenal medulla and the sympathetic nervous system.
See also OMIM:256700
Pheochromocytoma (PCC)1 Publication
Disease susceptibility is associated with variations affecting the gene represented in this entry.
Disease descriptionA catecholamine-producing tumor of chromaffin tissue of the adrenal medulla or sympathetic paraganglia. The cardinal symptom, reflecting the increased secretion of epinephrine and norepinephrine, is hypertension, which may be persistent or intermittent.
See also OMIM:171300

Keywords - Diseasei

Charcot-Marie-Tooth disease, Disease mutation, Neurodegeneration, Neuropathy

Organism-specific databases

DisGeNETi23095.
MalaCardsiKIF1B.
MIMi118210. phenotype.
171300. phenotype.
256700. phenotype.
OpenTargetsiENSG00000054523.
Orphaneti99946. Autosomal dominant Charcot-Marie-Tooth disease type 2A1.
PharmGKBiPA38176.

Chemistry databases

ChEMBLiCHEMBL5889.

Polymorphism and mutation databases

BioMutaiKIF1B.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00001254072 – 1816Kinesin-like protein KIF1BAdd BLAST1815

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylserineCombined sources1
Modified residuei647PhosphothreonineBy similarity1
Modified residuei652PhosphothreonineBy similarity1
Modified residuei1054PhosphoserineCombined sources1
Modified residuei1057PhosphoserineCombined sources1
Modified residuei1075PhosphothreonineCombined sources1
Modified residuei1416PhosphoserineCombined sources1
Modified residuei1454PhosphoserineCombined sources1
Modified residuei1487PhosphoserineCombined sources1
Modified residuei1573PhosphoserineCombined sources1
Modified residuei1603PhosphoserineCombined sources1
Modified residuei1610PhosphoserineCombined sources1
Modified residuei1613PhosphoserineCombined sources1
Isoform 3 (identifier: O60333-3)
Modified residuei663PhosphoserineCombined sources1
Modified residuei665PhosphoserineCombined sources1
Modified residuei1141PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiO60333.
MaxQBiO60333.
PaxDbiO60333.
PeptideAtlasiO60333.
PRIDEiO60333.

PTM databases

iPTMnetiO60333.
PhosphoSitePlusiO60333.
SwissPalmiO60333.

Expressioni

Tissue specificityi

Isoform 3 is abundant in the skeletal muscle. It is also expressed in fetal brain, lung and kidney, and adult heart, placenta, testis, ovary and small intestine. Isoform 2 is abundant in the brain and also expressed in fetal heart, lung, liver and kidney, and adult skeletal muscle, placenta, liver, kidney, heart, spleen, thymus, prostate, testis, ovary, small intestine, colon and pancreas.3 Publications

Gene expression databases

BgeeiENSG00000054523.
CleanExiHS_KIF1B.
ExpressionAtlasiO60333. baseline and differential.
GenevisibleiO60333. HS.

Organism-specific databases

HPAiCAB015177.
HPA026434.

Interactioni

Subunit structurei

Interacts (via C-terminus end of the kinesin-motor domain) with CHP1; the interaction occurs in a calcium-dependent manner (By similarity). Interacts with KBP.By similarity1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
CLASP1Q7Z4603EBI-465633,EBI-913476
DLG1Q129594EBI-465669,EBI-357481
Dlg2Q636223EBI-465669,EBI-396947From a different organism.
DLG4P783524EBI-465669,EBI-80389
MAGI1Q96QZ73EBI-465669,EBI-924464
SIAH1Q8IUQ43EBI-465633,EBI-747107

GO - Molecular functioni

  • kinesin binding Source: UniProtKB

Protein-protein interaction databases

BioGridi116723. 47 interactors.
DIPiDIP-33015N.
IntActiO60333. 41 interactors.
MINTiMINT-1682229.
STRINGi9606.ENSP00000263934.

Chemistry databases

BindingDBiO60333.

Structurei

Secondary structure

11816
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi533 – 535Combined sources3
Beta strandi547 – 550Combined sources4
Beta strandi553 – 559Combined sources7
Beta strandi563 – 565Combined sources3
Beta strandi568 – 570Combined sources3
Beta strandi573 – 575Combined sources3
Beta strandi580 – 587Combined sources8
Beta strandi593 – 597Combined sources5
Beta strandi601 – 603Combined sources3
Beta strandi605 – 607Combined sources3
Beta strandi625 – 629Combined sources5
Beta strandi633 – 635Combined sources3
Helixi637 – 640Combined sources4
Turni641 – 645Combined sources5

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2EH0NMR-A531-647[»]
ProteinModelPortaliO60333.
SMRiO60333.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO60333.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini5 – 354Kinesin motorPROSITE-ProRule annotationAdd BLAST350
Domaini556 – 612FHAPROSITE-ProRule annotationAdd BLAST57
Domaini1702 – 1799PHPROSITE-ProRule annotationAdd BLAST98

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni270 – 350Interaction with KBP1 PublicationAdd BLAST81

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili365 – 386Sequence analysisAdd BLAST22
Coiled coili470 – 502Sequence analysisAdd BLAST33
Coiled coili668 – 737Sequence analysisAdd BLAST70
Coiled coili841 – 869Sequence analysisAdd BLAST29

Sequence similaritiesi

Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family. Unc-104 subfamily.PROSITE-ProRule annotation
Contains 1 FHA domain.PROSITE-ProRule annotation
Contains 1 kinesin motor domain.PROSITE-ProRule annotation
Contains 1 PH domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG0245. Eukaryota.
COG5059. LUCA.
GeneTreeiENSGT00840000129680.
HOGENOMiHOG000165968.
HOVERGENiHBG052251.
InParanoidiO60333.
KOiK10392.
OMAiGQSMSKY.
OrthoDBiEOG091G009V.
PhylomeDBiO60333.
TreeFamiTF105221.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
2.60.200.20. 1 hit.
3.40.850.10. 1 hit.
InterProiIPR000253. FHA_dom.
IPR022164. Kinesin-like.
IPR027640. Kinesin-like_fam.
IPR022140. Kinesin-like_KIF1-typ.
IPR032405. Kinesin_assoc.
IPR019821. Kinesin_motor_CS.
IPR001752. Kinesin_motor_dom.
IPR027417. P-loop_NTPase.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR008984. SMAD_FHA_domain.
[Graphical view]
PANTHERiPTHR24115. PTHR24115. 3 hits.
PfamiPF12473. DUF3694. 1 hit.
PF00498. FHA. 1 hit.
PF12423. KIF1B. 1 hit.
PF00225. Kinesin. 1 hit.
PF16183. Kinesin_assoc. 1 hit.
PF00169. PH. 1 hit.
[Graphical view]
PRINTSiPR00380. KINESINHEAVY.
SMARTiSM00240. FHA. 1 hit.
SM00129. KISc. 1 hit.
SM00233. PH. 1 hit.
[Graphical view]
SUPFAMiSSF49879. SSF49879. 1 hit.
SSF50729. SSF50729. 2 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS50006. FHA_DOMAIN. 1 hit.
PS00411. KINESIN_MOTOR_1. 1 hit.
PS50067. KINESIN_MOTOR_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O60333-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSGASVKVAV RVRPFNSRET SKESKCIIQM QGNSTSIINP KNPKEAPKSF
60 70 80 90 100
SFDYSYWSHT SPEDPCFASQ NRVYNDIGKE MLLHAFEGYN VCIFAYGQTG
110 120 130 140 150
AGKSYTMMGK QEESQAGIIP QLCEELFEKI NDNCNEEMSY SVEVSYMEIY
160 170 180 190 200
CERVRDLLNP KNKGNLRVRE HPLLGPYVED LSKLAVTSYT DIADLMDAGN
210 220 230 240 250
KARTVAATNM NETSSRSHAV FTIVFTQKKH DNETNLSTEK VSKISLVDLA
260 270 280 290 300
GSERADSTGA KGTRLKEGAN INKSLTTLGK VISALAEVDN CTSKSKKKKK
310 320 330 340 350
TDFIPYRDSV LTWLLRENLG GNSRTAMVAA LSPADINYDE TLSTLRYADR
360 370 380 390 400
AKQIKCNAVI NEDPNAKLVR ELKEEVTRLK DLLRAQGLGD IIDIDPLIDD
410 420 430 440 450
YSGSGSKYLK DFQNNKHRYL LASENQRPGH FSTASMGSLT SSPSSCSLSS
460 470 480 490 500
QVGLTSVTSI QERIMSTPGG EEAIERLKES EKIIAELNET WEEKLRKTEA
510 520 530 540 550
IRMEREALLA EMGVAIREDG GTLGVFSPKK TPHLVNLNED PLMSECLLYY
560 570 580 590 600
IKDGITRVGQ ADAERRQDIV LSGAHIKEEH CIFRSERSNS GEVIVTLEPC
610 620 630 640 650
ERSETYVNGK RVSQPVQLRS GNRIIMGKNH VFRFNHPEQA RAEREKTPSA
660 670 680 690 700
ETPSEPVDWT FAQRELLEKQ GIDMKQEMEK RLQEMEILYK KEKEEADLLL
710 720 730 740 750
EQQRLDYESK LQALQKQVET RSLAAETTEE EEEEEEVPWT QHEFELAQWA
760 770 780 790 800
FRKWKSHQFT SLRDLLWGNA VYLKEANAIS VELKKKVQFQ FVLLTDTLYS
810 820 830 840 850
PLPPELLPTE MEKTHEDRPF PRTVVAVEVQ DLKNGATHYW SLEKLKQRLD
860 870 880 890 900
LMREMYDRAG EMASSAQDES ETTVTGSDPF YDRFHWFKLV GSSPIFHGCV
910 920 930 940 950
NERLADRTPS PTFSTADSDI TELADEQQDE MEDFDDEAFV DDAGSDAGTE
960 970 980 990 1000
EGSDLFSDGH DPFYDRSPWF ILVGRAFVYL SNLLYPVPLI HRVAIVSEKG
1010 1020 1030 1040 1050
EVRGFLRVAV QAIAADEEAP DYGSGIRQSG TAKISFDNEY FNQSDFSSVA
1060 1070 1080 1090 1100
MTRSGLSLEE LRIVEGQGQS SEVITPPEEI SRINDLDLKS STLLDGKMVM
1110 1120 1130 1140 1150
EGFSEEIGNH LKLGSAFTFR VTVLQASGIL PEYADIFCQF NFLHRHDEAF
1160 1170 1180 1190 1200
STEPLKNNGR GSPLAFYHVQ NIAVEITESF VDYIKTKPIV FEVFGHYQQH
1210 1220 1230 1240 1250
PLHLQGQELN SPPQPCRRFF PPPMPLSKPV PATKLNTMSK TSLGQSMSKY
1260 1270 1280 1290 1300
DLLVWFEISE LEPTGEYIPA VVDHTAGLPC QGTFLLHQGI QRRITVTIIH
1310 1320 1330 1340 1350
EKGSELHWKD VRELVVGRIR NKPEVDEAAV DAILSLNIIS AKYLKSSHNS
1360 1370 1380 1390 1400
SRTFYRFEAV WDSSLHNSLL LNRVTPYGEK IYMTLSAYLE LDHCIQPAVI
1410 1420 1430 1440 1450
TKDVCMVFYS RDAKISPPRS LRSLFGSGYS KSPDSNRVTG IYELSLCKMS
1460 1470 1480 1490 1500
DTGSPGMQRR RRKILDTSVA YVRGEENLAG WRPRGDSLIL EHQWELEKLE
1510 1520 1530 1540 1550
LLHEVEKTRH FLLLRERLGD SIPKSLSDSL SPSLSSGTLS TSTSISSQIS
1560 1570 1580 1590 1600
TTTFESAITP SESSGYDSGD IESLVDREKE LATKCLQLLT HTFNREFSQV
1610 1620 1630 1640 1650
HGSVSDCKLS DISPIGRDPS ESSFSSATLT PSSTCPSLVD SRSNSLDQKT
1660 1670 1680 1690 1700
PEANSRASSP CPEFEQFQIV PAVETPYLAR AGKNEFLNLV PDIEEIRPSS
1710 1720 1730 1740 1750
VVSKKGYLHF KEPLYSNWAK HFVVVRRPYV FIYNSDKDPV ERGIINLSTA
1760 1770 1780 1790 1800
QVEYSEDQQA MVKTPNTFAV CTKHRGVLLQ ALNDKDMNDW LYAFNPLLAG
1810
TIRSKLSRRC PSQSKY
Length:1,816
Mass (Da):204,476
Last modified:October 17, 2006 - v5
Checksum:iAD62F0515978C783
GO
Isoform 2 (identifier: O60333-2) [UniParc]FASTAAdd to basket
Also known as: Beta

The sequence of this isoform differs from the canonical sequence as follows:
     289-294: Missing.
     394-434: IDPLIDDYSGSGSKYLKDFQNNKHRYLLASENQRPGHFSTA → T

Show »
Length:1,770
Mass (Da):199,263
Checksum:i8AE6BB2665AF702C
GO
Isoform 3 (identifier: O60333-3) [UniParc]FASTAAdd to basket
Also known as: Alpha

The sequence of this isoform differs from the canonical sequence as follows:
     289-294: Missing.
     394-434: IDPLIDDYSGSGSKYLKDFQNNKHRYLLASENQRPGHFSTA → T
     707-1196: YESKLQALQK...KPIVFEVFGH → ADSDSGDDSD...NLKAGRETTV
     1197-1816: Missing.

Show »
Length:1,153
Mass (Da):130,363
Checksum:i6F0D8846CD283811
GO
Isoform 4 (identifier: O60333-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1804-1816: SKLSRRCPSQSKY → PGHLASEIIREDKSVSFSCQ

Show »
Length:1,823
Mass (Da):205,140
Checksum:iA53CAAD5693880E7
GO

Sequence cautioni

The sequence AAH01415 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAP35838 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAA25517 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAA95972 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB69038 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti87E → G in BAA25517 (PubMed:10819331).Curated1
Sequence conflicti129 – 131KIN → TNH in AAK49332 (PubMed:11526494).Curated3
Sequence conflicti129 – 131KIN → TNH in AAK85155 (Ref. 4) Curated3
Sequence conflicti129 – 131KIN → TNH in AAN17742 (Ref. 5) Curated3
Sequence conflicti170E → D in AAK49332 (PubMed:11526494).Curated1
Sequence conflicti170E → D in AAK85155 (Ref. 4) Curated1
Sequence conflicti170E → D in AAN17742 (Ref. 5) Curated1
Sequence conflicti174L → R in AAK49332 (PubMed:11526494).Curated1
Sequence conflicti174L → R in AAK85155 (Ref. 4) Curated1
Sequence conflicti174L → R in AAN17742 (Ref. 5) Curated1
Sequence conflicti219 – 221AVF → VVY in AAK49332 (PubMed:11526494).Curated3
Sequence conflicti219 – 221AVF → VVY in AAK85155 (Ref. 4) Curated3
Sequence conflicti219 – 221AVF → VVY in AAN17742 (Ref. 5) Curated3
Sequence conflicti235 – 239NLSTE → ILATV in AAK49332 (PubMed:11526494).Curated5
Sequence conflicti235 – 239NLSTE → ILATV in AAK85155 (Ref. 4) Curated5
Sequence conflicti235 – 239NLSTE → ILATV in AAN17742 (Ref. 5) Curated5
Sequence conflicti244I → T in AAK49332 (PubMed:11526494).Curated1
Sequence conflicti244I → T in AAK85155 (Ref. 4) Curated1
Sequence conflicti244I → T in AAN17742 (Ref. 5) Curated1
Sequence conflicti253E → D in AAK49332 (PubMed:11526494).Curated1
Sequence conflicti253E → D in AAK85155 (Ref. 4) Curated1
Sequence conflicti253E → D in AAN17742 (Ref. 5) Curated1
Sequence conflicti256D → A in AAK49332 (PubMed:11526494).Curated1
Sequence conflicti256D → A in AAK85155 (Ref. 4) Curated1
Sequence conflicti256D → A in AAN17742 (Ref. 5) Curated1
Sequence conflicti270N → I in AAK49332 (PubMed:11526494).Curated1
Sequence conflicti270N → I in AAK85155 (Ref. 4) Curated1
Sequence conflicti270N → I in AAN17742 (Ref. 5) Curated1
Sequence conflicti363D → G in BAB69038 (PubMed:10762626).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06353134S → L in a medulloblastoma sample; somatic mutation; loss of ability to induce apoptosis. 1 Publication1
Natural variantiVAR_01151598Q → L in CMT2A1. 1 PublicationCorresponds to variant rs121908160dbSNPEnsembl.1
Natural variantiVAR_063532692E → V Confers susceptibility to neuroblastoma; found as germline mutation in a neuroblastoma patient; loss of ability to induce apoptosis. 1 PublicationCorresponds to variant rs121908161dbSNPEnsembl.1
Natural variantiVAR_063533873T → I Confers susceptibility to neuroblastoma; found as germline mutation in a neuroblastoma patient; loss of ability to induce apoptosis. 1 PublicationCorresponds to variant rs121908162dbSNPEnsembl.1
Natural variantiVAR_0635341133Y → C.1 PublicationCorresponds to variant rs2297881dbSNPEnsembl.1
Natural variantiVAR_0635351263P → S Confers susceptibility to neuroblastoma; found as germline mutation in a neuroblastoma patient; loss of ability to induce apoptosis. 1 PublicationCorresponds to variant rs121908163dbSNPEnsembl.1
Natural variantiVAR_0635361527S → N Confers susceptibility to pheochromocytoma; found as germline mutation in a pheochromocytoma family; loss of ability to induce apoptosis. 1 PublicationCorresponds to variant rs121908164dbSNPEnsembl.1
Natural variantiVAR_0635371600V → M.1 PublicationCorresponds to variant rs77172218dbSNPEnsembl.1
Natural variantiVAR_0635381674E → K in a pheochromocytoma sample; loss of ability to induce apoptosis. 1 PublicationCorresponds to variant rs143669846dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_002858289 – 294Missing in isoform 2 and isoform 3. 4 Publications6
Alternative sequenceiVSP_002859394 – 434IDPLI…HFSTA → T in isoform 2 and isoform 3. 4 PublicationsAdd BLAST41
Alternative sequenceiVSP_002860707 – 1196YESKL…EVFGH → ADSDSGDDSDKRSCEESWKL ITSLREKLPPSKLQTIVKKC GLPSSGKKREPIKMYQIPQR RRLSKDSKWVTISDLKIQAV KEICYEVALNDFRHSRQEIE ALAIVKMKELCAMYGKKDPN ERDSWRAVARDVWDTVGVGD EKIEDVMATGKGSTDVDDLK VHIDKLEDILQEVKKQNNMK DEEIKVLRNKMLKMEKVLPL IGSQEQKSPGSHKAKEPVGA GVSSTSENNVSKGDNGELAK EERVSQLMNGDPAFRRGRLR WMRQEQIRFKNLQQQEITKQ LRRQNVPHRFIPPENRKPRF PFKSNPKHRNSWSPGTHIII TEDEVIELRIPKDDEARKGN KEESQEKGGKGAFKDPQFPW GSQGMRSQDHIQVSKQHINN QQQPPQLRWRSNSLNNGQPK STRCQASASAESLNSHSGHP TADVQTFQAKRHIHQHRQSY CNYNTGGQLEGNAATSYQKQ TDKPSHCSQFVTPPRMRRQF SAPNLKAGRETTV in isoform 3. 4 PublicationsAdd BLAST490
Alternative sequenceiVSP_0028611197 – 1816Missing in isoform 3. 4 PublicationsAdd BLAST620
Alternative sequenceiVSP_0093811804 – 1816SKLSR…SQSKY → PGHLASEIIREDKSVSFSCQ in isoform 4. 2 PublicationsAdd BLAST13

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AX039604 Genomic DNA. Translation: CAC16629.1.
AB017133 mRNA. Translation: BAB69038.1. Different initiation.
AF257176 mRNA. Translation: AAK49332.1.
AY043362 mRNA. Translation: AAK85155.1.
AB088210 mRNA. Translation: BAE02543.1.
AY139835 mRNA. Translation: AAN17742.1.
AB011163 mRNA. Translation: BAA25517.2. Different initiation.
AB040881 mRNA. Translation: BAA95972.2. Different initiation.
AL139424, AL358013 Genomic DNA. Translation: CAI95752.1.
AL139424, AL358013 Genomic DNA. Translation: CAI95753.1.
AL358013, AL139424 Genomic DNA. Translation: CAI95219.1.
AL358013, AL139424 Genomic DNA. Translation: CAI95220.1.
AL358013, AL139424 Genomic DNA. Translation: CAI95221.1.
AL358013 Genomic DNA. Translation: CAI95222.1.
AL139424, AL358013 Genomic DNA. Translation: CAI95754.1.
BC001415 mRNA. Translation: AAH01415.1. Different initiation.
BC115395 mRNA. Translation: AAI15396.1.
BT007174 mRNA. Translation: AAP35838.1. Different initiation.
AK022977 mRNA. Translation: BAB14341.1.
CCDSiCCDS111.1. [O60333-2]
CCDS112.1. [O60333-3]
RefSeqiNP_055889.2. NM_015074.3. [O60333-2]
NP_904325.2. NM_183416.3. [O60333-3]
UniGeneiHs.97858.

Genome annotation databases

EnsembliENST00000263934; ENSP00000263934; ENSG00000054523. [O60333-2]
ENST00000377081; ENSP00000366284; ENSG00000054523. [O60333-4]
ENST00000377083; ENSP00000366287; ENSG00000054523. [O60333-3]
ENST00000377086; ENSP00000366290; ENSG00000054523. [O60333-1]
ENST00000377093; ENSP00000366297; ENSG00000054523. [O60333-3]
GeneIDi23095.
KEGGihsa:23095.
UCSCiuc001aqv.5. human. [O60333-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Inherited peripheral neuropathies mutation db

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AX039604 Genomic DNA. Translation: CAC16629.1.
AB017133 mRNA. Translation: BAB69038.1. Different initiation.
AF257176 mRNA. Translation: AAK49332.1.
AY043362 mRNA. Translation: AAK85155.1.
AB088210 mRNA. Translation: BAE02543.1.
AY139835 mRNA. Translation: AAN17742.1.
AB011163 mRNA. Translation: BAA25517.2. Different initiation.
AB040881 mRNA. Translation: BAA95972.2. Different initiation.
AL139424, AL358013 Genomic DNA. Translation: CAI95752.1.
AL139424, AL358013 Genomic DNA. Translation: CAI95753.1.
AL358013, AL139424 Genomic DNA. Translation: CAI95219.1.
AL358013, AL139424 Genomic DNA. Translation: CAI95220.1.
AL358013, AL139424 Genomic DNA. Translation: CAI95221.1.
AL358013 Genomic DNA. Translation: CAI95222.1.
AL139424, AL358013 Genomic DNA. Translation: CAI95754.1.
BC001415 mRNA. Translation: AAH01415.1. Different initiation.
BC115395 mRNA. Translation: AAI15396.1.
BT007174 mRNA. Translation: AAP35838.1. Different initiation.
AK022977 mRNA. Translation: BAB14341.1.
CCDSiCCDS111.1. [O60333-2]
CCDS112.1. [O60333-3]
RefSeqiNP_055889.2. NM_015074.3. [O60333-2]
NP_904325.2. NM_183416.3. [O60333-3]
UniGeneiHs.97858.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2EH0NMR-A531-647[»]
ProteinModelPortaliO60333.
SMRiO60333.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116723. 47 interactors.
DIPiDIP-33015N.
IntActiO60333. 41 interactors.
MINTiMINT-1682229.
STRINGi9606.ENSP00000263934.

Chemistry databases

BindingDBiO60333.
ChEMBLiCHEMBL5889.

PTM databases

iPTMnetiO60333.
PhosphoSitePlusiO60333.
SwissPalmiO60333.

Polymorphism and mutation databases

BioMutaiKIF1B.

Proteomic databases

EPDiO60333.
MaxQBiO60333.
PaxDbiO60333.
PeptideAtlasiO60333.
PRIDEiO60333.

Protocols and materials databases

DNASUi23095.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000263934; ENSP00000263934; ENSG00000054523. [O60333-2]
ENST00000377081; ENSP00000366284; ENSG00000054523. [O60333-4]
ENST00000377083; ENSP00000366287; ENSG00000054523. [O60333-3]
ENST00000377086; ENSP00000366290; ENSG00000054523. [O60333-1]
ENST00000377093; ENSP00000366297; ENSG00000054523. [O60333-3]
GeneIDi23095.
KEGGihsa:23095.
UCSCiuc001aqv.5. human. [O60333-1]

Organism-specific databases

CTDi23095.
DisGeNETi23095.
GeneCardsiKIF1B.
HGNCiHGNC:16636. KIF1B.
HPAiCAB015177.
HPA026434.
MalaCardsiKIF1B.
MIMi118210. phenotype.
171300. phenotype.
256700. phenotype.
605995. gene.
neXtProtiNX_O60333.
OpenTargetsiENSG00000054523.
Orphaneti99946. Autosomal dominant Charcot-Marie-Tooth disease type 2A1.
PharmGKBiPA38176.
HUGEiSearch...
Search...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0245. Eukaryota.
COG5059. LUCA.
GeneTreeiENSGT00840000129680.
HOGENOMiHOG000165968.
HOVERGENiHBG052251.
InParanoidiO60333.
KOiK10392.
OMAiGQSMSKY.
OrthoDBiEOG091G009V.
PhylomeDBiO60333.
TreeFamiTF105221.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000054523-MONOMER.
ReactomeiR-HSA-6811434. COPI-dependent Golgi-to-ER retrograde traffic.
R-HSA-983189. Kinesins.

Miscellaneous databases

ChiTaRSiKIF1B. human.
EvolutionaryTraceiO60333.
GeneWikiiKIF1B.
GenomeRNAii23095.
PROiO60333.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000054523.
CleanExiHS_KIF1B.
ExpressionAtlasiO60333. baseline and differential.
GenevisibleiO60333. HS.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
2.60.200.20. 1 hit.
3.40.850.10. 1 hit.
InterProiIPR000253. FHA_dom.
IPR022164. Kinesin-like.
IPR027640. Kinesin-like_fam.
IPR022140. Kinesin-like_KIF1-typ.
IPR032405. Kinesin_assoc.
IPR019821. Kinesin_motor_CS.
IPR001752. Kinesin_motor_dom.
IPR027417. P-loop_NTPase.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR008984. SMAD_FHA_domain.
[Graphical view]
PANTHERiPTHR24115. PTHR24115. 3 hits.
PfamiPF12473. DUF3694. 1 hit.
PF00498. FHA. 1 hit.
PF12423. KIF1B. 1 hit.
PF00225. Kinesin. 1 hit.
PF16183. Kinesin_assoc. 1 hit.
PF00169. PH. 1 hit.
[Graphical view]
PRINTSiPR00380. KINESINHEAVY.
SMARTiSM00240. FHA. 1 hit.
SM00129. KISc. 1 hit.
SM00233. PH. 1 hit.
[Graphical view]
SUPFAMiSSF49879. SSF49879. 1 hit.
SSF50729. SSF50729. 2 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS50006. FHA_DOMAIN. 1 hit.
PS00411. KINESIN_MOTOR_1. 1 hit.
PS50067. KINESIN_MOTOR_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiKIF1B_HUMAN
AccessioniPrimary (citable) accession number: O60333
Secondary accession number(s): A6NFS8
, A6NKQ4, Q4VXC3, Q4VXC4, Q4VXC5, Q4VXC6, Q96Q94, Q9BV80, Q9P280
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: October 17, 2006
Last modified: November 2, 2016
This is version 183 of the entry and version 5 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.