Reviewed,
UniProtKB/Swiss-Prot O60333 (KIF1B_HUMAN)
Last modified
June 16, 2009.
Version 101.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Kinesin-like protein KIF1B Short name=Klp | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1816 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Motor for anterograde transport of mitochondria. Has a microtubule plus end-directed motility. |
| Subunit structure | Interacts with KBP. Ref.13 |
| Subcellular location | Cytoplasmic vesicle By similarity. Cytoplasm › cytoskeleton By similarity. Mitochondrion. |
| Tissue specificity | Isoform 3 is abundant in the skeletal muscle. It is also expressed in fetal brain, lung and kidney, and adult heart, placenta, testis, ovary and small intestine. Isoform 2 is abundant in the brain and also expressed in fetal heart, lung, liver and kidney, and adult skeletal muscle, placenta, liver, kidney, heart, spleen, thymus, prostate, testis, ovary, small intestine, colon and pancreas. Ref.2 Ref.3 Ref.5 |
| Involvement in disease | Defects in KIF1B are the cause of Charcot-Marie-Tooth disease type 2A1 (CMT2A1) [MIM:118210]. CMT2A1 is a form of Charcot-Marie-Tooth disease, the most common inherited disorder of the peripheral nervous system. Charcot-Marie-Tooth disease is classified in two main groups on the basis of electrophysiologic properties and histopathology: primary peripheral demyelinating neuropathy or CMT1, and primary peripheral axonal neuropathy or CMT2. Neuropathies of the CMT2 group are characterized by signs of axonal regeneration in the absence of obvious myelin alterations, normal or slightly reduced nerve conduction velocities, and progressive distal muscle weakness and atrophy. Ref.17 |
| Sequence similarities | Belongs to the kinesin-like protein family. Unc-104 subfamily. Contains 1 FHA domain. Contains 1 kinesin-motor domain. Contains 1 PH domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| DLG1 | Q12959 | 1 | EBI-465669,EBI-357481 | |
| DLG4 | P78352 | 1 | EBI-465669,EBI-80389 | |
| MAGI1 | Q96QZ7 | 1 | EBI-465669,EBI-924464 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O60333-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O60333-2) Also known as: Beta; The sequence of this isoform differs from the canonical sequence as follows: 289-294: Missing. 394-434: IDPLIDDYSGSGSKYLKDFQNNKHRYLLASENQRPGHFSTA → T | ||||||
| Isoform 3 (identifier: O60333-3) Also known as: Alpha; The sequence of this isoform differs from the canonical sequence as follows: 289-294: Missing. 394-434: IDPLIDDYSGSGSKYLKDFQNNKHRYLLASENQRPGHFSTA → T 707-1196: YESKLQALQK...KPIVFEVFGH → ADSDSGDDSD...NLKAGRETTV 1197-1816: Missing. | ||||||
| Isoform 4 (identifier: O60333-4) The sequence of this isoform differs from the canonical sequence as follows: 1804-1816: SKLSRRCPSQSKY → PGHLASEIIREDKSVSFSCQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1816 | 1816 | Kinesin-like protein KIF1B | PRO_0000125407 | |||||
Regions | |||||||||
| Domain | 1 – 361 | 361 | Kinesin-motor | ||||||
| Domain | 556 – 612 | 57 | FHA | ||||||
| Domain | 1702 – 1799 | 98 | PH | ||||||
| Nucleotide binding | 97 – 104 | 8 | ATP By similarity | ||||||
| Region | 270 – 350 | 81 | Interaction with KBP | ||||||
| Coiled coil | 365 – 386 | 22 | Potential | ||||||
| Coiled coil | 470 – 502 | 33 | Potential | ||||||
| Coiled coil | 668 – 737 | 70 | Potential | ||||||
| Coiled coil | 841 – 869 | 29 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 1057 | 1 | Phosphoserine Ref.12 Ref.15 | ||||||
| Modified residue | 1454 | 1 | Phosphoserine Ref.12 | ||||||
| Modified residue | 1487 | 1 | Phosphoserine Ref.15 Ref.14 | ||||||
Natural variations | |||||||||
| Alternative sequence | 289 – 294 | 6 | Missing in isoform 2 and isoform 3. | VSP_002858 | |||||
| Alternative sequence | 394 – 434 | 41 | IDPLI…HFSTA → T in isoform 2 and isoform 3. | VSP_002859 | |||||
| Alternative sequence | 707 – 1196 | 490 | YESKL…EVFGH → ADSDSGDDSDKRSCEESWKL ITSLREKLPPSKLQTIVKKC GLPSSGKKREPIKMYQIPQR RRLSKDSKWVTISDLKIQAV KEICYEVALNDFRHSRQEIE ALAIVKMKELCAMYGKKDPN ERDSWRAVARDVWDTVGVGD EKIEDVMATGKGSTDVDDLK VHIDKLEDILQEVKKQNNMK DEEIKVLRNKMLKMEKVLPL IGSQEQKSPGSHKAKEPVGA GVSSTSENNVSKGDNGELAK EERVSQLMNGDPAFRRGRLR WMRQEQIRFKNLQQQEITKQ LRRQNVPHRFIPPENRKPRF PFKSNPKHRNSWSPGTHIII TEDEVIELRIPKDDEARKGN KEESQEKGGKGAFKDPQFPW GSQGMRSQDHIQVSKQHINN QQQPPQLRWRSNSLNNGQPK STRCQASASAESLNSHSGHP TADVQTFQAKRHIHQHRQSY CNYNTGGQLEGNAATSYQKQ TDKPSHCSQFVTPPRMRRQF SAPNLKAGRETTV in isoform 3. | VSP_002860 | |||||
| Alternative sequence | 1197 – 1816 | 620 | Missing in isoform 3. | VSP_002861 | |||||
| Alternative sequence | 1804 – 1816 | 13 | SKLSR…SQSKY → PGHLASEIIREDKSVSFSCQ in isoform 4. | VSP_009381 | |||||
| Natural variant | 98 | 1 | Q → L in CMT2A1. Ref.17 | VAR_011515 | |||||
Experimental info | |||||||||
| Sequence conflict | 87 | 1 | E → G in BAA25517. Ref.7 | ||||||
| Sequence conflict | 129 – 131 | 3 | KIN → TNH in AAK49332. Ref.3 | ||||||
| Sequence conflict | 129 – 131 | 3 | KIN → TNH in AAK85155. Ref.4 | ||||||
| Sequence conflict | 129 – 131 | 3 | KIN → TNH in AAN17742. Ref.5 | ||||||
| Sequence conflict | 170 | 1 | E → D in AAK49332. Ref.3 | ||||||
| Sequence conflict | 170 | 1 | E → D in AAK85155. Ref.4 | ||||||
| Sequence conflict | 170 | 1 | E → D in AAN17742. Ref.5 | ||||||
| Sequence conflict | 174 | 1 | L → R in AAK49332. Ref.3 | ||||||
| Sequence conflict | 174 | 1 | L → R in AAK85155. Ref.4 | ||||||
| Sequence conflict | 174 | 1 | L → R in AAN17742. Ref.5 | ||||||
| Sequence conflict | 219 – 221 | 3 | AVF → VVY in AAK49332. Ref.3 | ||||||
| Sequence conflict | 219 – 221 | 3 | AVF → VVY in AAK85155. Ref.4 | ||||||
| Sequence conflict | 219 – 221 | 3 | AVF → VVY in AAN17742. Ref.5 | ||||||
| Sequence conflict | 235 – 239 | 5 | NLSTE → ILATV in AAK49332. Ref.3 | ||||||
| Sequence conflict | 235 – 239 | 5 | NLSTE → ILATV in AAK85155. Ref.4 | ||||||
| Sequence conflict | 235 – 239 | 5 | NLSTE → ILATV in AAN17742. Ref.5 | ||||||
| Sequence conflict | 244 | 1 | I → T in AAK49332. Ref.3 | ||||||
| Sequence conflict | 244 | 1 | I → T in AAK85155. Ref.4 | ||||||
| Sequence conflict | 244 | 1 | I → T in AAN17742. Ref.5 | ||||||
| Sequence conflict | 253 | 1 | E → D in AAK49332. Ref.3 | ||||||
| Sequence conflict | 253 | 1 | E → D in AAK85155. Ref.4 | ||||||
| Sequence conflict | 253 | 1 | E → D in AAN17742. Ref.5 | ||||||
| Sequence conflict | 256 | 1 | D → A in AAK49332. Ref.3 | ||||||
| Sequence conflict | 256 | 1 | D → A in AAK85155. Ref.4 | ||||||
| Sequence conflict | 256 | 1 | D → A in AAN17742. Ref.5 | ||||||
| Sequence conflict | 270 | 1 | N → I in AAK49332. Ref.3 | ||||||
| Sequence conflict | 270 | 1 | N → I in AAK85155. Ref.4 | ||||||
| Sequence conflict | 270 | 1 | N → I in AAN17742. Ref.5 | ||||||
| Sequence conflict | 363 | 1 | D → G in BAB69038. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "DNA encoding a kinesin-like protein (hklp) comprising biallelic markers." Bougueleret L., Dufaure-Gare I., Grel P. Patent number WO0063375, 26-OCT-2000 Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1). |
| [2] | "Identification of the full-length KIAA0591 gene encoding a novel kinesin-related protein which is mapped to the neuroblastoma suppressor gene locus at 1p36.2." Nagai M., Ichimiya S., Ozaki T., Seki N., Mihara M., Furuta S., Ohira M., Tomioka N., Nomura N., Sakiyama S., Kubo O., Takakura K., Hori T., Nakagawara A. Int. J. Oncol. 16:907-916(2000) [PubMed: 10762626] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), TISSUE SPECIFICITY. Tissue: Substantia nigra. |
| [3] | "Genomic structure and mutational analysis of the human KIF1B gene which is homozygously deleted in neuroblastoma at chromosome 1p36.2." Yang H.W., Chen Y.Z., Takita J., Soeda E., Piao H.Y., Hayashi Y. Oncogene 20:5075-5083(2001) [PubMed: 11526494] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 2), TISSUE SPECIFICITY. |
| [4] | "Identification of the human ortholog of mouse Kif1B, a kinesin superfamily motor protein." Park M., Shin H., Lee Y.M., Moon E., Choi W., Kim W. Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). |
| [5] | "Genomic structure and mutational analysis of the human KIF1Balpha gene located at 1p36.2 in neuroblastoma." Chen Y.Y., Takita J., Chen Y.Z., Yang H.W., Hanada R., Yamamoto K., Hayashi Y. Int. J. Oncol. 23:737-744(2003) [PubMed: 12888911] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY. Tissue: Neuroblastoma. |
| [6] | "Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro." Nagase T., Ishikawa K., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:31-39(1998) [PubMed: 9628581] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [7] | "Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O. DNA Res. 7:143-150(2000) [PubMed: 10819331] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Brain. |
| [8] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed: 16710414] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1238-1816 (ISOFORMS 1/2). Tissue: Placenta. |
| [10] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1238-1816 (ISOFORMS 1/2). |
| [11] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1449-1816 (ISOFORMS 1/2). |
| [12] | "Large-scale characterization of HeLa cell nuclear phosphoproteins." Beausoleil S.A., Jedrychowski M., Schwartz D., Elias J.E., Villen J., Li J., Cohn M.A., Cantley L.C., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 101:12130-12135(2004) [PubMed: 15302935] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1057 AND SER-1454, MASS SPECTROMETRY. Tissue: Epithelium. |
| [13] | "The novel protein KBP regulates mitochondria localization by interaction with a kinesin-like protein." Wozniak M.J., Melzer M., Dorner C., Haring H.U., Lammers R. BMC Cell Biol. 6:35-35(2005) [PubMed: 16225668] [Abstract] Cited for: INTERACTION WITH KBP, SUBCELLULAR LOCATION. |
| [14] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1487, MASS SPECTROMETRY. Tissue: Epithelium. |
| [15] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1057 AND SER-1487, MASS SPECTROMETRY. |
| [16] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [17] | "Charcot-Marie-Tooth disease type 2A caused by mutation in a microtubule motor KIF1B-beta." Zhao C., Takita J., Tanaka Y., Setou M., Nakagawa T., Takeda S., Yang H.W., Terada S., Nakata T., Takei Y., Saito M., Tsuji S., Hayashi Y., Hirokawa N. Cell 105:587-597(2001) [PubMed: 11389829] [Abstract] Cited for: VARIANT CMT2A1 LEU-98. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| AX039604 Unassigned DNA. Translation: CAC16629.1. AB017133 mRNA. Translation: BAB69038.1. Different initiation. AF257176 mRNA. Translation: AAK49332.1. AY043362 mRNA. Translation: AAK85155.1. AY139835 mRNA. Translation: AAN17742.1. AB011163 mRNA. Translation: BAA25517.2. Different initiation. AB040881 mRNA. Translation: BAA95972.2. Different initiation. AL139424, AL358013 Genomic DNA. Translation: CAI95753.1. AL358013, AL139424 Genomic DNA. Translation: CAI95219.1. AL358013 Genomic DNA. Translation: CAI95222.1. BC001415 mRNA. Translation: AAH01415.1. Different initiation. BC115395 mRNA. Translation: AAI15396.1. BT007174 mRNA. Translation: AAP35838.1. Different initiation. AK022977 mRNA. Translation: BAB14341.1. | |||||||||||||
| IPI | IPI00029011. IPI00216252. IPI00397383. IPI00411763. | ||||||||||||
| RefSeq | NP_055889.2. NP_904325.2. | ||||||||||||
| UniGene | Hs.97858 | ||||||||||||
3D structure databases | |||||||||||||
| |||||||||||||
| SMR | O60333. Positions 4-353. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | O60333. 11 interactions. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | O60333. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | O60333. | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENSG00000054523. Homo sapiens. [Contig view] | ||||||||||||
| GeneID | 23095. | ||||||||||||
| KEGG | hsa:23095. | ||||||||||||
Organism-specific databases | |||||||||||||
| GeneCards | GC01P010205. | ||||||||||||
| HGNC | HGNC:16636. KIF1B. | ||||||||||||
| HPA | CAB015177. | ||||||||||||
| MIM | 118210. phenotype. 605995. gene. | ||||||||||||
| Orphanet | 64746. Autosomal dominant Charcot-Marie-Tooth disease, type 2. 99946. Autosomal dominant Charcot-Marie-Tooth disease, type 2A1. | ||||||||||||
| PharmGKB | PA38176. | ||||||||||||
| HUGE | Search... Search... | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| HOVERGEN | O60333. | ||||||||||||
| OMA | O60333. THIIITD. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | O60333. | ||||||||||||
| Bgee | O60333. | ||||||||||||
| CleanEx | HS_KIF1B. | ||||||||||||
| GermOnline | ENSG00000054523. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR000253. FHA. IPR001752. Kinesin_motor. IPR019821. Kinesin_motor_CS. IPR011993. PH_type. IPR001849. Pleckstrin_homology. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:3.40.850.10. kinesin_motor. 1 hit. G3DSA:2.30.29.30. PH_type. 1 hit. | ||||||||||||
| Pfam | PF00498. FHA. 1 hit. PF00225. Kinesin. 1 hit. PF00169. PH. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR00380. KINESINHEAVY. | ||||||||||||
| SMART | SM00240. FHA. 1 hit. SM00129. KISc. 1 hit. SM00233. PH. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS50006. FHA_DOMAIN. 1 hit. PS00411. KINESIN_MOTOR_DOMAIN1. 1 hit. PS50067. KINESIN_MOTOR_DOMAIN2. 1 hit. PS50003. PH_DOMAIN. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other Resources | |||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | KIF1B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O60333 Secondary accession number(s): A6NKQ4 Q9P280 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


