Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 500

Gene

ZNF500

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri325 – 347C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri353 – 375C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri381 – 403C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri409 – 431C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri437 – 459C2H2-type 5PROSITE-ProRule annotationAdd BLAST23

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:ENSG00000103199-MONOMER.
ReactomeiR-HSA-212436. Generic Transcription Pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 500
Alternative name(s):
Zinc finger protein with KRAB and SCAN domains 18
Gene namesi
Name:ZNF500
Synonyms:KIAA0557, ZKSCAN18
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:23716. ZNF500.

Subcellular locationi

  • Nucleus PROSITE-ProRule annotation

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000103199.
PharmGKBiPA134969305.

Polymorphism and mutation databases

BioMutaiZNF500.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000476201 – 480Zinc finger protein 500Add BLAST480

Proteomic databases

PaxDbiO60304.
PeptideAtlasiO60304.
PRIDEiO60304.

PTM databases

iPTMnetiO60304.
PhosphoSitePlusiO60304.

Expressioni

Gene expression databases

BgeeiENSG00000103199.
CleanExiHS_ZNF500.
ExpressionAtlasiO60304. baseline and differential.
GenevisibleiO60304. HS.

Organism-specific databases

HPAiHPA035498.
HPA057963.

Interactioni

Protein-protein interaction databases

BioGridi117511. 1 interactor.
STRINGi9606.ENSP00000219478.

Structurei

3D structure databases

ProteinModelPortaliO60304.
SMRiO60304.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini50 – 134SCAN boxPROSITE-ProRule annotationAdd BLAST85
Domaini224 – 260KRABAdd BLAST37

Sequence similaritiesi

Contains 5 C2H2-type zinc fingers.PROSITE-ProRule annotation
Contains 1 KRAB domain.Curated
Contains 1 SCAN box domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri325 – 347C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri353 – 375C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri381 – 403C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri409 – 431C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri437 – 459C2H2-type 5PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00760000118881.
HOGENOMiHOG000234619.
HOVERGENiHBG018163.
InParanoidiO60304.
KOiK09229.
OMAiPVRMEWY.
OrthoDBiEOG091G09O3.
PhylomeDBiO60304.
TreeFamiTF341940.

Family and domain databases

CDDicd07765. KRAB_A-box. 1 hit.
Gene3Di3.30.160.60. 5 hits.
InterProiIPR001909. KRAB.
IPR008916. Retrov_capsid_C.
IPR003309. SCAN_dom.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF01352. KRAB. 1 hit.
PF02023. SCAN. 1 hit.
PF00096. zf-C2H2. 2 hits.
PF13912. zf-C2H2_6. 1 hit.
[Graphical view]
SMARTiSM00431. SCAN. 1 hit.
SM00355. ZnF_C2H2. 5 hits.
[Graphical view]
SUPFAMiSSF109640. SSF109640. 1 hit.
SSF47353. SSF47353. 1 hit.
PROSITEiPS50804. SCAN_BOX. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 5 hits.
PS50157. ZINC_FINGER_C2H2_2. 5 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O60304-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATVPGLQPL PTLEQDLEQE EILIVKVEED FCLEEEPSVE TEDPSPETFR
60 70 80 90 100
QLFRLFCYQE VAGPREALSR LWELCCRWLR PELRTKEQIL ELLVLEQFLT
110 120 130 140 150
VLPGEIQARV REQQPESGEE AVVLVEGLQR KPRKHRQRGS ELLSDDEVPL
160 170 180 190 200
GIGGQFLKHQ AEAQPEDLSL EEEARFSSQQ PPAQLSHRPQ RGPLLWPERG
210 220 230 240 250
PPAPRHQEMA SASPFLSAWS QVPVNLEDVA VYLSGEEPRC MDPAQRDAPL
260 270 280 290 300
ENEGPGIQLE DGGDGREDAP LRMEWYRVLS ARCQGPGHPL PGQRPAPVRG
310 320 330 340 350
LVRPDQPRGG PPPGRRASHG ADKPYTCPEC GKGFSKTSHL TKHQRTHTGE
360 370 380 390 400
RPYKCLVCGK GFSDRSNFST HQRVHTGEKP YPCPECGKRF SQSSSLVIHR
410 420 430 440 450
RTHSGERPYA CTQCGKRFNN SSHFSAHRRT HTGEKPYTCP ACGRGFRRGT
460 470 480
DLHKHQRTHM GAGSLPTLQP VAPGGPGAKA
Length:480
Mass (Da):53,674
Last modified:January 16, 2004 - v2
Checksum:i9AB0F456F2DC5580
GO
Isoform 2 (identifier: O60304-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     434-480: EKPYTCPACGRGFRRGTDLHKHQRTHMGAGSLPTLQPVAPGGPGAKA → HILRSGCT

Note: No experimental confirmation available.
Show »
Length:441
Mass (Da):49,649
Checksum:iAB2E9AF8B35A582E
GO

Sequence cautioni

The sequence BAA25483 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_055962434 – 480EKPYT…PGAKA → HILRSGCT in isoform 2. 1 PublicationAdd BLAST47

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB011129 mRNA. Translation: BAA25483.1. Different initiation.
AK291792 mRNA. Translation: BAF84481.1.
AK297993 mRNA. Translation: BAG60301.1.
AC020663 Genomic DNA. No translation available.
BC004125 mRNA. Translation: AAH04125.2.
BC121013 mRNA. Translation: AAI21014.1.
CCDSiCCDS32383.1. [O60304-1]
CCDS76814.1. [O60304-2]
RefSeqiNP_001290379.1. NM_001303450.1. [O60304-2]
NP_067678.1. NM_021646.3. [O60304-1]
UniGeneiHs.513316.

Genome annotation databases

EnsembliENST00000219478; ENSP00000219478; ENSG00000103199. [O60304-1]
ENST00000545009; ENSP00000445714; ENSG00000103199. [O60304-2]
GeneIDi26048.
KEGGihsa:26048.
UCSCiuc002cxp.2. human. [O60304-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB011129 mRNA. Translation: BAA25483.1. Different initiation.
AK291792 mRNA. Translation: BAF84481.1.
AK297993 mRNA. Translation: BAG60301.1.
AC020663 Genomic DNA. No translation available.
BC004125 mRNA. Translation: AAH04125.2.
BC121013 mRNA. Translation: AAI21014.1.
CCDSiCCDS32383.1. [O60304-1]
CCDS76814.1. [O60304-2]
RefSeqiNP_001290379.1. NM_001303450.1. [O60304-2]
NP_067678.1. NM_021646.3. [O60304-1]
UniGeneiHs.513316.

3D structure databases

ProteinModelPortaliO60304.
SMRiO60304.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117511. 1 interactor.
STRINGi9606.ENSP00000219478.

PTM databases

iPTMnetiO60304.
PhosphoSitePlusiO60304.

Polymorphism and mutation databases

BioMutaiZNF500.

Proteomic databases

PaxDbiO60304.
PeptideAtlasiO60304.
PRIDEiO60304.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000219478; ENSP00000219478; ENSG00000103199. [O60304-1]
ENST00000545009; ENSP00000445714; ENSG00000103199. [O60304-2]
GeneIDi26048.
KEGGihsa:26048.
UCSCiuc002cxp.2. human. [O60304-1]

Organism-specific databases

CTDi26048.
GeneCardsiZNF500.
HGNCiHGNC:23716. ZNF500.
HPAiHPA035498.
HPA057963.
neXtProtiNX_O60304.
OpenTargetsiENSG00000103199.
PharmGKBiPA134969305.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00760000118881.
HOGENOMiHOG000234619.
HOVERGENiHBG018163.
InParanoidiO60304.
KOiK09229.
OMAiPVRMEWY.
OrthoDBiEOG091G09O3.
PhylomeDBiO60304.
TreeFamiTF341940.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000103199-MONOMER.
ReactomeiR-HSA-212436. Generic Transcription Pathway.

Miscellaneous databases

ChiTaRSiZNF500. human.
GenomeRNAii26048.
PROiO60304.

Gene expression databases

BgeeiENSG00000103199.
CleanExiHS_ZNF500.
ExpressionAtlasiO60304. baseline and differential.
GenevisibleiO60304. HS.

Family and domain databases

CDDicd07765. KRAB_A-box. 1 hit.
Gene3Di3.30.160.60. 5 hits.
InterProiIPR001909. KRAB.
IPR008916. Retrov_capsid_C.
IPR003309. SCAN_dom.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF01352. KRAB. 1 hit.
PF02023. SCAN. 1 hit.
PF00096. zf-C2H2. 2 hits.
PF13912. zf-C2H2_6. 1 hit.
[Graphical view]
SMARTiSM00431. SCAN. 1 hit.
SM00355. ZnF_C2H2. 5 hits.
[Graphical view]
SUPFAMiSSF109640. SSF109640. 1 hit.
SSF47353. SSF47353. 1 hit.
PROSITEiPS50804. SCAN_BOX. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 5 hits.
PS50157. ZINC_FINGER_C2H2_2. 5 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiZN500_HUMAN
AccessioniPrimary (citable) accession number: O60304
Secondary accession number(s): A8K6X7
, B4DNN9, Q0VAL2, Q96CQ8, Q9BTG0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 16, 2004
Last sequence update: January 16, 2004
Last modified: November 2, 2016
This is version 140 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.